Historia de #mexico 13/05/2026 19:33 18 visitas

Hour Alias Mensaje Mensaje
[19:33] Jirafa\Letal !jugar [19:33] Jirafa\Letal
!jugar
[19:33] Caracol}Elocuente EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!! [19:33] Caracol}Elocuente
EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!!
[19:33] Caracol}Elocuente R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206 [19:33] Caracol}Elocuente
R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206
[19:33] Caracol}Elocuente Tri.5920 Cotilleo-TVɣarlovigo˿Friends-߃ualsesulatprofesionhdeoMonica?n?n [19:33] Caracol}Elocuente
Tri.5920 Cotilleo-TVɣarlovigo˿Friends-߃ualsesulatprofesionhdeoMonica?n?n
[19:33] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 5123 Puntos [19:33] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 5123 Puntos
[19:33] Caracol}Elocuente 2 Pista: coc***** 30 segundos y 5123 Puntos [19:33] Caracol}Elocuente
2 Pista: coc***** 30 segundos y 5123 Puntos
[19:33] Caracol}Elocuente 3 Pista: coci*e*a 15 segundos y 5123 Puntos [19:33] Caracol}Elocuente
3 Pista: coci*e*a 15 segundos y 5123 Puntos
[19:34] Caracol}Elocuente Tiempo! La respuesta es -> cocinera <- [19:34] Caracol}Elocuente
Tiempo! La respuesta es -> cocinera <-
[19:34] Caracol}Elocuente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [19:34] Caracol}Elocuente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[19:34] Caracol}Elocuente Tri.18441 GastronomiaɁker˿ENhASTURIAShDECIMOSh'ALhPANhPANhYhALhVINOhVINO',hPEROhBEBERhBEBEMOSh?h [19:34] Caracol}Elocuente
Tri.18441 GastronomiaɁker˿ENhASTURIAShDECIMOSh'ALhPANhPANhYhALhVINOhVINO',hPEROhBEBERhBEBEMOSh?h
[19:34] Caracol}Elocuente 1 Pista: ***** Valor pregunta : 18167 Puntos [19:34] Caracol}Elocuente
1 Pista: ***** Valor pregunta : 18167 Puntos
[19:34] Caracol}Elocuente 2 Pista: sid** 30 segundos y 18167 Puntos [19:34] Caracol}Elocuente
2 Pista: sid** 30 segundos y 18167 Puntos
[19:34] Jirafa\Letal sidos [19:34] Jirafa\Letal
sidos
[19:34] Caracol}Elocuente 3 Pista: sid*a 15 segundos y 18167 Puntos [19:34] Caracol}Elocuente
3 Pista: sid*a 15 segundos y 18167 Puntos
[19:34] Jirafa\Letal sidoa [19:34] Jirafa\Letal
sidoa
[19:34] Jirafa\Letal sidea [19:34] Jirafa\Letal
sidea
[19:34] Caracol}Elocuente Tiempo! La respuesta es -> sidra <- [19:34] Caracol}Elocuente
Tiempo! La respuesta es -> sidra <-
[19:35] Jirafa\Letal sidra [19:35] Jirafa\Letal
sidra
[19:35] Caracol}Elocuente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [19:35] Caracol}Elocuente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[19:35] Caracol}Elocuente Tri.13131 Idiomasɲaziel9˿ESPA񏌭-->FRANCES:lunesp?i [19:35] Caracol}Elocuente
Tri.13131 Idiomasɲaziel9˿ESPA񏌭-->FRANCES:lunesp?i
[19:35] Caracol}Elocuente 1 Pista: ***** Valor pregunta : 7315 Puntos [19:35] Caracol}Elocuente
1 Pista: ***** Valor pregunta : 7315 Puntos
[19:35] Caracol}Elocuente 2 Pista: lun** 30 segundos y 7315 Puntos [19:35] Caracol}Elocuente
2 Pista: lun** 30 segundos y 7315 Puntos
[19:35] Jirafa\Letal lunes [19:35] Jirafa\Letal
lunes
[19:35] Caracol}Elocuente 3 Pista: lun*i 15 segundos y 7315 Puntos [19:35] Caracol}Elocuente
3 Pista: lun*i 15 segundos y 7315 Puntos
[19:35] Jirafa\Letal lunni [19:35] Jirafa\Letal
lunni
[19:35] Jirafa\Letal lunai [19:35] Jirafa\Letal
lunai
[19:35] Caracol}Elocuente Tiempo! La respuesta es -> lundi <- [19:35] Caracol}Elocuente
Tiempo! La respuesta es -> lundi <-
[19:36] Caracol}Elocuente R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 898255 #5: siva- 692906 #6: Ketzy 610145 #7: Danielitto 397196 #8: Cosmo 285557 #9: hombre_bcn_48 264481 #10: Moog 180382 [19:36] Caracol}Elocuente
R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 898255 #5: siva- 692906 #6: Ketzy 610145 #7: Danielitto 397196 #8: Cosmo 285557 #9: hombre_bcn_48 264481 #10: Moog 180382
[19:36] Caracol}Elocuente Tri.17760 Arteɖivian˿ElxBalletqdelxTeatrodBolsh󩃰1zesjunaicompa񭡮..d?d [19:36] Caracol}Elocuente
Tri.17760 Arteɖivian˿ElxBalletqdelxTeatrodBolsh󩃰1zesjunaicompa񭡮..d?d
[19:36] Caracol}Elocuente 1 Pista: **** Valor pregunta : 13983 Puntos [19:36] Caracol}Elocuente
1 Pista: **** Valor pregunta : 13983 Puntos
[19:36] Caracol}Elocuente 2 Pista: rus* 30 segundos y 13983 Puntos [19:36] Caracol}Elocuente
2 Pista: rus* 30 segundos y 13983 Puntos
[19:36] Jirafa\Letal ruso [19:36] Jirafa\Letal
ruso
[19:36] Jirafa\Letal rusa [19:36] Jirafa\Letal
rusa
[19:36] Caracol}Elocuente �Increible!! Jirafa\Letal contest󺠃04"rusa" en �3.141 segundos, y ha ganado �3983�12 puntos [19:36] Caracol}Elocuente
�Increible!! Jirafa\Letal contest󺠃04"rusa" en �3.141 segundos, y ha ganado �3983�12 puntos
[19:36] Caracol}Elocuente ACTION Aplausos Jirafa\Letal una Pepsi y pizza por 900000 victorias!! Ole Jirafa\Letal!!! [19:36] Caracol}Elocuente
ACTION Aplausos Jirafa\Letal una Pepsi y pizza por 900000 victorias!! Ole Jirafa\Letal!!!
[19:36] Caracol}Elocuente ACTION awards Jirafa\Letal with a +v for having over 15000 points [19:36] Caracol}Elocuente
ACTION awards Jirafa\Letal with a +v for having over 15000 points
[19:36] Caracol}Elocuente Jirafa\Letal has acertado 4 seguidas!! Puntos HOY: 658487, SEMANA: 912238 y MES: 2030365 [19:36] Caracol}Elocuente
Jirafa\Letal has acertado 4 seguidas!! Puntos HOY: 658487, SEMANA: 912238 y MES: 2030365
[19:36] Caracol}Elocuente We feature over 50,000 Q&A ! [19:36] Caracol}Elocuente
We feature over 50,000 Q&A !
[19:36] Caracol}Elocuente Tri.9026 Medicina-Saludɳtephenwo˿Elementouaupartepdeplauescayolauquepsirvepparauinmovilizarzlosrhuesosrdesdepfuera?p?p [19:36] Caracol}Elocuente
Tri.9026 Medicina-Saludɳtephenwo˿Elementouaupartepdeplauescayolauquepsirvepparauinmovilizarzlosrhuesosrdesdepfuera?p?p
[19:36] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 5406 Puntos [19:36] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 5406 Puntos
[19:36] Caracol}Elocuente 2 Pista: fer*** 30 segundos y 5406 Puntos [19:36] Caracol}Elocuente
2 Pista: fer*** 30 segundos y 5406 Puntos
[19:37] Jirafa\Letal fernos [19:37] Jirafa\Letal
fernos
[19:37] Caracol}Elocuente 3 Pista: feru*a 15 segundos y 5406 Puntos [19:37] Caracol}Elocuente
3 Pista: feru*a 15 segundos y 5406 Puntos
[19:37] Caracol}Elocuente �Bingo!! Jirafa\Letal dio la respuesta: "ferula" en �7.156 segundos e incrementa sus ganancias con �406�12 puntos [19:37] Caracol}Elocuente
�Bingo!! Jirafa\Letal dio la respuesta: "ferula" en �7.156 segundos e incrementa sus ganancias con �406�12 puntos
[19:37] Caracol}Elocuente ACTION awards Jirafa\Letal with a +v for having over 15000 points [19:37] Caracol}Elocuente
ACTION awards Jirafa\Letal with a +v for having over 15000 points
[19:37] Caracol}Elocuente Jirafa\Letal has acertado 5 seguidas!! Puntos HOY: 663893, SEMANA: 917644 y MES: 2035771 [19:37] Caracol}Elocuente
Jirafa\Letal has acertado 5 seguidas!! Puntos HOY: 663893, SEMANA: 917644 y MES: 2035771
[19:37] Jirafa\Letal ferula [19:37] Jirafa\Letal
ferula
[19:37] Caracol}Elocuente R᮫ing de HOY: - #1: Gladiadora_del_Caribe 686734 #2: Jirafa\Letal 663893 #3: Grillo{Naranja 616922 #4: Danielitto 347196 #5: Paulus 317541 #6: Cosmo 285557 #7: Ketzy 38872 #8: * 0 #9: * 0 #10: * 0 [19:37] Caracol}Elocuente
R᮫ing de HOY: - #1: Gladiadora_del_Caribe 686734 #2: Jirafa\Letal 663893 #3: Grillo{Naranja 616922 #4: Danielitto 347196 #5: Paulus 317541 #6: Cosmo 285557 #7: Ketzy 38872 #8: * 0 #9: * 0 #10: * 0
[19:37] Caracol}Elocuente Tri.10932 Geografiaɣarlovigo˿EnjqueuoceanofsituariasllaslIslaslMaldivas?h?h [19:37] Caracol}Elocuente
Tri.10932 Geografiaɣarlovigo˿EnjqueuoceanofsituariasllaslIslaslMaldivas?h?h
[19:37] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 8433 Puntos [19:37] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 8433 Puntos
[19:37] Caracol}Elocuente 2 Pista: ind*** 30 segundos y 8433 Puntos [19:37] Caracol}Elocuente
2 Pista: ind*** 30 segundos y 8433 Puntos
[19:37] Jirafa\Letal indico [19:37] Jirafa\Letal
indico
[19:37] Caracol}Elocuente �As�e hace Jirafa\Letal!! Contestaste "indico" en �3.828 segundos y sumas �433�12 puntos [19:37] Caracol}Elocuente
�As�e hace Jirafa\Letal!! Contestaste "indico" en �3.828 segundos y sumas �433�12 puntos
[19:37] Caracol}Elocuente ACTION awards Jirafa\Letal with a +v for having over 15000 points [19:37] Caracol}Elocuente
ACTION awards Jirafa\Letal with a +v for having over 15000 points
[19:37] Caracol}Elocuente Jirafa\Letal has acertado 6 seguidas!! Puntos HOY: 672326, SEMANA: 926077 y MES: 2044204 [19:37] Caracol}Elocuente
Jirafa\Letal has acertado 6 seguidas!! Puntos HOY: 672326, SEMANA: 926077 y MES: 2044204
[19:37] Caracol}Elocuente Tri.8446 Miscelaneaɭuvmancer˿HAYxUNxMUNDOxMEJORxPEROx?x [19:37] Caracol}Elocuente
Tri.8446 Miscelaneaɭuvmancer˿HAYxUNxMUNDOxMEJORxPEROx?x
[19:37] Caracol}Elocuente 1 Pista: ** ******** Valor pregunta : 5823 Puntos [19:37] Caracol}Elocuente
1 Pista: ** ******** Valor pregunta : 5823 Puntos
[19:38] Caracol}Elocuente 2 Pista: es�******* 30 segundos y 5823 Puntos [19:38] Caracol}Elocuente
2 Pista: es�******* 30 segundos y 5823 Puntos
[19:38] Caracol}Elocuente 3 Pista: es�a*i*i*o 15 segundos y 5823 Puntos [19:38] Caracol}Elocuente
3 Pista: es�a*i*i*o 15 segundos y 5823 Puntos
[19:38] Caracol}Elocuente Tiempo! La respuesta es -> es�arisimo <- [19:38] Caracol}Elocuente
Tiempo! La respuesta es -> es�arisimo <-
[19:38] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [19:38] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[19:38] Caracol}Elocuente Tri.17453 Eros-Sexɖonda˿Enyqu郰1x�nicampel�lamdeosuocarrera,xdirigidamporwRusselllMulcahy,xapareci󃰱xdesnudopcompletamenteoellactorwDenzellWashingtony?x [19:38] Caracol}Elocuente
Tri.17453 Eros-Sexɖonda˿Enyqu郰1x�nicampel�lamdeosuocarrera,xdirigidamporwRusselllMulcahy,xapareci󃰱xdesnudopcompletamenteoellactorwDenzellWashingtony?x
[19:38] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 14385 Puntos [19:38] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 14385 Puntos
[19:39] Caracol}Elocuente 2 Pista: ric***** 30 segundos y 14385 Puntos [19:39] Caracol}Elocuente
2 Pista: ric***** 30 segundos y 14385 Puntos
[19:39] Caracol}Elocuente 3 Pista: rico**e* 15 segundos y 14385 Puntos [19:39] Caracol}Elocuente
3 Pista: rico**e* 15 segundos y 14385 Puntos
[19:39] Caracol}Elocuente Tiempo! La respuesta es -> ricochet <- [19:39] Caracol}Elocuente
Tiempo! La respuesta es -> ricochet <-
[19:39] Caracol}Elocuente R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414 [19:39] Caracol}Elocuente
R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414
[19:39] Caracol}Elocuente Tri.4712 Miscelaneaɭartuniki˿AxCASAxDExTUxHERMANOxNOxIRASx?x [19:39] Caracol}Elocuente
Tri.4712 Miscelaneaɭartuniki˿AxCASAxDExTUxHERMANOxNOxIRASx?x
[19:39] Caracol}Elocuente 1 Pista: **** ****** Valor pregunta : 20564 Puntos [19:39] Caracol}Elocuente
1 Pista: **** ****** Valor pregunta : 20564 Puntos
[19:40] Caracol}Elocuente 2 Pista: cad* ****** 30 segundos y 20564 Puntos [19:40] Caracol}Elocuente
2 Pista: cad* ****** 30 segundos y 20564 Puntos
[19:40] Caracol}Elocuente 3 Pista: cada *e*a*o 15 segundos y 20564 Puntos [19:40] Caracol}Elocuente
3 Pista: cada *e*a*o 15 segundos y 20564 Puntos
[19:40] Caracol}Elocuente Tiempo! La respuesta es -> cada�erano <- [19:40] Caracol}Elocuente
Tiempo! La respuesta es -> cada�erano <-
[19:40] Jirafa\Letal cada delato [19:40] Jirafa\Letal
cada delato
[19:40] Caracol}Elocuente If you think a Q&A is wrong, please call an OP [19:40] Caracol}Elocuente
If you think a Q&A is wrong, please call an OP
[19:40] Caracol}Elocuente Tri.17700 Biologiaɬusie˿C󭯃01jserllamaslasmasasdertejidojquerseralargasennformasderpicojennlasflortderlasrorqu�as?w?w [19:40] Caracol}Elocuente
Tri.17700 Biologiaɬusie˿C󭯃01jserllamaslasmasasdertejidojquerseralargasennformasderpicojennlasflortderlasrorqu�as?w?w
[19:40] Caracol}Elocuente 1 Pista: ******* Pregunta de BONUS : 200000 Puntos [19:40] Caracol}Elocuente
1 Pista: ******* Pregunta de BONUS : 200000 Puntos
[19:40] CaballitoDeMar-Respetable ¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [19:40] CaballitoDeMar-Respetable
¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[19:40] Caracol}Elocuente 2 Pista: ros**** 30 segundos y 200000 Puntos [19:40] Caracol}Elocuente
2 Pista: ros**** 30 segundos y 200000 Puntos
[19:41] Caracol}Elocuente 3 Pista: ros*e*o 15 segundos y 200000 Puntos [19:41] Caracol}Elocuente
3 Pista: ros*e*o 15 segundos y 200000 Puntos
[19:41] Jirafa\Letal rostero [19:41] Jirafa\Letal
rostero
[19:41] Caracol}Elocuente Tiempo! La respuesta es -> rostelo <- [19:41] Caracol}Elocuente
Tiempo! La respuesta es -> rostelo <-
[19:41] Caracol}Elocuente R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087 [19:41] Caracol}Elocuente
R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087
[19:41] Caracol}Elocuente Tri.8792 GeografiaɁcuarios˿CUALpESpELpLLAMADOpVIEJOpCONTINENTEp?p [19:41] Caracol}Elocuente
Tri.8792 GeografiaɁcuarios˿CUALpESpELpLLAMADOpVIEJOpCONTINENTEp?p
[19:41] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 9943 Puntos [19:41] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 9943 Puntos
[19:41] Caracol}Elocuente 2 Pista: eur*** 30 segundos y 9943 Puntos [19:41] Caracol}Elocuente
2 Pista: eur*** 30 segundos y 9943 Puntos
[19:42] Caracol}Elocuente �Increible!! Jirafa\Letal contest󺠃04"europa" en �8.953 segundos, y ha ganado �943�12 puntos [19:42] Caracol}Elocuente
�Increible!! Jirafa\Letal contest󺠃04"europa" en �8.953 segundos, y ha ganado �943�12 puntos
[19:42] Caracol}Elocuente ACTION awards Jirafa\Letal with a +v for having over 15000 points [19:42] Caracol}Elocuente
ACTION awards Jirafa\Letal with a +v for having over 15000 points
[19:42] Caracol}Elocuente Jirafa\Letal has acertado 7 seguidas!! Puntos HOY: 682269, SEMANA: 936020 y MES: 2054147 [19:42] Caracol}Elocuente
Jirafa\Letal has acertado 7 seguidas!! Puntos HOY: 682269, SEMANA: 936020 y MES: 2054147
[19:42] Jirafa\Letal europa [19:42] Jirafa\Letal
europa
[19:42] Caracol}Elocuente For The Competitive Edge type !pingme [19:42] Caracol}Elocuente
For The Competitive Edge type !pingme
[19:42] Caracol}Elocuente Tri.9212 MitologiaɍaRyaM˿DIOSApDEpLApSUERTEpYpDELpAZARp?p [19:42] Caracol}Elocuente
Tri.9212 MitologiaɍaRyaM˿DIOSApDEpLApSUERTEpYpDELpAZARp?p
[19:42] Caracol}Elocuente 1 Pista: ******* Valor pregunta : 6290 Puntos [19:42] Caracol}Elocuente
1 Pista: ******* Valor pregunta : 6290 Puntos
[19:42] Caracol}Elocuente 2 Pista: for**** 30 segundos y 6290 Puntos [19:42] Caracol}Elocuente
2 Pista: for**** 30 segundos y 6290 Puntos
[19:42] Jirafa\Letal forteza [19:42] Jirafa\Letal
forteza
[19:42] Caracol}Elocuente 3 Pista: for*u*a 15 segundos y 6290 Puntos [19:42] Caracol}Elocuente
3 Pista: for*u*a 15 segundos y 6290 Puntos
[19:42] Jirafa\Letal fortesa [19:42] Jirafa\Letal
fortesa
[19:42] Jirafa\Letal fortuna [19:42] Jirafa\Letal
fortuna
[19:42] Caracol}Elocuente �Enhorabuena Jirafa\Letal!! Has contestado "fortuna" y por ello has ganado �290�12 puntos [19:42] Caracol}Elocuente
�Enhorabuena Jirafa\Letal!! Has contestado "fortuna" y por ello has ganado �290�12 puntos
[19:42] Caracol}Elocuente ACTION awards Jirafa\Letal with a +v for having over 15000 points [19:42] Caracol}Elocuente
ACTION awards Jirafa\Letal with a +v for having over 15000 points
[19:42] Caracol}Elocuente Jirafa\Letal has acertado 8 seguidas!! Puntos HOY: 688559, SEMANA: 942310 y MES: 2060437 [19:42] Caracol}Elocuente
Jirafa\Letal has acertado 8 seguidas!! Puntos HOY: 688559, SEMANA: 942310 y MES: 2060437
[19:43] Caracol}Elocuente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [19:43] Caracol}Elocuente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[19:43] Caracol}Elocuente Tri.12310 GeografiaɍARdeJAVA˃OMARCAvCATALANA,vCUYAvCAPITALvESvSANTAvCOLOMAvDEvFARNERS,vDONDEvTARZ�vYvMOWGLIvSEvSENTIŔNvCOMOvENvCASA.v?v [19:43] Caracol}Elocuente
Tri.12310 GeografiaɍARdeJAVA˃OMARCAvCATALANA,vCUYAvCAPITALvESvSANTAvCOLOMAvDEvFARNERS,vDONDEvTARZ�vYvMOWGLIvSEvSENTIŔNvCOMOvENvCASA.v?v
[19:43] Caracol}Elocuente 1 Pista: ** ***** Valor pregunta : 6199 Puntos [19:43] Caracol}Elocuente
1 Pista: ** ***** Valor pregunta : 6199 Puntos
[19:43] Caracol}Elocuente 2 Pista: la�**** 30 segundos y 6199 Puntos [19:43] Caracol}Elocuente
2 Pista: la�**** 30 segundos y 6199 Puntos
[19:43] Caracol}Elocuente 3 Pista: la�e**a 15 segundos y 6199 Puntos [19:43] Caracol}Elocuente
3 Pista: la�e**a 15 segundos y 6199 Puntos
[19:43] Caracol}Elocuente Tiempo! La respuesta es -> la�elva <- [19:43] Caracol}Elocuente
Tiempo! La respuesta es -> la�elva <-
[19:44] Caracol}Elocuente R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2060437 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: wilby 597825 [19:44] Caracol}Elocuente
R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2060437 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: wilby 597825
[19:44] Caracol}Elocuente Tri.6977 MiscelaneaɎavas˿Dosqculosqquezhanodormidomjuntos...a?a [19:44] Caracol}Elocuente
Tri.6977 MiscelaneaɎavas˿Dosqculosqquezhanodormidomjuntos...a?a
[19:44] Caracol}Elocuente 1 Pista: ***** ***** ** ******* Valor pregunta : 17463 Puntos [19:44] Caracol}Elocuente
1 Pista: ***** ***** ** ******* Valor pregunta : 17463 Puntos
[19:44] Caracol}Elocuente 2 Pista: des** ***** ** ******* 30 segundos y 17463 Puntos [19:44] Caracol}Elocuente
2 Pista: des** ***** ** ******* 30 segundos y 17463 Puntos
[19:44] Caracol}Elocuente 3 Pista: des*e *e*o* *e *a*u*a* 15 segundos y 17463 Puntos [19:44] Caracol}Elocuente
3 Pista: des*e *e*o* *e *a*u*a* 15 segundos y 17463 Puntos
[19:44] Caracol}Elocuente Tiempo! La respuesta es -> desde�ejos�e�aludan <- [19:44] Caracol}Elocuente
Tiempo! La respuesta es -> desde�ejos�e�aludan <-
[19:44] Caracol}Elocuente Please refrain from using Extreme Bad Language [19:44] Caracol}Elocuente
Please refrain from using Extreme Bad Language
[19:44] Caracol}Elocuente Tri.1044 Idiomasɉcia˿Gallego-Espa񯬃01zenxebret?j [19:44] Caracol}Elocuente
Tri.1044 Idiomasɉcia˿Gallego-Espa񯬃01zenxebret?j
[19:44] Caracol}Elocuente 1 Pista: ******* Valor pregunta : 8486 Puntos [19:44] Caracol}Elocuente
1 Pista: ******* Valor pregunta : 8486 Puntos
[19:45] Caracol}Elocuente 2 Pista: Cas**** 30 segundos y 8486 Puntos [19:45] Caracol}Elocuente
2 Pista: Cas**** 30 segundos y 8486 Puntos
[19:45] Jirafa\Letal castigo [19:45] Jirafa\Letal
castigo
[19:45] Caracol}Elocuente 3 Pista: Cas*i*o 15 segundos y 8486 Puntos [19:45] Caracol}Elocuente
3 Pista: Cas*i*o 15 segundos y 8486 Puntos
[19:45] Jirafa\Letal castilo [19:45] Jirafa\Letal
castilo
[19:45] Caracol}Elocuente Tiempo! La respuesta es -> Castizo <- [19:45] Caracol}Elocuente
Tiempo! La respuesta es -> Castizo <-
[19:45] Caracol}Elocuente This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente [19:45] Caracol}Elocuente
This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente
[19:45] Caracol}Elocuente Tri.14143 Gastronomiaɍercedes˿CuandozlluevebenlMurcia,alaltradici󮃰1lobligalalcocinarounlplatozquebenllalcostalsebhacebconlsardinaseygenlinterioroconlmarrano,adebqu郰1aplatozhablamos....a?a [19:45] Caracol}Elocuente
Tri.14143 Gastronomiaɍercedes˿CuandozlluevebenlMurcia,alaltradici󮃰1lobligalalcocinarounlplatozquebenllalcostalsebhacebconlsardinaseygenlinterioroconlmarrano,adebqu郰1aplatozhablamos....a?a
[19:45] Caracol}Elocuente 1 Pista: ***** ******* Valor pregunta : 9058 Puntos [19:45] Caracol}Elocuente
1 Pista: ***** ******* Valor pregunta : 9058 Puntos
[19:46] Caracol}Elocuente 2 Pista: mig** ******* 30 segundos y 9058 Puntos [19:46] Caracol}Elocuente
2 Pista: mig** ******* 30 segundos y 9058 Puntos
[19:46] Caracol}Elocuente 3 Pista: miga* *u*e*a* 15 segundos y 9058 Puntos [19:46] Caracol}Elocuente
3 Pista: miga* *u*e*a* 15 segundos y 9058 Puntos
[19:46] Caracol}Elocuente Tiempo! La respuesta es -> migas�uleras <- [19:46] Caracol}Elocuente
Tiempo! La respuesta es -> migas�uleras <-
[19:46] Caracol}Elocuente This WEEKS Top 11-20: - #11: wilby 171689 #12: LeCaTwaLk_z 19830 #13: FANTASMAMEXICO 5048 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [19:46] Caracol}Elocuente
This WEEKS Top 11-20: - #11: wilby 171689 #12: LeCaTwaLk_z 19830 #13: FANTASMAMEXICO 5048 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[19:46] Caracol}Elocuente Tri.11925 Geografiaɳherif˿Cuᬃ01neszelnnombremdemlosztreszestrechoszquemseparaniajDinamarcajdemlajpeninsulajescandinava?p?p [19:46] Caracol}Elocuente
Tri.11925 Geografiaɳherif˿Cuᬃ01neszelnnombremdemlosztreszestrechoszquemseparaniajDinamarcajdemlajpeninsulajescandinava?p?p
[19:46] Caracol}Elocuente 1 Pista: ******** ********* * **** Valor pregunta : 7422 Puntos [19:46] Caracol}Elocuente
1 Pista: ******** ********* * **** Valor pregunta : 7422 Puntos
[19:47] Caracol}Elocuente 2 Pista: kat***** ********* * **** 30 segundos y 7422 Puntos [19:47] Caracol}Elocuente
2 Pista: kat***** ********* * **** 30 segundos y 7422 Puntos
[19:47] Caracol}Elocuente 3 Pista: kat*e*a* **a*e**a* * *u** 15 segundos y 7422 Puntos [19:47] Caracol}Elocuente
3 Pista: kat*e*a* **a*e**a* * *u** 15 segundos y 7422 Puntos
[19:47] Caracol}Elocuente Tiempo! La respuesta es -> kattegat�kagerrak��und <- [19:47] Caracol}Elocuente
Tiempo! La respuesta es -> kattegat�kagerrak��und <-
[19:47] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [19:47] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[19:47] Caracol}Elocuente Tri.13489 MitologiaɍARdeJAVA˿AxORILLASxDExQUɃ01xMARxSExUBICABANxTRADICIONALMENTExLASxCIUDADESxB͂LICASxDExSODOMAxYxGOMORRA?x?x [19:47] Caracol}Elocuente
Tri.13489 MitologiaɍARdeJAVA˿AxORILLASxDExQUɃ01xMARxSExUBICABANxTRADICIONALMENTExLASxCIUDADESxB͂LICASxDExSODOMAxYxGOMORRA?x?x
[19:47] Caracol}Elocuente 1 Pista: *** ****** Valor pregunta : 14684 Puntos [19:47] Caracol}Elocuente
1 Pista: *** ****** Valor pregunta : 14684 Puntos
[19:47] Caracol}Elocuente 2 Pista: mar ****** 30 segundos y 14684 Puntos [19:47] Caracol}Elocuente
2 Pista: mar ****** 30 segundos y 14684 Puntos
[19:48] Jirafa\Letal mar negro [19:48] Jirafa\Letal
mar negro
[19:48] Caracol}Elocuente 3 Pista: mar *ue**o 15 segundos y 14684 Puntos [19:48] Caracol}Elocuente
3 Pista: mar *ue**o 15 segundos y 14684 Puntos
[19:48] Caracol}Elocuente �Absolutamente correcto Jirafa\Letal!! Acertaste "mar muerto" en �8.032 segundos y ganas �4684�12 puntos [19:48] Caracol}Elocuente
�Absolutamente correcto Jirafa\Letal!! Acertaste "mar muerto" en �8.032 segundos y ganas �4684�12 puntos
[19:48] Caracol}Elocuente ACTION awards Jirafa\Letal with a +v for having over 15000 points [19:48] Caracol}Elocuente
ACTION awards Jirafa\Letal with a +v for having over 15000 points
[19:48] Caracol}Elocuente Jirafa\Letal has acertado 9 seguidas!! Puntos HOY: 703243, SEMANA: 956994 y MES: 2075121 [19:48] Caracol}Elocuente
Jirafa\Letal has acertado 9 seguidas!! Puntos HOY: 703243, SEMANA: 956994 y MES: 2075121
[19:48] Jirafa\Letal mar muerto [19:48] Jirafa\Letal
mar muerto
[19:48] Caracol}Elocuente This MONTHS Top 11-20: - #11: Cosmo 285557 #12: Karen 285487 #13: Gladiadora_del_Caribe95 276694 #14: Alii 264411 #15: KaZuMa_KiRyU 257930 #16: Nyffa 217376 #17: Moog 180382 #18: lindisita1 83421 #19: Rodolfo516 49625 #20: NN_vOx_invasion-electoralizada 44977 [19:48] Caracol}Elocuente
This MONTHS Top 11-20: - #11: Cosmo 285557 #12: Karen 285487 #13: Gladiadora_del_Caribe95 276694 #14: Alii 264411 #15: KaZuMa_KiRyU 257930 #16: Nyffa 217376 #17: Moog 180382 #18: lindisita1 83421 #19: Rodolfo516 49625 #20: NN_vOx_invasion-electoralizada 44977
[19:48] Caracol}Elocuente Tri.20963 Deporteɳein˿Futbol...:comodserllamaedernombrerzidane?v?v [19:48] Caracol}Elocuente
Tri.20963 Deporteɳein˿Futbol...:comodserllamaedernombrerzidane?v?v
[19:48] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 11930 Puntos [19:48] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 11930 Puntos
[19:48] Caracol}Elocuente 2 Pista: zin***** 30 segundos y 11930 Puntos [19:48] Caracol}Elocuente
2 Pista: zin***** 30 segundos y 11930 Puntos
[19:49] Caracol}Elocuente 3 Pista: zine*i*e 15 segundos y 11930 Puntos [19:49] Caracol}Elocuente
3 Pista: zine*i*e 15 segundos y 11930 Puntos
[19:49] Caracol}Elocuente Tiempo! La respuesta es -> zinedine <- [19:49] Caracol}Elocuente
Tiempo! La respuesta es -> zinedine <-
[19:49] Caracol}Elocuente R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206 [19:49] Caracol}Elocuente
R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206
[19:49] Caracol}Elocuente Tri.3735 Mitologiaɖivianne˿JOVENiDIOSiGERMANICOiHIJOiDEiODIN,iREPRESENTANTEiDEiLAiLUZiYiLAiBELLEZAi?i [19:49] Caracol}Elocuente
Tri.3735 Mitologiaɖivianne˿JOVENiDIOSiGERMANICOiHIJOiDEiODIN,iREPRESENTANTEiDEiLAiLUZiYiLAiBELLEZAi?i
[19:49] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 13706 Puntos [19:49] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 13706 Puntos
[19:49] Caracol}Elocuente 2 Pista: bal*** 30 segundos y 13706 Puntos [19:49] Caracol}Elocuente
2 Pista: bal*** 30 segundos y 13706 Puntos
[19:49] Caracol}Elocuente 3 Pista: bal*e* 15 segundos y 13706 Puntos [19:49] Caracol}Elocuente
3 Pista: bal*e* 15 segundos y 13706 Puntos
[19:50] Jirafa\Letal baldes [19:50] Jirafa\Letal
baldes
[19:50] Caracol}Elocuente Tiempo! La respuesta es -> balder <- [19:50] Caracol}Elocuente
Tiempo! La respuesta es -> balder <-
[19:50] Caracol}Elocuente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [19:50] Caracol}Elocuente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[19:50] Caracol}Elocuente Tri.9982 Historiaɒachy˿EspectacularaedificacionxconstruidakparakevitaralasginvasionesgdetlasgtribusgbᲢarasg?q [19:50] Caracol}Elocuente
Tri.9982 Historiaɒachy˿EspectacularaedificacionxconstruidakparakevitaralasginvasionesgdetlasgtribusgbᲢarasg?q
[19:50] Caracol}Elocuente 1 Pista: **** ******* ***** Valor pregunta : 19791 Puntos [19:50] Caracol}Elocuente
1 Pista: **** ******* ***** Valor pregunta : 19791 Puntos
[19:50] Caracol}Elocuente 2 Pista: gra* ******* ***** 30 segundos y 19791 Puntos [19:50] Caracol}Elocuente
2 Pista: gra* ******* ***** 30 segundos y 19791 Puntos
[19:50] Caracol}Elocuente 3 Pista: gra* *u*a**a **i*a 15 segundos y 19791 Puntos [19:50] Caracol}Elocuente
3 Pista: gra* *u*a**a **i*a 15 segundos y 19791 Puntos
[19:51] Caracol}Elocuente Tiempo! La respuesta es -> gran�uralla�hina <- [19:51] Caracol}Elocuente
Tiempo! La respuesta es -> gran�uralla�hina <-
[19:51] Caracol}Elocuente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [19:51] Caracol}Elocuente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[19:51] Caracol}Elocuente Tri.396 Economiaɳica˿ENuQUEuA񏃰1uSEuPRODUJOuLAuSEGUNDAuCRISISuDELuPETROLEOu?u [19:51] Caracol}Elocuente
Tri.396 Economiaɳica˿ENuQUEuA񏃰1uSEuPRODUJOuLAuSEGUNDAuCRISISuDELuPETROLEOu?u
[19:51] Caracol}Elocuente 1 Pista: **** Valor pregunta : 5971 Puntos [19:51] Caracol}Elocuente
1 Pista: **** Valor pregunta : 5971 Puntos
[19:51] Caracol}Elocuente 2 Pista: 197* 30 segundos y 5971 Puntos [19:51] Caracol}Elocuente
2 Pista: 197* 30 segundos y 5971 Puntos
[19:51] Jirafa\Letal 1978 [19:51] Jirafa\Letal
1978
[19:51] Jirafa\Letal 1977 [19:51] Jirafa\Letal
1977
[19:51] Caracol}Elocuente 3 Pista: 197* 15 segundos y 5971 Puntos [19:51] Caracol}Elocuente
3 Pista: 197* 15 segundos y 5971 Puntos
[19:52] Caracol}Elocuente Tiempo! La respuesta es -> 1979 <- [19:52] Caracol}Elocuente
Tiempo! La respuesta es -> 1979 <-
[19:52] Caracol}Elocuente R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 956994 #5: siva- 692906 #6: Ketzy 610145 #7: Danielitto 397196 #8: Cosmo 285557 #9: hombre_bcn_48 264481 #10: Moog 180382 [19:52] Caracol}Elocuente
R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 956994 #5: siva- 692906 #6: Ketzy 610145 #7: Danielitto 397196 #8: Cosmo 285557 #9: hombre_bcn_48 264481 #10: Moog 180382
[19:52] Caracol}Elocuente Tri.16474 Personajesɦlipp_er˿Aristotolestfueudiscipulovde..?m?m [19:52] Caracol}Elocuente
Tri.16474 Personajesɦlipp_er˿Aristotolestfueudiscipulovde..?m?m
[19:52] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 22213 Puntos [19:52] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 22213 Puntos
[19:52] Caracol}Elocuente 2 Pista: pla*** 30 segundos y 22213 Puntos [19:52] Caracol}Elocuente
2 Pista: pla*** 30 segundos y 22213 Puntos
[19:52] Caracol}Elocuente 3 Pista: pla*o* 15 segundos y 22213 Puntos [19:52] Caracol}Elocuente
3 Pista: pla*o* 15 segundos y 22213 Puntos
[19:52] Jirafa\Letal platon [19:52] Jirafa\Letal
platon
[19:52] Caracol}Elocuente �Increible!! Jirafa\Letal contest󺠃04"platon" en �5.922 segundos, y ha ganado �2213�12 puntos [19:52] Caracol}Elocuente
�Increible!! Jirafa\Letal contest󺠃04"platon" en �5.922 segundos, y ha ganado �2213�12 puntos
[19:52] Caracol}Elocuente ACTION awards Jirafa\Letal with a +v for having over 15000 points [19:52] Caracol}Elocuente
ACTION awards Jirafa\Letal with a +v for having over 15000 points
[19:52] Caracol}Elocuente Jirafa\Letal has acertado 10 seguidas!! Puntos HOY: 725456, SEMANA: 979207 y MES: 2097334 [19:52] Caracol}Elocuente
Jirafa\Letal has acertado 10 seguidas!! Puntos HOY: 725456, SEMANA: 979207 y MES: 2097334
[19:52] Caracol}Elocuente Bonus especial de 50000 Puntos para Jirafa\Letal por acertar 10 seguidas!!! [19:52] Caracol}Elocuente
Bonus especial de 50000 Puntos para Jirafa\Letal por acertar 10 seguidas!!!
[19:52] Caracol}Elocuente We feature over 50,000 Q&A ! [19:52] Caracol}Elocuente
We feature over 50,000 Q&A !
[19:52] Caracol}Elocuente Tri.2607 IdiomasɎAPINE˿Definiciones:bRAMAbDEbLAbFILOSOFIAbNATURALbQQUEbBUSCABAbLAbPANACEAbUNIVERSALbYbLAbTRASMUTACIONbDEbLOSbMETALESb?b [19:52] Caracol}Elocuente
Tri.2607 IdiomasɎAPINE˿Definiciones:bRAMAbDEbLAbFILOSOFIAbNATURALbQQUEbBUSCABAbLAbPANACEAbUNIVERSALbYbLAbTRASMUTACIONbDEbLOSbMETALESb?b
[19:52] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 17254 Puntos [19:52] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 17254 Puntos
[19:53] Caracol}Elocuente 2 Pista: alq***** 30 segundos y 17254 Puntos [19:53] Caracol}Elocuente
2 Pista: alq***** 30 segundos y 17254 Puntos
[19:53] Caracol}Elocuente 3 Pista: alqui*ia 15 segundos y 17254 Puntos [19:53] Caracol}Elocuente
3 Pista: alqui*ia 15 segundos y 17254 Puntos
[19:53] Caracol}Elocuente Tiempo! La respuesta es -> alquimia <- [19:53] Caracol}Elocuente
Tiempo! La respuesta es -> alquimia <-
[19:53] Caracol}Elocuente R᮫ing de HOY: - #1: Jirafa\Letal 775456 #2: Gladiadora_del_Caribe 686734 #3: Grillo{Naranja 616922 #4: Danielitto 347196 #5: Paulus 317541 #6: Cosmo 285557 #7: Ketzy 38872 #8: * 0 #9: * 0 #10: * 0 [19:53] Caracol}Elocuente
R᮫ing de HOY: - #1: Jirafa\Letal 775456 #2: Gladiadora_del_Caribe 686734 #3: Grillo{Naranja 616922 #4: Danielitto 347196 #5: Paulus 317541 #6: Cosmo 285557 #7: Ketzy 38872 #8: * 0 #9: * 0 #10: * 0
[19:53] Caracol}Elocuente Tri.3960 Gastronomiaɓort˿DEfDONDEfESfTIPICOfELf"WATERZOOI"f?f [19:53] Caracol}Elocuente
Tri.3960 Gastronomiaɓort˿DEfDONDEfESfTIPICOfELf"WATERZOOI"f?f
[19:53] Caracol}Elocuente 1 Pista: ******* Pregunta de BONUS : 100000 Puntos [19:53] Caracol}Elocuente
1 Pista: ******* Pregunta de BONUS : 100000 Puntos
[19:54] Caracol}Elocuente 2 Pista: bel**** 30 segundos y 100000 Puntos [19:54] Caracol}Elocuente
2 Pista: bel**** 30 segundos y 100000 Puntos
[19:54] Caracol}Elocuente �Bingo!! Jirafa\Letal dio la respuesta: "belgica" en �5.672 segundos e incrementa sus ganancias con �00000�12 puntos [19:54] Caracol}Elocuente
�Bingo!! Jirafa\Letal dio la respuesta: "belgica" en �5.672 segundos e incrementa sus ganancias con �00000�12 puntos
[19:54] Caracol}Elocuente ACTION Aplausos Jirafa\Letal una cerveza fr�por 1000000 victorias!! Ole Jirafa\Letal!!! [19:54] Caracol}Elocuente
ACTION Aplausos Jirafa\Letal una cerveza fr�por 1000000 victorias!! Ole Jirafa\Letal!!!
[19:54] Caracol}Elocuente ACTION awards Jirafa\Letal with a +v for having over 15000 points [19:54] Caracol}Elocuente
ACTION awards Jirafa\Letal with a +v for having over 15000 points
[19:54] Jirafa\Letal belgica [19:54] Jirafa\Letal
belgica
[19:54] Caracol}Elocuente Jirafa\Letal has acertado 11 seguidas!! Puntos HOY: 875456, SEMANA: 1129207 y MES: 2247334 [19:54] Caracol}Elocuente
Jirafa\Letal has acertado 11 seguidas!! Puntos HOY: 875456, SEMANA: 1129207 y MES: 2247334
[19:54] Caracol}Elocuente Tri.1622 Informaticaɴjmm.com˃uandohenlWindowsocortasoohcopiasoalg�nlelementohsemalmacenahtemporalmentemenlel....q?q [19:54] Caracol}Elocuente
Tri.1622 Informaticaɴjmm.com˃uandohenlWindowsocortasoohcopiasoalg�nlelementohsemalmacenahtemporalmentemenlel....q?q
[19:54] Caracol}Elocuente 1 Pista: ************ Valor pregunta : 19510 Puntos [19:54] Caracol}Elocuente
1 Pista: ************ Valor pregunta : 19510 Puntos
[19:54] Caracol}Elocuente 2 Pista: Por********* 30 segundos y 19510 Puntos [19:54] Caracol}Elocuente
2 Pista: Por********* 30 segundos y 19510 Puntos
[19:54] Caracol}Elocuente 3 Pista: Por*a*a*e*e* 15 segundos y 19510 Puntos [19:54] Caracol}Elocuente
3 Pista: Por*a*a*e*e* 15 segundos y 19510 Puntos
[19:55] Caracol}Elocuente Tiempo! La respuesta es -> Portapapeles <- [19:55] Caracol}Elocuente
Tiempo! La respuesta es -> Portapapeles <-
[19:55] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [19:55] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[19:55] Caracol}Elocuente Tri.1843 GastronomiaɓaBaTh˿DeudondeusonbtipicosxlosxadoquinesxdelgPilarl?i [19:55] Caracol}Elocuente
Tri.1843 GastronomiaɓaBaTh˿DeudondeusonbtipicosxlosxadoquinesxdelgPilarl?i
[19:55] Caracol}Elocuente 1 Pista: ******** Pregunta de BONUS : 50000 Puntos [19:55] Caracol}Elocuente
1 Pista: ******** Pregunta de BONUS : 50000 Puntos
[19:55] Caracol}Elocuente 2 Pista: Zar***** 30 segundos y 50000 Puntos [19:55] Caracol}Elocuente
2 Pista: Zar***** 30 segundos y 50000 Puntos
[19:55] Jirafa\Letal zaramora [19:55] Jirafa\Letal
zaramora
[19:55] Caracol}Elocuente �Enhorabuena Caiman_Enorme!! Has contestado "zaragoza" y por ello has ganado �0000�12 puntos [19:55] Caracol}Elocuente
�Enhorabuena Caiman_Enorme!! Has contestado "zaragoza" y por ello has ganado �0000�12 puntos
[19:55] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [19:55] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[19:55] Caracol}Elocuente Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 50000, SEMANA: 50000 y MES: 50000 [19:55] Caracol}Elocuente
Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 50000, SEMANA: 50000 y MES: 50000
[19:55] Caiman_Enorme zaragoza [19:55] Caiman_Enorme
zaragoza
[19:55] CaballitoDeMar-Respetable ¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [19:55] CaballitoDeMar-Respetable
¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[19:56] Caracol}Elocuente R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414 [19:56] Caracol}Elocuente
R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414
[19:56] Caracol}Elocuente Tri.4647 MusicaɫarlitoxZ˿Cuᬃ01gesyelgdiscoxdehThehCranberriesyeditadoxenw1999v?v [19:56] Caracol}Elocuente
Tri.4647 MusicaɫarlitoxZ˿Cuᬃ01gesyelgdiscoxdehThehCranberriesyeditadoxenw1999v?v
[19:56] Caracol}Elocuente 1 Pista: **** *** ******* Valor pregunta : 12216 Puntos [19:56] Caracol}Elocuente
1 Pista: **** *** ******* Valor pregunta : 12216 Puntos
[19:56] Caracol}Elocuente 2 Pista: bur* *** ******* 30 segundos y 12216 Puntos [19:56] Caracol}Elocuente
2 Pista: bur* *** ******* 30 segundos y 12216 Puntos
[19:56] Caracol}Elocuente 3 Pista: bur* **e *a***e* 15 segundos y 12216 Puntos [19:56] Caracol}Elocuente
3 Pista: bur* **e *a***e* 15 segundos y 12216 Puntos
[19:56] Caracol}Elocuente Tiempo! La respuesta es -> bury�he�atchet <- [19:56] Caracol}Elocuente
Tiempo! La respuesta es -> bury�he�atchet <-
[19:56] Caracol}Elocuente If you think a Q&A is wrong, please call an OP [19:56] Caracol}Elocuente
If you think a Q&A is wrong, please call an OP
[19:56] Caracol}Elocuente Tri.2367 Literaturaɭartuniki˿Autorvdelnlibroy"losuojosudelntuareg"r?r [19:56] Caracol}Elocuente
Tri.2367 Literaturaɭartuniki˿Autorvdelnlibroy"losuojosudelntuareg"r?r
[19:56] Caracol}Elocuente 1 Pista: ******* ******* ******** Valor pregunta : 7600 Puntos [19:56] Caracol}Elocuente
1 Pista: ******* ******* ******** Valor pregunta : 7600 Puntos
[19:57] Caracol}Elocuente 2 Pista: alb**** ******* ******** 30 segundos y 7600 Puntos [19:57] Caracol}Elocuente
2 Pista: alb**** ******* ******** 30 segundos y 7600 Puntos
[19:57] Caracol}Elocuente 3 Pista: albe**o *a**ue* *i*ue*oa 15 segundos y 7600 Puntos [19:57] Caracol}Elocuente
3 Pista: albe**o *a**ue* *i*ue*oa 15 segundos y 7600 Puntos
[19:57] Caracol}Elocuente Tiempo! La respuesta es -> alberto�azquez�igueroa <- [19:57] Caracol}Elocuente
Tiempo! La respuesta es -> alberto�azquez�igueroa <-
[19:57] Caracol}Elocuente R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087 [19:57] Caracol}Elocuente
R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087
[19:57] Caracol}Elocuente Tri.8557 Biologiaɓebosin˿Cuᬃ01ieslelinombreedeelajplantajcuyaslhojaslseeempleanbenblajindustriajparajhacerbsogas,uesteras,utripe,upastajparajfabricarbpapel,uetc?u?u [19:57] Caracol}Elocuente
Tri.8557 Biologiaɓebosin˿Cuᬃ01ieslelinombreedeelajplantajcuyaslhojaslseeempleanbenblajindustriajparajhacerbsogas,uesteras,utripe,upastajparajfabricarbpapel,uetc?u?u
[19:57] Caracol}Elocuente 1 Pista: ******* Pregunta de BONUS : 25000 Puntos [19:57] Caracol}Elocuente
1 Pista: ******* Pregunta de BONUS : 25000 Puntos
[19:58] Caracol}Elocuente 2 Pista: esp**** 30 segundos y 25000 Puntos [19:58] Caracol}Elocuente
2 Pista: esp**** 30 segundos y 25000 Puntos
[19:58] Caracol}Elocuente 3 Pista: espa**o 15 segundos y 25000 Puntos [19:58] Caracol}Elocuente
3 Pista: espa**o 15 segundos y 25000 Puntos
[19:58] Jirafa\Letal espacio [19:58] Jirafa\Letal
espacio
[19:58] Caracol}Elocuente Tiempo! La respuesta es -> esparto <- [19:58] Caracol}Elocuente
Tiempo! La respuesta es -> esparto <-
[19:58] Caracol}Elocuente For The Competitive Edge type !pingme [19:58] Caracol}Elocuente
For The Competitive Edge type !pingme
[19:58] Caracol}Elocuente Tri.16061 Cancionesɖonk˿Dehquienbesudanielam?a [19:58] Caracol}Elocuente
Tri.16061 Cancionesɖonk˿Dehquienbesudanielam?a
[19:58] Caracol}Elocuente 1 Pista: ***** ****** Pregunta de BONUS : 25000 Puntos [19:58] Caracol}Elocuente
1 Pista: ***** ****** Pregunta de BONUS : 25000 Puntos
[19:59] Caracol}Elocuente 2 Pista: ped** ****** 30 segundos y 25000 Puntos [19:59] Caracol}Elocuente
2 Pista: ped** ****** 30 segundos y 25000 Puntos
[19:59] Caracol}Elocuente 3 Pista: ped*o *ue**a 15 segundos y 25000 Puntos [19:59] Caracol}Elocuente
3 Pista: ped*o *ue**a 15 segundos y 25000 Puntos
[19:59] Jirafa\Letal pedro tuerta [19:59] Jirafa\Letal
pedro tuerta
[19:59] Caracol}Elocuente Tiempo! La respuesta es -> pedro�uerra <- [19:59] Caracol}Elocuente
Tiempo! La respuesta es -> pedro�uerra <-
[19:59] Caracol}Elocuente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [19:59] Caracol}Elocuente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[19:59] Caracol}Elocuente Tri.31 Cineɥrboni˿CUANTOSxOSCARSxGANOx"EltPADRINO,xPARTExIII"?x?x [19:59] Caracol}Elocuente
Tri.31 Cineɥrboni˿CUANTOSxOSCARSxGANOx"EltPADRINO,xPARTExIII"?x?x
[19:59] Caracol}Elocuente 1 Pista: * Valor pregunta : 20974 Puntos [19:59] Caracol}Elocuente
1 Pista: * Valor pregunta : 20974 Puntos
[19:59] Jirafa\Letal 4 [19:59] Jirafa\Letal
4
[19:59] Jirafa\Letal 3 [19:59] Jirafa\Letal
3
[19:59] Jirafa\Letal 2 [19:59] Jirafa\Letal
2
[19:59] Jirafa\Letal 7 [19:59] Jirafa\Letal
7
[19:59] Caracol}Elocuente 2 Pista: 0 30 segundos y 20974 Puntos [19:59] Caracol}Elocuente
2 Pista: 0 30 segundos y 20974 Puntos
[20:00] Caracol}Elocuente �Bien Jirafa\Letal!! Tu respuesta: "0" es correcta y ganas �0974�12 puntos [20:00] Caracol}Elocuente
�Bien Jirafa\Letal!! Tu respuesta: "0" es correcta y ganas �0974�12 puntos
[20:00] Caracol}Elocuente ACTION awards Jirafa\Letal with a +v for having over 15000 points [20:00] Caracol}Elocuente
ACTION awards Jirafa\Letal with a +v for having over 15000 points
[20:00] Caracol}Elocuente Jirafa\Letal has acertado 1 seguidas!! Puntos HOY: 896430, SEMANA: 1150181 y MES: 2268308 [20:00] Caracol}Elocuente
Jirafa\Letal has acertado 1 seguidas!! Puntos HOY: 896430, SEMANA: 1150181 y MES: 2268308
[20:00] Jirafa\Letal 0 [20:00] Jirafa\Letal
0
[20:00] Caracol}Elocuente R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2247334 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: wilby 597825 [20:00] Caracol}Elocuente
R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2247334 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: wilby 597825
[20:00] Caracol}Elocuente Tri.5961 Economiaɒachy˿C󭯃01qseedefineealhinversorpqueehapcompradoqvaloresaaplosapreciosamḩmos,fcuandoqbajanrlasacotizacionesadeelosamismos?f?f [20:00] Caracol}Elocuente
Tri.5961 Economiaɒachy˿C󭯃01qseedefineealhinversorpqueehapcompradoqvaloresaaplosapreciosamḩmos,fcuandoqbajanrlasacotizacionesadeelosamismos?f?f
[20:00] Caracol}Elocuente 1 Pista: ******* Valor pregunta : 17408 Puntos [20:00] Caracol}Elocuente
1 Pista: ******* Valor pregunta : 17408 Puntos
[20:00] Caracol}Elocuente 2 Pista: col**** 30 segundos y 17408 Puntos [20:00] Caracol}Elocuente
2 Pista: col**** 30 segundos y 17408 Puntos
[20:00] Jirafa\Letal colonia [20:00] Jirafa\Letal
colonia
[20:00] Caracol}Elocuente 3 Pista: col*a*o 15 segundos y 17408 Puntos [20:00] Caracol}Elocuente
3 Pista: col*a*o 15 segundos y 17408 Puntos
[20:00] Jirafa\Letal colorado [20:00] Jirafa\Letal
colorado
[20:00] Caracol}Elocuente Tiempo! La respuesta es -> colgado <- [20:00] Caracol}Elocuente
Tiempo! La respuesta es -> colgado <-
[20:01] Caracol}Elocuente Please refrain from using Extreme Bad Language [20:01] Caracol}Elocuente
Please refrain from using Extreme Bad Language
[20:01] Caracol}Elocuente Tri.8563 DeporteɔeLaRaNhA˿CampeonxdelymundoideuBalonmanoi2005h?h [20:01] Caracol}Elocuente
Tri.8563 DeporteɔeLaRaNhA˿CampeonxdelymundoideuBalonmanoi2005h?h
[20:01] Caracol}Elocuente 1 Pista: ****񪠃 Valor pregunta : 7496 Puntos [20:01] Caracol}Elocuente
1 Pista: ****񪠃 Valor pregunta : 7496 Puntos
[20:01] Caracol}Elocuente 2 Pista: esp*񪠃 30 segundos y 7496 Puntos [20:01] Caracol}Elocuente
2 Pista: esp*񪠃 30 segundos y 7496 Puntos
[20:01] Caracol}Elocuente 3 Pista: espa񡠃 15 segundos y 7496 Puntos [20:01] Caracol}Elocuente
3 Pista: espa񡠃 15 segundos y 7496 Puntos
[20:01] Caracol}Elocuente Tiempo! La respuesta es -> espa񡠃12 <- [20:01] Caracol}Elocuente
Tiempo! La respuesta es -> espa񡠃12 <-
[20:01] Jirafa\Letal joven_mexicana tus fotos son gratis [20:01] Jirafa\Letal
joven_mexicana tus fotos son gratis
[20:02] Caracol}Elocuente This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente [20:02] Caracol}Elocuente
This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente
[20:02] Caracol}Elocuente Tri.14974 MiscelaneaɁigua˿Comolseydenominamsegunllamdoctrinambudista,elamaniquilacionlcompletamdelqyolyhlamdichamsupremam?e [20:02] Caracol}Elocuente
Tri.14974 MiscelaneaɁigua˿Comolseydenominamsegunllamdoctrinambudista,elamaniquilacionlcompletamdelqyolyhlamdichamsupremam?e
[20:02] Caracol}Elocuente 1 Pista: ******* Valor pregunta : 21130 Puntos [20:02] Caracol}Elocuente
1 Pista: ******* Valor pregunta : 21130 Puntos
[20:02] Caracol}Elocuente 2 Pista: nir**** 30 segundos y 21130 Puntos [20:02] Caracol}Elocuente
2 Pista: nir**** 30 segundos y 21130 Puntos
[20:02] Caracol}Elocuente 3 Pista: nir*a*a 15 segundos y 21130 Puntos [20:02] Caracol}Elocuente
3 Pista: nir*a*a 15 segundos y 21130 Puntos
[20:02] Jirafa\Letal no quiero problemas con tu novio joven_mexicana xD [20:02] Jirafa\Letal
no quiero problemas con tu novio joven_mexicana xD
[20:02] Caracol}Elocuente Tiempo! La respuesta es -> nirvana <- [20:02] Caracol}Elocuente
Tiempo! La respuesta es -> nirvana <-
[20:02] Caracol}Elocuente This WEEKS Top 11-20: - #11: wilby 171689 #12: Caiman_Enorme 50000 #13: LeCaTwaLk_z 19830 #14: FANTASMAMEXICO 5048 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [20:02] Caracol}Elocuente
This WEEKS Top 11-20: - #11: wilby 171689 #12: Caiman_Enorme 50000 #13: LeCaTwaLk_z 19830 #14: FANTASMAMEXICO 5048 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[20:02] Caracol}Elocuente Tri.13068 Geografiaɓebosin˿LaaciudadjdesHaweraasesencuentraaenwNuevaaZelanda.dߑu郰1dsignificaaliteralmente?d?d [20:02] Caracol}Elocuente
Tri.13068 Geografiaɓebosin˿LaaciudadjdesHaweraasesencuentraaenwNuevaaZelanda.dߑu郰1dsignificaaliteralmente?d?d
[20:02] Caracol}Elocuente 1 Pista: ***** ******** Valor pregunta : 23170 Puntos [20:02] Caracol}Elocuente
1 Pista: ***** ******** Valor pregunta : 23170 Puntos
[20:03] Caracol}Elocuente 2 Pista: lug** ******** 30 segundos y 23170 Puntos [20:03] Caracol}Elocuente
2 Pista: lug** ******** 30 segundos y 23170 Puntos
[20:03] Caiman_Enorme jajajjajajaja [20:03] Caiman_Enorme
jajajjajajaja
[20:03] Caracol}Elocuente 3 Pista: luga* a**ie**e 15 segundos y 23170 Puntos [20:03] Caracol}Elocuente
3 Pista: luga* a**ie**e 15 segundos y 23170 Puntos
[20:03] Jirafa\Letal xD [20:03] Jirafa\Letal
xD
[20:03] Caiman_Enorme la asustaste [20:03] Caiman_Enorme
la asustaste
[20:03] Jirafa\Letal si verdad [20:03] Jirafa\Letal
si verdad
[20:03] Caracol}Elocuente Tiempo! La respuesta es -> lugar�rdiente <- [20:03] Caracol}Elocuente
Tiempo! La respuesta es -> lugar�rdiente <-
[20:03] Caiman_Enorme si :D [20:03] Caiman_Enorme
si :D
[20:03] Jirafa\Letal no tiene telegram [20:03] Jirafa\Letal
no tiene telegram
[20:03] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [20:03] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[20:03] Caracol}Elocuente Tri.14863 MiscelaneaɔeLaRaNhA˿Caballitoudebcarton,mnixandante,mnixgalopanteb?m [20:03] Caracol}Elocuente
Tri.14863 MiscelaneaɔeLaRaNhA˿Caballitoudebcarton,mnixandante,mnixgalopanteb?m
[20:03] Caracol}Elocuente 1 Pista: ** ****** Valor pregunta : 15197 Puntos [20:03] Caracol}Elocuente
1 Pista: ** ****** Valor pregunta : 15197 Puntos
[20:04] Caracol}Elocuente 2 Pista: ni�***** 30 segundos y 15197 Puntos [20:04] Caracol}Elocuente
2 Pista: ni�***** 30 segundos y 15197 Puntos
[20:04] Jirafa\Letal nicaragua [20:04] Jirafa\Letal
nicaragua
[20:04] Caracol}Elocuente 3 Pista: ni�*o*o* 15 segundos y 15197 Puntos [20:04] Caracol}Elocuente
3 Pista: ni�*o*o* 15 segundos y 15197 Puntos
[20:04] Jirafa\Letal no me salio [20:04] Jirafa\Letal
no me salio
[20:04] Caracol}Elocuente Tiempo! La respuesta es -> ni�roton <- [20:04] Caracol}Elocuente
Tiempo! La respuesta es -> ni�roton <-
[20:04] Caracol}Elocuente This MONTHS Top 11-20: - #11: Cosmo 285557 #12: Karen 285487 #13: Gladiadora_del_Caribe95 276694 #14: Alii 264411 #15: KaZuMa_KiRyU 257930 #16: Nyffa 217376 #17: Moog 180382 #18: lindisita1 83421 #19: Caiman_Enorme 50000 #20: Rodolfo516 49625 [20:04] Caracol}Elocuente
This MONTHS Top 11-20: - #11: Cosmo 285557 #12: Karen 285487 #13: Gladiadora_del_Caribe95 276694 #14: Alii 264411 #15: KaZuMa_KiRyU 257930 #16: Nyffa 217376 #17: Moog 180382 #18: lindisita1 83421 #19: Caiman_Enorme 50000 #20: Rodolfo516 49625
[20:04] Caracol}Elocuente Tri.17682 BiologiaɞIrati˿Deyqu郰1bcolorvsonflasxcr�xreci鮃01fnacidasxdeldgorila?b?b [20:04] Caracol}Elocuente
Tri.17682 BiologiaɞIrati˿Deyqu郰1bcolorvsonflasxcr�xreci鮃01fnacidasxdeldgorila?b?b
[20:04] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 5499 Puntos [20:04] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 5499 Puntos
[20:05] Caracol}Elocuente 2 Pista: ros*** 30 segundos y 5499 Puntos [20:05] Caracol}Elocuente
2 Pista: ros*** 30 segundos y 5499 Puntos
[20:05] Jirafa\Letal marron [20:05] Jirafa\Letal
marron
[20:05] Caiman_Enorme rosada [20:05] Caiman_Enorme
rosada
[20:05] Caiman_Enorme rosado [20:05] Caiman_Enorme
rosado
[20:05] Caracol}Elocuente �Increible!! Caiman_Enorme contest󺠃04"rosado" en �3.656 segundos, y ha ganado �499�12 puntos [20:05] Caracol}Elocuente
�Increible!! Caiman_Enorme contest󺠃04"rosado" en �3.656 segundos, y ha ganado �499�12 puntos
[20:05] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:05] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:05] Caracol}Elocuente Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 55499, SEMANA: 55499 y MES: 55499 [20:05] Caracol}Elocuente
Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 55499, SEMANA: 55499 y MES: 55499
[20:05] Jirafa\Letal rosada [20:05] Jirafa\Letal
rosada
[20:05] Caracol}Elocuente R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206 [20:05] Caracol}Elocuente
R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206
[20:05] Caracol}Elocuente Tri.19137 Idiomasɐsico666˳in󮩭os:wcomich?w [20:05] Caracol}Elocuente
Tri.19137 Idiomasɐsico666˳in󮩭os:wcomich?w
[20:05] Caracol}Elocuente 1 Pista: ***** Pregunta de BONUS : 100000 Puntos [20:05] Caracol}Elocuente
1 Pista: ***** Pregunta de BONUS : 100000 Puntos
[20:05] Caracol}Elocuente 2 Pista: teb** 30 segundos y 100000 Puntos [20:05] Caracol}Elocuente
2 Pista: teb** 30 segundos y 100000 Puntos
[20:05] Jirafa\Letal me ganastes missiaxis [20:05] Jirafa\Letal
me ganastes missiaxis
[20:05] Caiman_Enorme tebak [20:05] Caiman_Enorme
tebak
[20:05] Caracol}Elocuente 3 Pista: tebeo 15 segundos y 100000 Puntos [20:05] Caracol}Elocuente
3 Pista: tebeo 15 segundos y 100000 Puntos
[20:05] Caracol}Elocuente �Eso es Caiman_Enorme!! Dijiste: "tebeo" y ello te ha valido: �00000�12 puntos [20:05] Caracol}Elocuente
�Eso es Caiman_Enorme!! Dijiste: "tebeo" y ello te ha valido: �00000�12 puntos
[20:05] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:05] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:05] Caracol}Elocuente Caiman_Enorme has acertado 2 seguidas!! Puntos HOY: 155499, SEMANA: 155499 y MES: 155499 [20:05] Caracol}Elocuente
Caiman_Enorme has acertado 2 seguidas!! Puntos HOY: 155499, SEMANA: 155499 y MES: 155499
[20:05] Caiman_Enorme tebeo [20:05] Caiman_Enorme
tebeo
[20:05] Jirafa\Letal tabeo [20:05] Jirafa\Letal
tabeo
[20:06] Caiman_Enorme gx [20:06] Caiman_Enorme
gx
[20:06] Jirafa\Letal me ganaste [20:06] Jirafa\Letal
me ganaste
[20:06] Caracol}Elocuente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [20:06] Caracol}Elocuente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[20:06] Caracol}Elocuente Tri.18419 Miscelaneaɨowlita˿Gatos:fElygatonHimalayaxesaunycrucejentrejlasarazas...f?f [20:06] Caracol}Elocuente
Tri.18419 Miscelaneaɨowlita˿Gatos:fElygatonHimalayaxesaunycrucejentrejlasarazas...f?f
[20:06] Caracol}Elocuente 1 Pista: ****** * ***** ***** Valor pregunta : 11025 Puntos [20:06] Caracol}Elocuente
1 Pista: ****** * ***** ***** Valor pregunta : 11025 Puntos
[20:06] Jirafa\Letal eres smart [20:06] Jirafa\Letal
eres smart
[20:06] Jirafa\Letal como tv [20:06] Jirafa\Letal
como tv
[20:06] Caracol}Elocuente 2 Pista: sia*** * ***** ***** 30 segundos y 11025 Puntos [20:06] Caracol}Elocuente
2 Pista: sia*** * ***** ***** 30 segundos y 11025 Puntos
[20:06] Jirafa\Letal xD [20:06] Jirafa\Letal
xD
[20:06] Caiman_Enorme na [20:06] Caiman_Enorme
na
[20:06] Caracol}Elocuente 3 Pista: sia*e* * *e**a *e**o 15 segundos y 11025 Puntos [20:06] Caracol}Elocuente
3 Pista: sia*e* * *e**a *e**o 15 segundos y 11025 Puntos
[20:06] Caracol}Elocuente Tiempo! La respuesta es -> siames��ersa�egro <- [20:06] Caracol}Elocuente
Tiempo! La respuesta es -> siames��ersa�egro <-
[20:07] Caracol}Elocuente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [20:07] Caracol}Elocuente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[20:07] Caracol}Elocuente Tri.1747 HistoriaɊAVEA˿1914eCONeQUEeOTRAeCIUDADeSEeESTABLECEeDESDEeSANePETESBURGOe(FLORIDA)eLAePRIMERAeLINEAeAEREAeREGULAReENeEE.UUe?e [20:07] Caracol}Elocuente
Tri.1747 HistoriaɊAVEA˿1914eCONeQUEeOTRAeCIUDADeSEeESTABLECEeDESDEeSANePETESBURGOe(FLORIDA)eLAePRIMERAeLINEAeAEREAeREGULAReENeEE.UUe?e
[20:07] Caracol}Elocuente 1 Pista: ***** Valor pregunta : 17859 Puntos [20:07] Caracol}Elocuente
1 Pista: ***** Valor pregunta : 17859 Puntos
[20:07] Caracol}Elocuente 2 Pista: TAM** 30 segundos y 17859 Puntos [20:07] Caracol}Elocuente
2 Pista: TAM** 30 segundos y 17859 Puntos
[20:07] Caracol}Elocuente �Bien Caiman_Enorme!! Tu respuesta: "tampa" es correcta y ganas �7859�12 puntos [20:07] Caracol}Elocuente
�Bien Caiman_Enorme!! Tu respuesta: "tampa" es correcta y ganas �7859�12 puntos
[20:07] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:07] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:07] Caracol}Elocuente Caiman_Enorme has acertado 3 seguidas!! Puntos HOY: 173358, SEMANA: 173358 y MES: 173358 [20:07] Caracol}Elocuente
Caiman_Enorme has acertado 3 seguidas!! Puntos HOY: 173358, SEMANA: 173358 y MES: 173358
[20:07] Caiman_Enorme tampa [20:07] Caiman_Enorme
tampa
[20:07] Jirafa\Letal deja veo si hay en la lass radios aqui missmaxis no tardo sigue jugando [20:07] Jirafa\Letal
deja veo si hay en la lass radios aqui missmaxis no tardo sigue jugando
[20:07] Caracol}Elocuente R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1150181 #5: siva- 692906 #6: Ketzy 610145 #7: Danielitto 397196 #8: Cosmo 285557 #9: hombre_bcn_48 264481 #10: Moog 180382 [20:07] Caracol}Elocuente
R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1150181 #5: siva- 692906 #6: Ketzy 610145 #7: Danielitto 397196 #8: Cosmo 285557 #9: hombre_bcn_48 264481 #10: Moog 180382
[20:07] Caracol}Elocuente Tri.104 InformaticaɻOpeR}˿Cuantosakilobytesatienecuntmegabytec?h [20:07] Caracol}Elocuente
Tri.104 InformaticaɻOpeR}˿Cuantosakilobytesatienecuntmegabytec?h
[20:07] Caracol}Elocuente 1 Pista: **** Valor pregunta : 21963 Puntos [20:07] Caracol}Elocuente
1 Pista: **** Valor pregunta : 21963 Puntos
[20:07] Caracol}Elocuente 2 Pista: 102* 30 segundos y 21963 Puntos [20:07] Caracol}Elocuente
2 Pista: 102* 30 segundos y 21963 Puntos
[20:07] Caiman_Enorme [20:07] Caiman_Enorme
[20:07] Jirafa\Letal trea [20:07] Jirafa\Letal
trea
[20:07] Caiman_Enorme 1022 [20:07] Caiman_Enorme
1022
[20:07] Jirafa\Letal 1021 [20:07] Jirafa\Letal
1021
[20:08] Caiman_Enorme 1029 [20:08] Caiman_Enorme
1029
[20:08] Caracol}Elocuente �Increible!! Jirafa\Letal contest󺠃04"1024" en �7.625 segundos, y ha ganado �1963�12 puntos [20:08] Caracol}Elocuente
�Increible!! Jirafa\Letal contest󺠃04"1024" en �7.625 segundos, y ha ganado �1963�12 puntos
[20:08] Caracol}Elocuente ACTION awards Jirafa\Letal with a +v for having over 15000 points [20:08] Caracol}Elocuente
ACTION awards Jirafa\Letal with a +v for having over 15000 points
[20:08] Caracol}Elocuente Jirafa\Letal has acertado 1 seguidas!! Puntos HOY: 918393, SEMANA: 1172144 y MES: 2290271 [20:08] Caracol}Elocuente
Jirafa\Letal has acertado 1 seguidas!! Puntos HOY: 918393, SEMANA: 1172144 y MES: 2290271
[20:08] Jirafa\Letal 1024 [20:08] Jirafa\Letal
1024
[20:08] Caiman_Enorme bn [20:08] Caiman_Enorme
bn
[20:08] Jirafa\Letal gracias [20:08] Jirafa\Letal
gracias
[20:08] Caracol}Elocuente We feature over 50,000 Q&A ! [20:08] Caracol}Elocuente
We feature over 50,000 Q&A !
[20:08] Caracol}Elocuente Tri.4793 Medicina-SaludɍARdeJAVA˿CӍOfSEfDENOMINAfLAfFOBIAfAfLASfMUJERESfHERMOSAS?f?f [20:08] Caracol}Elocuente
Tri.4793 Medicina-SaludɍARdeJAVA˿CӍOfSEfDENOMINAfLAfFOBIAfAfLASfMUJERESfHERMOSAS?f?f
[20:08] Caracol}Elocuente 1 Pista: ************* Valor pregunta : 21194 Puntos [20:08] Caracol}Elocuente
1 Pista: ************* Valor pregunta : 21194 Puntos
[20:08] Jirafa\Letal voy por el dj [20:08] Jirafa\Letal
voy por el dj
[20:08] Caracol}Elocuente 2 Pista: cal********** 30 segundos y 21194 Puntos [20:08] Caracol}Elocuente
2 Pista: cal********** 30 segundos y 21194 Puntos
[20:08] Jirafa\Letal no tardo [20:08] Jirafa\Letal
no tardo
[20:08] Caiman_Enorme vale [20:08] Caiman_Enorme
vale
[20:08] Caracol}Elocuente 3 Pista: cali*i*e*o*ia 15 segundos y 21194 Puntos [20:08] Caracol}Elocuente
3 Pista: cali*i*e*o*ia 15 segundos y 21194 Puntos
[20:09] Caracol}Elocuente Tiempo! La respuesta es -> caliginefobia <- [20:09] Caracol}Elocuente
Tiempo! La respuesta es -> caliginefobia <-
[20:09] Caracol}Elocuente R᮫ing de HOY: - #1: Jirafa\Letal 918393 #2: Gladiadora_del_Caribe 686734 #3: Grillo{Naranja 616922 #4: Danielitto 347196 #5: Paulus 317541 #6: Cosmo 285557 #7: Caiman_Enorme 173358 #8: Ketzy 38872 #9: * 0 #10: * 0 [20:09] Caracol}Elocuente
R᮫ing de HOY: - #1: Jirafa\Letal 918393 #2: Gladiadora_del_Caribe 686734 #3: Grillo{Naranja 616922 #4: Danielitto 347196 #5: Paulus 317541 #6: Cosmo 285557 #7: Caiman_Enorme 173358 #8: Ketzy 38872 #9: * 0 #10: * 0
[20:09] Caracol}Elocuente Tri.7596 Geografiaɂatval˿CUALgESgELgNOMBREgDEgPOBLACIONgMASgCORTOgDEgESPA񁿃01g?g [20:09] Caracol}Elocuente
Tri.7596 Geografiaɂatval˿CUALgESgELgNOMBREgDEgPOBLACIONgMASgCORTOgDEgESPA񁿃01g?g
[20:09] Caracol}Elocuente 1 Pista: ** Valor pregunta : 22619 Puntos [20:09] Caracol}Elocuente
1 Pista: ** Valor pregunta : 22619 Puntos
[20:09] Jirafa\Letal eu [20:09] Jirafa\Letal
eu
[20:09] Caracol}Elocuente 2 Pista: ea 30 segundos y 22619 Puntos [20:09] Caracol}Elocuente
2 Pista: ea 30 segundos y 22619 Puntos
[20:09] Caiman_Enorme ea [20:09] Caiman_Enorme
ea
[20:09] Jirafa\Letal ea [20:09] Jirafa\Letal
ea
[20:09] Caracol}Elocuente �emuestra lo que sabes Caiman_Enorme! Has respondido "ea" correctamente y eso te da: �2619�12 puntos [20:09] Caracol}Elocuente
�emuestra lo que sabes Caiman_Enorme! Has respondido "ea" correctamente y eso te da: �2619�12 puntos
[20:09] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:09] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:09] Caracol}Elocuente Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 195977, SEMANA: 195977 y MES: 195977 [20:09] Caracol}Elocuente
Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 195977, SEMANA: 195977 y MES: 195977
[20:09] Caiman_Enorme eo [20:09] Caiman_Enorme
eo
[20:09] Caracol}Elocuente Tri.4511 Geografiaɓebosin˿Cuᬃ01eesjlawcapitaledelMoraviawmeridional?q?q [20:09] Caracol}Elocuente
Tri.4511 Geografiaɓebosin˿Cuᬃ01eesjlawcapitaledelMoraviawmeridional?q?q
[20:09] Caracol}Elocuente 1 Pista: **** Valor pregunta : 19843 Puntos [20:09] Caracol}Elocuente
1 Pista: **** Valor pregunta : 19843 Puntos
[20:09] Jirafa\Letal me gasnastes missmaxis de nuevo [20:09] Jirafa\Letal
me gasnastes missmaxis de nuevo
[20:09] Jirafa\Letal xD [20:09] Jirafa\Letal
xD
[20:09] Caracol}Elocuente 2 Pista: brn* 30 segundos y 19843 Puntos [20:09] Caracol}Elocuente
2 Pista: brn* 30 segundos y 19843 Puntos
[20:09] Caiman_Enorme brns [20:09] Caiman_Enorme
brns
[20:10] Caiman_Enorme brnz [20:10] Caiman_Enorme
brnz
[20:10] Caiman_Enorme brne [20:10] Caiman_Enorme
brne
[20:10] Caiman_Enorme brna [20:10] Caiman_Enorme
brna
[20:10] Caracol}Elocuente 3 Pista: brno 15 segundos y 19843 Puntos [20:10] Caracol}Elocuente
3 Pista: brno 15 segundos y 19843 Puntos
[20:10] Caiman_Enorme xd [20:10] Caiman_Enorme
xd
[20:10] Caiman_Enorme brno [20:10] Caiman_Enorme
brno
[20:10] Caracol}Elocuente �Ol頃04Caiman_Enorme!! Has contestado: "brno" en �5.015 segundos y sumas �9843�12 puntos a tu marcador. �Sigue as� [20:10] Caracol}Elocuente
�Ol頃04Caiman_Enorme!! Has contestado: "brno" en �5.015 segundos y sumas �9843�12 puntos a tu marcador. �Sigue as�
[20:10] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:10] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:10] Caracol}Elocuente Caiman_Enorme has acertado 2 seguidas!! Puntos HOY: 215820, SEMANA: 215820 y MES: 215820 [20:10] Caracol}Elocuente
Caiman_Enorme has acertado 2 seguidas!! Puntos HOY: 215820, SEMANA: 215820 y MES: 215820
[20:10] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [20:10] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[20:10] Caracol}Elocuente Tri.3147 GastronomiaɌuik˿DEeQUEeCOMUNDADeAUTONOMAeESeLAeDENOMINACIONeDEeORIGENe"SOMONTANO"e?e [20:10] Caracol}Elocuente
Tri.3147 GastronomiaɌuik˿DEeQUEeCOMUNDADeAUTONOMAeESeLAeDENOMINACIONeDEeORIGENe"SOMONTANO"e?e
[20:10] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 6053 Puntos [20:10] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 6053 Puntos
[20:10] Caracol}Elocuente 2 Pista: ara*** 30 segundos y 6053 Puntos [20:10] Caracol}Elocuente
2 Pista: ara*** 30 segundos y 6053 Puntos
[20:10] Caracol}Elocuente 3 Pista: ara*o* 15 segundos y 6053 Puntos [20:10] Caracol}Elocuente
3 Pista: ara*o* 15 segundos y 6053 Puntos
[20:10] CaballitoDeMar-Respetable ¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [20:10] CaballitoDeMar-Respetable
¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[20:11] Caracol}Elocuente Tiempo! La respuesta es -> aragon <- [20:11] Caracol}Elocuente
Tiempo! La respuesta es -> aragon <-
[20:11] Caracol}Elocuente R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414 [20:11] Caracol}Elocuente
R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414
[20:11] Caracol}Elocuente Tri.9763 Arteɐsico666˥scultorvbarrocojitalianoj?q [20:11] Caracol}Elocuente
Tri.9763 Arteɐsico666˥scultorvbarrocojitalianoj?q
[20:11] Caracol}Elocuente 1 Pista: **** ******* ******* Valor pregunta : 11008 Puntos [20:11] Caracol}Elocuente
1 Pista: **** ******* ******* Valor pregunta : 11008 Puntos
[20:11] Caracol}Elocuente 2 Pista: gia* ******* ******* 30 segundos y 11008 Puntos [20:11] Caracol}Elocuente
2 Pista: gia* ******* ******* 30 segundos y 11008 Puntos
[20:11] Caracol}Elocuente 3 Pista: gia* *o*e**o *e**i*i 15 segundos y 11008 Puntos [20:11] Caracol}Elocuente
3 Pista: gia* *o*e**o *e**i*i 15 segundos y 11008 Puntos
[20:12] Caracol}Elocuente Tiempo! La respuesta es -> gian�orenzo�ernini <- [20:12] Caracol}Elocuente
Tiempo! La respuesta es -> gian�orenzo�ernini <-
[20:12] Caracol}Elocuente If you think a Q&A is wrong, please call an OP [20:12] Caracol}Elocuente
If you think a Q&A is wrong, please call an OP
[20:12] Caracol}Elocuente Tri.8312 DeporteɌawgiver˿FutboldesoafGoldcomomRugbyxesoaf....m?m [20:12] Caracol}Elocuente
Tri.8312 DeporteɌawgiver˿FutboldesoafGoldcomomRugbyxesoaf....m?m
[20:12] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 13986 Puntos [20:12] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 13986 Puntos
[20:12] Caracol}Elocuente 2 Pista: ens*** 30 segundos y 13986 Puntos [20:12] Caracol}Elocuente
2 Pista: ens*** 30 segundos y 13986 Puntos
[20:12] Caiman_Enorme ensayo [20:12] Caiman_Enorme
ensayo
[20:12] Caracol}Elocuente �Increible!! Caiman_Enorme contest󺠃04"ensayo" en �0.703 segundos, y ha ganado �3986�12 puntos [20:12] Caracol}Elocuente
�Increible!! Caiman_Enorme contest󺠃04"ensayo" en �0.703 segundos, y ha ganado �3986�12 puntos
[20:12] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:12] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:12] Caracol}Elocuente Caiman_Enorme has acertado 3 seguidas!! Puntos HOY: 229806, SEMANA: 229806 y MES: 229806 [20:12] Caracol}Elocuente
Caiman_Enorme has acertado 3 seguidas!! Puntos HOY: 229806, SEMANA: 229806 y MES: 229806
[20:12] Caracol}Elocuente R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087 [20:12] Caracol}Elocuente
R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087
[20:12] Caracol}Elocuente Tri.47 CienciaɍarcaAcme˿CuantodvaleaCos(60Щz?z?z [20:12] Caracol}Elocuente
Tri.47 CienciaɍarcaAcme˿CuantodvaleaCos(60Щz?z?z
[20:12] Caracol}Elocuente 1 Pista: *,* Valor pregunta : 9394 Puntos [20:12] Caracol}Elocuente
1 Pista: *,* Valor pregunta : 9394 Puntos
[20:12] Jirafa\Letal okay ya trigo dj en la radio missmaxis [20:12] Jirafa\Letal
okay ya trigo dj en la radio missmaxis
[20:12] Jirafa\Letal traigo [20:12] Jirafa\Letal
traigo
[20:13] Caracol}Elocuente 2 Pista: 0,5 30 segundos y 9394 Puntos [20:13] Caracol}Elocuente
2 Pista: 0,5 30 segundos y 9394 Puntos
[20:13] Jirafa\Letal 0,5 [20:13] Jirafa\Letal
0,5
[20:13] Caracol}Elocuente �Suma y sigue Jirafa\Letal!! La respuesta: "0,5" incrementa tu marcador en �394�12 puntos [20:13] Caracol}Elocuente
�Suma y sigue Jirafa\Letal!! La respuesta: "0,5" incrementa tu marcador en �394�12 puntos
[20:13] Caracol}Elocuente ACTION awards Jirafa\Letal with a +v for having over 15000 points [20:13] Caracol}Elocuente
ACTION awards Jirafa\Letal with a +v for having over 15000 points
[20:13] Caracol}Elocuente Jirafa\Letal has acertado 1 seguidas!! Puntos HOY: 927787, SEMANA: 1181538 y MES: 2299665 [20:13] Caracol}Elocuente
Jirafa\Letal has acertado 1 seguidas!! Puntos HOY: 927787, SEMANA: 1181538 y MES: 2299665
[20:13] Caiman_Enorme Oh! [20:13] Caiman_Enorme
Oh!
[20:13] Caracol}Elocuente For The Competitive Edge type !pingme [20:13] Caracol}Elocuente
For The Competitive Edge type !pingme
[20:13] Caracol}Elocuente Tri.10151 Geografiaɂatval˿ENxQUExPROVINCIAxESTAxAIA?x?x [20:13] Caracol}Elocuente
Tri.10151 Geografiaɂatval˿ENxQUExPROVINCIAxESTAxAIA?x?x
[20:13] Caracol}Elocuente 1 Pista: ********* Valor pregunta : 23005 Puntos [20:13] Caracol}Elocuente
1 Pista: ********* Valor pregunta : 23005 Puntos
[20:13] Caracol}Elocuente 2 Pista: gui****** 30 segundos y 23005 Puntos [20:13] Caracol}Elocuente
2 Pista: gui****** 30 segundos y 23005 Puntos
[20:13] Caiman_Enorme guintana [20:13] Caiman_Enorme
guintana
[20:13] Caracol}Elocuente 3 Pista: gui*u**oa 15 segundos y 23005 Puntos [20:13] Caracol}Elocuente
3 Pista: gui*u**oa 15 segundos y 23005 Puntos
[20:13] Caiman_Enorme complicado esa [20:13] Caiman_Enorme
complicado esa
[20:13] Caracol}Elocuente Tiempo! La respuesta es -> guipuzcoa <- [20:13] Caracol}Elocuente
Tiempo! La respuesta es -> guipuzcoa <-
[20:14] Caracol}Elocuente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [20:14] Caracol}Elocuente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[20:14] Caracol}Elocuente Tri.8066 Fisica-QuimicaɐiNKiTa˿COMOaSEaLLAMAaLAAPLICACIONaDEaDEaLASaLEYESaDEaLAaFISICAaAaLAaPRODUCCION,aTRATAMIENTO,aTRANSPORTEaYaUTILIZACIONaDEaLAaENERGIAaELECTRICAa?a [20:14] Caracol}Elocuente
Tri.8066 Fisica-QuimicaɐiNKiTa˿COMOaSEaLLAMAaLAAPLICACIONaDEaDEaLASaLEYESaDEaLAaFISICAaAaLAaPRODUCCION,aTRATAMIENTO,aTRANSPORTEaYaUTILIZACIONaDEaLAaENERGIAaELECTRICAa?a
[20:14] Caracol}Elocuente 1 Pista: ************* Pregunta de BONUS : 25000 Puntos [20:14] Caracol}Elocuente
1 Pista: ************* Pregunta de BONUS : 25000 Puntos
[20:14] Caracol}Elocuente 2 Pista: ele********** 30 segundos y 25000 Puntos [20:14] Caracol}Elocuente
2 Pista: ele********** 30 segundos y 25000 Puntos
[20:14] Jirafa\Letal ok listo [20:14] Jirafa\Letal
ok listo
[20:14] Caracol}Elocuente 3 Pista: ele***o*e**ia 15 segundos y 25000 Puntos [20:14] Caracol}Elocuente
3 Pista: ele***o*e**ia 15 segundos y 25000 Puntos
[20:14] Caracol}Elocuente Tiempo! La respuesta es -> electrotecnia <- [20:14] Caracol}Elocuente
Tiempo! La respuesta es -> electrotecnia <-
[20:14] Caiman_Enorme electo [20:14] Caiman_Enorme
electo
[20:15] Caracol}Elocuente R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2299665 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: wilby 597825 [20:15] Caracol}Elocuente
R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2299665 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: wilby 597825
[20:15] Caracol}Elocuente Tri.16686 Fisica-QuimicaɞSergio^˿Amquencorrespondenelucocientendelutrabajoxentrenelutiempox?m [20:15] Caracol}Elocuente
Tri.16686 Fisica-QuimicaɞSergio^˿Amquencorrespondenelucocientendelutrabajoxentrenelutiempox?m
[20:15] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 24900 Puntos [20:15] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 24900 Puntos
[20:15] Caracol}Elocuente 2 Pista: pot***** 30 segundos y 24900 Puntos [20:15] Caracol}Elocuente
2 Pista: pot***** 30 segundos y 24900 Puntos
[20:15] Caracol}Elocuente 3 Pista: pote**ia 15 segundos y 24900 Puntos [20:15] Caracol}Elocuente
3 Pista: pote**ia 15 segundos y 24900 Puntos
[20:15] Caracol}Elocuente Tiempo! La respuesta es -> potencia <- [20:15] Caracol}Elocuente
Tiempo! La respuesta es -> potencia <-
[20:16] Caracol}Elocuente Please refrain from using Extreme Bad Language [20:16] Caracol}Elocuente
Please refrain from using Extreme Bad Language
[20:16] Caracol}Elocuente Tri.13713 EconomiaɊAVEA˿22yDEyMAYOyDEy1975:yQUEyMARCAyDEyCOCHESyITALIANAyCIERRAySUSyPUERTASyAyCAUSAyDEySUSyDEUDASy?y [20:16] Caracol}Elocuente
Tri.13713 EconomiaɊAVEA˿22yDEyMAYOyDEy1975:yQUEyMARCAyDEyCOCHESyITALIANAyCIERRAySUSyPUERTASyAyCAUSAyDEySUSyDEUDASy?y
[20:16] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 10436 Puntos [20:16] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 10436 Puntos
[20:16] Caracol}Elocuente 2 Pista: mas***** 30 segundos y 10436 Puntos [20:16] Caracol}Elocuente
2 Pista: mas***** 30 segundos y 10436 Puntos
[20:16] Caracol}Elocuente 3 Pista: mase*a*i 15 segundos y 10436 Puntos [20:16] Caracol}Elocuente
3 Pista: mase*a*i 15 segundos y 10436 Puntos
[20:16] Caiman_Enorme maserati [20:16] Caiman_Enorme
maserati
[20:16] Caracol}Elocuente �Ol頃04Caiman_Enorme!! Has contestado: "maserati" en �5.125 segundos y sumas �0436�12 puntos a tu marcador. �Sigue as� [20:16] Caracol}Elocuente
�Ol頃04Caiman_Enorme!! Has contestado: "maserati" en �5.125 segundos y sumas �0436�12 puntos a tu marcador. �Sigue as�
[20:16] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:16] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:16] Caracol}Elocuente Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 240242, SEMANA: 240242 y MES: 240242 [20:16] Caracol}Elocuente
Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 240242, SEMANA: 240242 y MES: 240242
[20:16] Caiman_Enorme viajero te fuistes? [20:16] Caiman_Enorme
viajero te fuistes?
[20:16] Caracol}Elocuente This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente [20:16] Caracol}Elocuente
This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente
[20:16] Caracol}Elocuente Tri.17665 DeporteɃarPEnTer˿Cuᬃ01resmladpropiedadwm᳃01mbarataddelrMonopolyv?m [20:16] Caracol}Elocuente
Tri.17665 DeporteɃarPEnTer˿Cuᬃ01resmladpropiedadwm᳃01mbarataddelrMonopolyv?m
[20:16] Caracol}Elocuente 1 Pista: ***** ** ******** Valor pregunta : 18763 Puntos [20:16] Caracol}Elocuente
1 Pista: ***** ** ******** Valor pregunta : 18763 Puntos
[20:17] Caracol}Elocuente 2 Pista: ron** ** ******** 30 segundos y 18763 Puntos [20:17] Caracol}Elocuente
2 Pista: ron** ** ******** 30 segundos y 18763 Puntos
[20:17] Caracol}Elocuente 3 Pista: ron*a *e *a*e**ia 15 segundos y 18763 Puntos [20:17] Caracol}Elocuente
3 Pista: ron*a *e *a*e**ia 15 segundos y 18763 Puntos
[20:17] Caracol}Elocuente Tiempo! La respuesta es -> ronda�e�alencia <- [20:17] Caracol}Elocuente
Tiempo! La respuesta es -> ronda�e�alencia <-
[20:17] Caracol}Elocuente This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeCaTwaLk_z 19830 #14: FANTASMAMEXICO 5048 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [20:17] Caracol}Elocuente
This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeCaTwaLk_z 19830 #14: FANTASMAMEXICO 5048 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[20:17] Caracol}Elocuente Tri.3455 MitologiaɁigua˿Islazoycontinentenfabuloso,rquensensuponensumergidoy?r [20:17] Caracol}Elocuente
Tri.3455 MitologiaɁigua˿Islazoycontinentenfabuloso,rquensensuponensumergidoy?r
[20:17] Caracol}Elocuente 1 Pista: ********* Pregunta de BONUS : 50000 Puntos [20:17] Caracol}Elocuente
1 Pista: ********* Pregunta de BONUS : 50000 Puntos
[20:17] Jirafa\Letal no aqui estoy missmaxis a tus ordenes ... [20:17] Jirafa\Letal
no aqui estoy missmaxis a tus ordenes ...
[20:17] Jirafa\Letal no soy bot xD [20:17] Jirafa\Letal
no soy bot xD
[20:17] Caracol}Elocuente 2 Pista: atl****** 30 segundos y 50000 Puntos [20:17] Caracol}Elocuente
2 Pista: atl****** 30 segundos y 50000 Puntos
[20:17] Caiman_Enorme ah okey [20:17] Caiman_Enorme
ah okey
[20:18] Caiman_Enorme atlantico [20:18] Caiman_Enorme
atlantico
[20:18] Caiman_Enorme atlanta [20:18] Caiman_Enorme
atlanta
[20:18] Caiman_Enorme atlartica [20:18] Caiman_Enorme
atlartica
[20:18] Jirafa\Letal atlartico [20:18] Jirafa\Letal
atlartico
[20:18] Caracol}Elocuente 3 Pista: atla**i*a 15 segundos y 50000 Puntos [20:18] Caracol}Elocuente
3 Pista: atla**i*a 15 segundos y 50000 Puntos
[20:18] Caiman_Enorme ni idea [20:18] Caiman_Enorme
ni idea
[20:18] Jirafa\Letal nada [20:18] Jirafa\Letal
nada
[20:18] Caracol}Elocuente �e nota que sabes mucho de esto Caiman_Enorme! Tu respuesta "atlantida" es correcta y ganas �0000�12 puntos [20:18] Caracol}Elocuente
�e nota que sabes mucho de esto Caiman_Enorme! Tu respuesta "atlantida" es correcta y ganas �0000�12 puntos
[20:18] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:18] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:18] Caracol}Elocuente Caiman_Enorme has acertado 2 seguidas!! Puntos HOY: 290242, SEMANA: 290242 y MES: 290242 [20:18] Caracol}Elocuente
Caiman_Enorme has acertado 2 seguidas!! Puntos HOY: 290242, SEMANA: 290242 y MES: 290242
[20:18] Caiman_Enorme atlantida [20:18] Caiman_Enorme
atlantida
[20:18] Caiman_Enorme esa [20:18] Caiman_Enorme
esa
[20:18] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [20:18] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[20:18] Caracol}Elocuente Tri.9479 Gastronomiaɐsico666˰ezbglobobvenenosobdevJap󮃰1fconsideradobunfmanjarxexquisitob?b [20:18] Caracol}Elocuente
Tri.9479 Gastronomiaɐsico666˰ezbglobobvenenosobdevJap󮃰1fconsideradobunfmanjarxexquisitob?b
[20:18] Caracol}Elocuente 1 Pista: **** Pregunta de BONUS : 100000 Puntos [20:18] Caracol}Elocuente
1 Pista: **** Pregunta de BONUS : 100000 Puntos
[20:18] Jirafa\Letal buena [20:18] Jirafa\Letal
buena
[20:18] Caiman_Enorme dios mucho puntos :)) [20:18] Caiman_Enorme
dios mucho puntos :))
[20:18] Jirafa\Letal si [20:18] Jirafa\Letal
si
[20:18] Caracol}Elocuente 2 Pista: fug* 30 segundos y 100000 Puntos [20:18] Caracol}Elocuente
2 Pista: fug* 30 segundos y 100000 Puntos
[20:18] Caiman_Enorme fuga [20:18] Caiman_Enorme
fuga
[20:18] Jirafa\Letal fuga [20:18] Jirafa\Letal
fuga
[20:18] Caiman_Enorme fugo [20:18] Caiman_Enorme
fugo
[20:18] Jirafa\Letal nada [20:18] Jirafa\Letal
nada
[20:18] Caiman_Enorme fuge [20:18] Caiman_Enorme
fuge
[20:18] Jirafa\Letal fusi [20:18] Jirafa\Letal
fusi
[20:18] Caiman_Enorme fuga [20:18] Caiman_Enorme
fuga
[20:18] Caracol}Elocuente 3 Pista: fugu 15 segundos y 100000 Puntos [20:18] Caracol}Elocuente
3 Pista: fugu 15 segundos y 100000 Puntos
[20:18] Caiman_Enorme fuge [20:18] Caiman_Enorme
fuge
[20:18] Caracol}Elocuente �Est᳠que lo tiras Caiman_Enorme!! ߃󭯠supiste que "fugu" era la respuesta? Venga, �00000�12 puntos suben a tu marcador [20:18] Caracol}Elocuente
�Est᳠que lo tiras Caiman_Enorme!! ߃󭯠supiste que "fugu" era la respuesta? Venga, �00000�12 puntos suben a tu marcador
[20:18] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:18] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:18] Caracol}Elocuente Caiman_Enorme has acertado 3 seguidas!! Puntos HOY: 390242, SEMANA: 390242 y MES: 390242 [20:18] Caracol}Elocuente
Caiman_Enorme has acertado 3 seguidas!! Puntos HOY: 390242, SEMANA: 390242 y MES: 390242
[20:18] Caiman_Enorme fugu [20:18] Caiman_Enorme
fugu
[20:19] Jirafa\Letal fogo [20:19] Jirafa\Letal
fogo
[20:19] Caracol}Elocuente This MONTHS Top 11-20: - #11: Cosmo 285557 #12: Karen 285487 #13: Gladiadora_del_Caribe95 276694 #14: Alii 264411 #15: KaZuMa_KiRyU 257930 #16: Caiman_Enorme 240242 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: Rodolfo516 49625 [20:19] Caracol}Elocuente
This MONTHS Top 11-20: - #11: Cosmo 285557 #12: Karen 285487 #13: Gladiadora_del_Caribe95 276694 #14: Alii 264411 #15: KaZuMa_KiRyU 257930 #16: Caiman_Enorme 240242 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: Rodolfo516 49625
[20:19] Caracol}Elocuente Tri.3512 MiscelaneaɔeLaRaNhA˿Buenofesntenercamigosn?k [20:19] Caracol}Elocuente
Tri.3512 MiscelaneaɔeLaRaNhA˿Buenofesntenercamigosn?k
[20:19] Caracol}Elocuente 1 Pista: ****** *** ** ** ******** Valor pregunta : 10956 Puntos [20:19] Caracol}Elocuente
1 Pista: ****** *** ** ** ******** Valor pregunta : 10956 Puntos
[20:19] Caracol}Elocuente 2 Pista: aun*** *** ** ** ******** 30 segundos y 10956 Puntos [20:19] Caracol}Elocuente
2 Pista: aun*** *** ** ** ******** 30 segundos y 10956 Puntos
[20:19] Jirafa\Letal me ganastes de nuevo como me como las unas [20:19] Jirafa\Letal
me ganastes de nuevo como me como las unas
[20:19] Jirafa\Letal xD [20:19] Jirafa\Letal
xD
[20:19] Caracol}Elocuente 3 Pista: aun*ue *ea e* e* i**ie**o 15 segundos y 10956 Puntos [20:19] Caracol}Elocuente
3 Pista: aun*ue *ea e* e* i**ie**o 15 segundos y 10956 Puntos
[20:19] Caiman_Enorme cuidado con la carnita jajajjajajaja [20:19] Caiman_Enorme
cuidado con la carnita jajajjajajaja
[20:19] Caracol}Elocuente Tiempo! La respuesta es -> aunque�ea�n�l�nfierno <- [20:19] Caracol}Elocuente
Tiempo! La respuesta es -> aunque�ea�n�l�nfierno <-
[20:20] Caracol}Elocuente R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206 [20:20] Caracol}Elocuente
R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206
[20:20] Caracol}Elocuente Tri.981 HistoriaɊAVEA˿01/01/1993:QUEzANTIGUOzPAISzSEzDIVIDEzENzDOSz?z [20:20] Caracol}Elocuente
Tri.981 HistoriaɊAVEA˿01/01/1993:QUEzANTIGUOzPAISzSEzDIVIDEzENzDOSz?z
[20:20] Caracol}Elocuente 1 Pista: ************** Valor pregunta : 13284 Puntos [20:20] Caracol}Elocuente
1 Pista: ************** Valor pregunta : 13284 Puntos
[20:20] Jirafa\Letal deja pido un tema missmaxis [20:20] Jirafa\Letal
deja pido un tema missmaxis
[20:20] Caracol}Elocuente 2 Pista: CHE*********** 30 segundos y 13284 Puntos [20:20] Caracol}Elocuente
2 Pista: CHE*********** 30 segundos y 13284 Puntos
[20:20] Caiman_Enorme !pido un tema [20:20] Caiman_Enorme
!pido un tema
[20:20] Caracol}Elocuente 3 Pista: CHE*O**O*A*UIA 15 segundos y 13284 Puntos [20:20] Caracol}Elocuente
3 Pista: CHE*O**O*A*UIA 15 segundos y 13284 Puntos
[20:20] Caracol}Elocuente �Muy bien Caiman_Enorme!! Acertaste "checoslovaquia" en tan s󬯠�9.375 segundos y por eso has ganado: �3284�12 puntos [20:20] Caracol}Elocuente
�Muy bien Caiman_Enorme!! Acertaste "checoslovaquia" en tan s󬯠�9.375 segundos y por eso has ganado: �3284�12 puntos
[20:20] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:20] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:20] Caracol}Elocuente Caiman_Enorme has acertado 4 seguidas!! Puntos HOY: 403526, SEMANA: 403526 y MES: 403526 [20:20] Caracol}Elocuente
Caiman_Enorme has acertado 4 seguidas!! Puntos HOY: 403526, SEMANA: 403526 y MES: 403526
[20:20] Caiman_Enorme checoslovaquia [20:20] Caiman_Enorme
checoslovaquia
[20:20] Caracol}Elocuente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [20:20] Caracol}Elocuente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[20:20] Caracol}Elocuente Tri.18497 Arteɴjmm.com˿ElsDoncels(1486)nm᳃01sfamosodesselsde...n?n [20:20] Caracol}Elocuente
Tri.18497 Arteɴjmm.com˿ElsDoncels(1486)nm᳃01sfamosodesselsde...n?n
[20:20] Caracol}Elocuente 1 Pista: ***�**** Pregunta de BONUS : 50000 Puntos [20:20] Caracol}Elocuente
1 Pista: ***�**** Pregunta de BONUS : 50000 Puntos
[20:20] Caiman_Enorme !tema [20:20] Caiman_Enorme
!tema
[20:21] Caracol}Elocuente 2 Pista: sig�**** 30 segundos y 50000 Puntos [20:21] Caracol}Elocuente
2 Pista: sig�**** 30 segundos y 50000 Puntos
[20:21] Caracol}Elocuente 3 Pista: sig�e**a 15 segundos y 50000 Puntos [20:21] Caracol}Elocuente
3 Pista: sig�e**a 15 segundos y 50000 Puntos
[20:21] Jirafa\Letal es asi ahora missmaxis . [20:21] Jirafa\Letal
es asi ahora missmaxis .
[20:21] Caracol}Elocuente Tiempo! La respuesta es -> sig�enza <- [20:21] Caracol}Elocuente
Tiempo! La respuesta es -> sig�enza <-
[20:21] Caracol}Elocuente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [20:21] Caracol}Elocuente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[20:21] Caracol}Elocuente Tri.10243 Historiaɳubmarin˿Conaqu郰1xnombreaeskconocidaqlaqculturaqc鬴icaqqueaseadesarroll󃰱xenaell600xa.c.?x?x [20:21] Caracol}Elocuente
Tri.10243 Historiaɳubmarin˿Conaqu郰1xnombreaeskconocidaqlaqculturaqc鬴icaqqueaseadesarroll󃰱xenaell600xa.c.?x?x
[20:21] Caracol}Elocuente 1 Pista: ********* Valor pregunta : 9059 Puntos [20:21] Caracol}Elocuente
1 Pista: ********* Valor pregunta : 9059 Puntos
[20:21] Caiman_Enorme como es la cosa? [20:21] Caiman_Enorme
como es la cosa?
[20:21] Jirafa\Letal con este signo . [20:21] Jirafa\Letal
con este signo .
[20:21] Jirafa\Letal no mas ! [20:21] Jirafa\Letal
no mas !
[20:22] Jirafa\Letal .tema [20:22] Jirafa\Letal
.tema
[20:22] CaballitoDeMar-Respetable » Ahora suena: musza - Bonnie & Clyde · https://www.radiolunademiel.com [20:22] CaballitoDeMar-Respetable
» Ahora suena: musza - Bonnie & Clyde · https://www.radiolunademiel.com
[20:22] Caracol}Elocuente 2 Pista: hal****** 30 segundos y 9059 Puntos [20:22] Caracol}Elocuente
2 Pista: hal****** 30 segundos y 9059 Puntos
[20:22] Caracol}Elocuente 3 Pista: hal***a** 15 segundos y 9059 Puntos [20:22] Caracol}Elocuente
3 Pista: hal***a** 15 segundos y 9059 Puntos
[20:22] Jirafa\Letal halloweed [20:22] Jirafa\Letal
halloweed
[20:22] Jirafa\Letal nada [20:22] Jirafa\Letal
nada
[20:22] Caracol}Elocuente Tiempo! La respuesta es -> hallstatt <- [20:22] Caracol}Elocuente
Tiempo! La respuesta es -> hallstatt <-
[20:22] CaballitoDeMar-Respetable « Radio Luna de Miel » DJ: AUTODJ · Tema: Música variada · Peticiones: Cerradas · Canción: musza - Bonnie & Clyde [20:22] CaballitoDeMar-Respetable
« Radio Luna de Miel » DJ: AUTODJ · Tema: Música variada · Peticiones: Cerradas · Canción: musza - Bonnie & Clyde
[20:22] Jirafa\Letal .radio [20:22] Jirafa\Letal
.radio
[20:22] Caiman_Enorme me sale un vampirito ahora !que susto [20:22] Caiman_Enorme
me sale un vampirito ahora !que susto
[20:22] Caracol}Elocuente R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1181538 #5: siva- 692906 #6: Ketzy 610145 #7: Caiman_Enorme 403526 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481 [20:22] Caracol}Elocuente
R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1181538 #5: siva- 692906 #6: Ketzy 610145 #7: Caiman_Enorme 403526 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481
[20:22] Caracol}Elocuente Tri.158 Medicina-SaludɄarklest˿Cuantoppesaoelzelzcerebropdeounehombreoadulto?u?u [20:22] Caracol}Elocuente
Tri.158 Medicina-SaludɄarklest˿Cuantoppesaoelzelzcerebropdeounehombreoadulto?u?u
[20:22] Caracol}Elocuente 1 Pista: **** ****** Valor pregunta : 22869 Puntos [20:22] Caracol}Elocuente
1 Pista: **** ****** Valor pregunta : 22869 Puntos
[20:22] Jirafa\Letal no hay nadies [20:22] Jirafa\Letal
no hay nadies
[20:23] Caracol}Elocuente 2 Pista: 135* ****** 30 segundos y 22869 Puntos [20:23] Caracol}Elocuente
2 Pista: 135* ****** 30 segundos y 22869 Puntos
[20:23] Caracol}Elocuente 3 Pista: 135* **a*o* 15 segundos y 22869 Puntos [20:23] Caracol}Elocuente
3 Pista: 135* **a*o* 15 segundos y 22869 Puntos
[20:23] Caiman_Enorme que pena [20:23] Caiman_Enorme
que pena
[20:23] Caracol}Elocuente Tiempo! La respuesta es -> 1350�ramos <- [20:23] Caracol}Elocuente
Tiempo! La respuesta es -> 1350�ramos <-
[20:23] Jirafa\Letal kieres que te pida un tema en la radio missmaxis [20:23] Jirafa\Letal
kieres que te pida un tema en la radio missmaxis
[20:23] Caracol}Elocuente We feature over 50,000 Q&A ! [20:23] Caracol}Elocuente
We feature over 50,000 Q&A !
[20:23] Caracol}Elocuente Tri.11024 Informaticaɒadian˿EnpJAVAonodexisterlaoherenciaoderclasesxmultiple,oߑu郰1oserutilizaoenpsumlugar?o?o [20:23] Caracol}Elocuente
Tri.11024 Informaticaɒadian˿EnpJAVAonodexisterlaoherenciaoderclasesxmultiple,oߑu郰1oserutilizaoenpsumlugar?o?o
[20:23] Caracol}Elocuente 1 Pista: ********** Valor pregunta : 9982 Puntos [20:23] Caracol}Elocuente
1 Pista: ********** Valor pregunta : 9982 Puntos
[20:23] Jirafa\Letal la que tu gustes [20:23] Jirafa\Letal
la que tu gustes
[20:23] Caracol}Elocuente 2 Pista: int******* 30 segundos y 9982 Puntos [20:23] Caracol}Elocuente
2 Pista: int******* 30 segundos y 9982 Puntos
[20:24] Caiman_Enorme si gracias [20:24] Caiman_Enorme
si gracias
[20:24] Caracol}Elocuente 3 Pista: inte**a*e* 15 segundos y 9982 Puntos [20:24] Caracol}Elocuente
3 Pista: inte**a*e* 15 segundos y 9982 Puntos
[20:24] Jirafa\Letal cual [20:24] Jirafa\Letal
cual
[20:24] Caiman_Enorme me gusta la musica [20:24] Caiman_Enorme
me gusta la musica
[20:24] Caiman_Enorme reggeton [20:24] Caiman_Enorme
reggeton
[20:24] Jirafa\Letal deja por privado [20:24] Jirafa\Letal
deja por privado
[20:24] Caracol}Elocuente Tiempo! La respuesta es -> interfaces <- [20:24] Caracol}Elocuente
Tiempo! La respuesta es -> interfaces <-
[20:24] Jirafa\Letal si reggaeton me encanta [20:24] Jirafa\Letal
si reggaeton me encanta
[20:24] Jirafa\Letal mucho [20:24] Jirafa\Letal
mucho
[20:24] Caracol}Elocuente R᮫ing de HOY: - #1: Jirafa\Letal 927787 #2: Gladiadora_del_Caribe 686734 #3: Grillo{Naranja 616922 #4: Caiman_Enorme 403526 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: Ketzy 38872 #9: * 0 #10: * 0 [20:24] Caracol}Elocuente
R᮫ing de HOY: - #1: Jirafa\Letal 927787 #2: Gladiadora_del_Caribe 686734 #3: Grillo{Naranja 616922 #4: Caiman_Enorme 403526 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: Ketzy 38872 #9: * 0 #10: * 0
[20:24] Caracol}Elocuente Tri.13932 Gastronomiaɢorali˿DEvQUEvISLAvESvPROPIAvLAvCALDERETAvDEvLANGOSTAv?v [20:24] Caracol}Elocuente
Tri.13932 Gastronomiaɢorali˿DEvQUEvISLAvESvPROPIAvLAvCALDERETAvDEvLANGOSTAv?v
[20:24] Caracol}Elocuente 1 Pista: ******* Valor pregunta : 23639 Puntos [20:24] Caracol}Elocuente
1 Pista: ******* Valor pregunta : 23639 Puntos
[20:24] Caiman_Enorme cualquiera que sea es buena [20:24] Caiman_Enorme
cualquiera que sea es buena
[20:24] Caiman_Enorme es perreo nada mas [20:24] Caiman_Enorme
es perreo nada mas
[20:24] Caracol}Elocuente 2 Pista: men**** 30 segundos y 23639 Puntos [20:24] Caracol}Elocuente
2 Pista: men**** 30 segundos y 23639 Puntos
[20:24] Jirafa\Letal okay tonces te pongo ronca [20:24] Jirafa\Letal
okay tonces te pongo ronca
[20:25] Caracol}Elocuente 3 Pista: meno**a 15 segundos y 23639 Puntos [20:25] Caracol}Elocuente
3 Pista: meno**a 15 segundos y 23639 Puntos
[20:25] Jirafa\Letal ya regreso voy a la sala a pedir la radio [20:25] Jirafa\Letal
ya regreso voy a la sala a pedir la radio
[20:25] Caracol}Elocuente Tiempo! La respuesta es -> menorca <- [20:25] Caracol}Elocuente
Tiempo! La respuesta es -> menorca <-
[20:25] Caracol}Elocuente Tri.12334 LiteraturaɞIrati˿Cuᬃ01bestelbt�loxdeglat�ltimatnovelatquegescribi󃰱wJamestJoyce?w?w [20:25] Caracol}Elocuente
Tri.12334 LiteraturaɞIrati˿Cuᬃ01bestelbt�loxdeglat�ltimatnovelatquegescribi󃰱wJamestJoyce?w?w
[20:25] Caracol}Elocuente 1 Pista: ** **** ** ******** Valor pregunta : 9923 Puntos [20:25] Caracol}Elocuente
1 Pista: ** **** ** ******** Valor pregunta : 9923 Puntos
[20:25] Caracol}Elocuente 2 Pista: la�*** ** ******** 30 segundos y 9923 Puntos [20:25] Caracol}Elocuente
2 Pista: la�*** ** ******** 30 segundos y 9923 Puntos
[20:25] CaballitoDeMar-Respetable ¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [20:25] CaballitoDeMar-Respetable
¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[20:26] Caracol}Elocuente 3 Pista: la�e*a *e *i**e*a* 15 segundos y 9923 Puntos [20:26] Caracol}Elocuente
3 Pista: la�e*a *e *i**e*a* 15 segundos y 9923 Puntos
[20:26] Caracol}Elocuente Tiempo! La respuesta es -> la�ela�e�innegan <- [20:26] Caracol}Elocuente
Tiempo! La respuesta es -> la�ela�e�innegan <-
[20:26] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [20:26] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[20:26] Caracol}Elocuente Tri.18307 Biologiaɦlipp_er˿Cuantostcromosomasttienenxlastcelulastdesunxperro?(letras)k?k [20:26] Caracol}Elocuente
Tri.18307 Biologiaɦlipp_er˿Cuantostcromosomasttienenxlastcelulastdesunxperro?(letras)k?k
[20:26] Caracol}Elocuente 1 Pista: ******* * **** Pregunta de BONUS : 100000 Puntos [20:26] Caracol}Elocuente
1 Pista: ******* * **** Pregunta de BONUS : 100000 Puntos
[20:26] Caracol}Elocuente 2 Pista: set**** * **** 30 segundos y 100000 Puntos [20:26] Caracol}Elocuente
2 Pista: set**** * **** 30 segundos y 100000 Puntos
[20:26] Caracol}Elocuente 3 Pista: sete**a * o**o 15 segundos y 100000 Puntos [20:26] Caracol}Elocuente
3 Pista: sete**a * o**o 15 segundos y 100000 Puntos
[20:26] Caiman_Enorme setenta y seis [20:26] Caiman_Enorme
setenta y seis
[20:26] Caracol}Elocuente �Increible!! Caiman_Enorme contest󺠃04"setenta y ocho" en �3.86 segundos, y ha ganado �00000�12 puntos [20:26] Caracol}Elocuente
�Increible!! Caiman_Enorme contest󺠃04"setenta y ocho" en �3.86 segundos, y ha ganado �00000�12 puntos
[20:26] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:26] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:26] Caracol}Elocuente Caiman_Enorme has acertado 5 seguidas!! Puntos HOY: 503526, SEMANA: 503526 y MES: 503526 [20:26] Caracol}Elocuente
Caiman_Enorme has acertado 5 seguidas!! Puntos HOY: 503526, SEMANA: 503526 y MES: 503526
[20:26] Caiman_Enorme setenta y ocho [20:26] Caiman_Enorme
setenta y ocho
[20:27] Caracol}Elocuente R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414 [20:27] Caracol}Elocuente
R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414
[20:27] Caracol}Elocuente Tri.2678 MitologiaɆrigotora˿Diosarjaponesardelksolkyklarluz?z?z [20:27] Caracol}Elocuente
Tri.2678 MitologiaɆrigotora˿Diosarjaponesardelksolkyklarluz?z?z
[20:27] Caracol}Elocuente 1 Pista: ********* Valor pregunta : 13757 Puntos [20:27] Caracol}Elocuente
1 Pista: ********* Valor pregunta : 13757 Puntos
[20:27] Jirafa\Letal te gusta don omar missmaxis or hector el father [20:27] Jirafa\Letal
te gusta don omar missmaxis or hector el father
[20:27] Caracol}Elocuente 2 Pista: ama****** 30 segundos y 13757 Puntos [20:27] Caracol}Elocuente
2 Pista: ama****** 30 segundos y 13757 Puntos
[20:27] Caiman_Enorme Ambos. [20:27] Caiman_Enorme
Ambos.
[20:27] Jirafa\Letal escuchala radio ahy te la pongo [20:27] Jirafa\Letal
escuchala radio ahy te la pongo
[20:27] Caracol}Elocuente 3 Pista: ama*e*a*u 15 segundos y 13757 Puntos [20:27] Caracol}Elocuente
3 Pista: ama*e*a*u 15 segundos y 13757 Puntos
[20:27] Caracol}Elocuente Tiempo! La respuesta es -> amaterasu <- [20:27] Caracol}Elocuente
Tiempo! La respuesta es -> amaterasu <-
[20:28] Caracol}Elocuente If you think a Q&A is wrong, please call an OP [20:28] Caracol}Elocuente
If you think a Q&A is wrong, please call an OP
[20:28] Caracol}Elocuente Tri.1199 Informaticaɐax˿EnciclopediaddemMicrosofte?t [20:28] Caracol}Elocuente
Tri.1199 Informaticaɐax˿EnciclopediaddemMicrosofte?t
[20:28] Caracol}Elocuente 1 Pista: ******* Valor pregunta : 18263 Puntos [20:28] Caracol}Elocuente
1 Pista: ******* Valor pregunta : 18263 Puntos
[20:28] Caiman_Enorme donde escucho ahora [20:28] Caiman_Enorme
donde escucho ahora
[20:28] Caracol}Elocuente 2 Pista: Enc**** 30 segundos y 18263 Puntos [20:28] Caracol}Elocuente
2 Pista: Enc**** 30 segundos y 18263 Puntos
[20:28] Caiman_Enorme no me sale la radio [20:28] Caiman_Enorme
no me sale la radio
[20:28] Caracol}Elocuente 3 Pista: Enca**a 15 segundos y 18263 Puntos [20:28] Caracol}Elocuente
3 Pista: Enca**a 15 segundos y 18263 Puntos
[20:28] Jirafa\Letal nencanta [20:28] Jirafa\Letal
nencanta
[20:28] Caracol}Elocuente Tiempo! La respuesta es -> Encarta <- [20:28] Caracol}Elocuente
Tiempo! La respuesta es -> Encarta <-
[20:28] Caracol}Elocuente R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087 [20:28] Caracol}Elocuente
R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087
[20:28] Caracol}Elocuente Tri.517 Cienciaɳtephenwo˿Cuantosja񯳃01jabarcavunxa񯃰1pdeyPluton?m?m [20:28] Caracol}Elocuente
Tri.517 Cienciaɳtephenwo˿Cuantosja񯳃01jabarcavunxa񯃰1pdeyPluton?m?m
[20:28] Caracol}Elocuente 1 Pista: *** Pregunta de BONUS : 100000 Puntos [20:28] Caracol}Elocuente
1 Pista: *** Pregunta de BONUS : 100000 Puntos
[20:29] Caracol}Elocuente 2 Pista: 247 30 segundos y 100000 Puntos [20:29] Caracol}Elocuente
2 Pista: 247 30 segundos y 100000 Puntos
[20:29] Caiman_Enorme 24 [20:29] Caiman_Enorme
24
[20:29] Caiman_Enorme 247 [20:29] Caiman_Enorme
247
[20:29] Caracol}Elocuente �Ol頃04Caiman_Enorme!! Has contestado: "247" en �3.187 segundos y sumas �00000�12 puntos a tu marcador. �Sigue as� [20:29] Caracol}Elocuente
�Ol頃04Caiman_Enorme!! Has contestado: "247" en �3.187 segundos y sumas �00000�12 puntos a tu marcador. �Sigue as�
[20:29] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:29] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:29] Caracol}Elocuente Caiman_Enorme has acertado 6 seguidas!! Puntos HOY: 603526, SEMANA: 603526 y MES: 603526 [20:29] Caracol}Elocuente
Caiman_Enorme has acertado 6 seguidas!! Puntos HOY: 603526, SEMANA: 603526 y MES: 603526
[20:29] Caracol}Elocuente For The Competitive Edge type !pingme [20:29] Caracol}Elocuente
For The Competitive Edge type !pingme
[20:29] Caracol}Elocuente Tri.1694 HistoriaɊAVEA˿DExQUExCIUDADxCHINAxFUExSUxALCADExENTREx1948-49xELxMARISCALxCHINOxCHENxYIx?x [20:29] Caracol}Elocuente
Tri.1694 HistoriaɊAVEA˿DExQUExCIUDADxCHINAxFUExSUxALCADExENTREx1948-49xELxMARISCALxCHINOxCHENxYIx?x
[20:29] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 6818 Puntos [20:29] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 6818 Puntos
[20:29] Caracol}Elocuente 2 Pista: SHA***** 30 segundos y 6818 Puntos [20:29] Caracol}Elocuente
2 Pista: SHA***** 30 segundos y 6818 Puntos
[20:29] Caiman_Enorme hiroshima [20:29] Caiman_Enorme
hiroshima
[20:30] Caracol}Elocuente 3 Pista: SHA***AI 15 segundos y 6818 Puntos [20:30] Caracol}Elocuente
3 Pista: SHA***AI 15 segundos y 6818 Puntos
[20:30] Caracol}Elocuente Tiempo! La respuesta es -> SHANGHAI <- [20:30] Caracol}Elocuente
Tiempo! La respuesta es -> SHANGHAI <-
[20:30] Caracol}Elocuente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [20:30] Caracol}Elocuente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[20:30] Caracol}Elocuente Tri.4658 PoliticaɊAVEA˿01/01/1997:QUIENqDEJAqLAqPRESIDENTAqDEqLAqONUq?q [20:30] Caracol}Elocuente
Tri.4658 PoliticaɊAVEA˿01/01/1997:QUIENqDEJAqLAqPRESIDENTAqDEqLAqONUq?q
[20:30] Caracol}Elocuente 1 Pista: ****** **** Valor pregunta : 18075 Puntos [20:30] Caracol}Elocuente
1 Pista: ****** **** Valor pregunta : 18075 Puntos
[20:30] Caracol}Elocuente 2 Pista: but*** **** 30 segundos y 18075 Puntos [20:30] Caracol}Elocuente
2 Pista: but*** **** 30 segundos y 18075 Puntos
[20:30] Caracol}Elocuente 3 Pista: but*o* *a*i 15 segundos y 18075 Puntos [20:30] Caracol}Elocuente
3 Pista: but*o* *a*i 15 segundos y 18075 Puntos
[20:31] Caracol}Elocuente Tiempo! La respuesta es -> butros�ali <- [20:31] Caracol}Elocuente
Tiempo! La respuesta es -> butros�ali <-
[20:31] Caracol}Elocuente R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2299665 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 603526 [20:31] Caracol}Elocuente
R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2299665 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 603526
[20:31] Caracol}Elocuente Tri.20997 Idiomasɴjmm.com˄efalemᮃ01aatespa񯬺o"Wiefheiߴtdu?"o?o [20:31] Caracol}Elocuente
Tri.20997 Idiomasɴjmm.com˄efalemᮃ01aatespa񯬺o"Wiefheiߴtdu?"o?o
[20:31] Caracol}Elocuente 1 Pista: ߪ*** ** ******? Pregunta de BONUS : 50000 Puntos [20:31] Caracol}Elocuente
1 Pista: ߪ*** ** ******? Pregunta de BONUS : 50000 Puntos
[20:31] Caracol}Elocuente 2 Pista: ߣo** ** ******? 30 segundos y 50000 Puntos [20:31] Caracol}Elocuente
2 Pista: ߣo** ** ******? 30 segundos y 50000 Puntos
[20:31] Caracol}Elocuente 3 Pista: ߣo*o *e **a*a*? 15 segundos y 50000 Puntos [20:31] Caracol}Elocuente
3 Pista: ߣo*o *e **a*a*? 15 segundos y 50000 Puntos
[20:31] Caiman_Enorme ACTION regresa* [20:31] Caiman_Enorme
ACTION regresa*
[20:32] Caracol}Elocuente Tiempo! La respuesta es -> ߣomo�e�lamas? <- [20:32] Caracol}Elocuente
Tiempo! La respuesta es -> ߣomo�e�lamas? <-
[20:32] Caracol}Elocuente Please refrain from using Extreme Bad Language [20:32] Caracol}Elocuente
Please refrain from using Extreme Bad Language
[20:32] Caracol}Elocuente Tri.4093 GeografiaɍARdeJAVA˃IUDADmDEmLAmINDIA,mCAPITALmDELmESTADOmDEmMADHYAmPRADESH,mENmLAmQUEmENmDICIEMBREmDEm1984mSEmPRODUJOmUNmESCAPEmDEmGASmTӘICOmDEmUNAmF�RICAmDEmPRODUCTOSmQU͍ICOS,mQUEmCAUSӃ01mLAmMUERTEmAmM�mDEm3.300mPERSONAS,mYmC [20:32] Caracol}Elocuente
Tri.4093 GeografiaɍARdeJAVA˃IUDADmDEmLAmINDIA,mCAPITALmDELmESTADOmDEmMADHYAmPRADESH,mENmLAmQUEmENmDICIEMBREmDEm1984mSEmPRODUJOmUNmESCAPEmDEmGASmTӘICOmDEmUNAmF�RICAmDEmPRODUCTOSmQU͍ICOS,mQUEmCAUSӃ01mLAmMUERTEmAmM�mDEm3.300mPERSONAS,mYmC
[20:32] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 6856 Puntos [20:32] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 6856 Puntos
[20:32] Caracol}Elocuente 2 Pista: bho*** 30 segundos y 6856 Puntos [20:32] Caracol}Elocuente
2 Pista: bho*** 30 segundos y 6856 Puntos
[20:32] Caracol}Elocuente 3 Pista: bho*a* 15 segundos y 6856 Puntos [20:32] Caracol}Elocuente
3 Pista: bho*a* 15 segundos y 6856 Puntos
[20:33] Caracol}Elocuente Tiempo! La respuesta es -> bhopal <- [20:33] Caracol}Elocuente
Tiempo! La respuesta es -> bhopal <-
[20:33] Caracol}Elocuente This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente [20:33] Caracol}Elocuente
This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente
[20:33] Caracol}Elocuente Tri.991 HistoriaɊAVEA˿9nDEnMAYOnDEn1915:nAnQUEnPAISnCONVIERTEnENnESTADOnVASALLO,nJAPONn?n [20:33] Caracol}Elocuente
Tri.991 HistoriaɊAVEA˿9nDEnMAYOnDEn1915:nAnQUEnPAISnCONVIERTEnENnESTADOnVASALLO,nJAPONn?n
[20:33] Caracol}Elocuente 1 Pista: ***** Valor pregunta : 23731 Puntos [20:33] Caracol}Elocuente
1 Pista: ***** Valor pregunta : 23731 Puntos
[20:33] Caracol}Elocuente 2 Pista: CHI** 30 segundos y 23731 Puntos [20:33] Caracol}Elocuente
2 Pista: CHI** 30 segundos y 23731 Puntos
[20:33] Grillo-Locuaz me tumbaro missmaxis [20:33] Grillo-Locuaz
me tumbaro missmaxis
[20:33] Grillo-Locuaz xD [20:33] Grillo-Locuaz
xD
[20:33] Grillo-Locuaz china [20:33] Grillo-Locuaz
china
[20:33] Caracol}Elocuente �Est᳠que lo tiras Grillo-Locuaz!! ߃󭯠supiste que "china" era la respuesta? Venga, �3731�12 puntos suben a tu marcador [20:33] Caracol}Elocuente
�Est᳠que lo tiras Grillo-Locuaz!! ߃󭯠supiste que "china" era la respuesta? Venga, �3731�12 puntos suben a tu marcador
[20:33] Caracol}Elocuente ACTION awards Grillo-Locuaz with a +v for having over 15000 points [20:33] Caracol}Elocuente
ACTION awards Grillo-Locuaz with a +v for having over 15000 points
[20:33] Caracol}Elocuente Grillo-Locuaz has acertado 1 seguidas!! Puntos HOY: 23731, SEMANA: 23731 y MES: 23731 [20:33] Caracol}Elocuente
Grillo-Locuaz has acertado 1 seguidas!! Puntos HOY: 23731, SEMANA: 23731 y MES: 23731
[20:33] Grillo-Locuaz chino [20:33] Grillo-Locuaz
chino
[20:33] Grillo-Locuaz chile [20:33] Grillo-Locuaz
chile
[20:33] Caracol}Elocuente This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeCaTwaLk_z 19830 #14: FANTASMAMEXICO 5048 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [20:33] Caracol}Elocuente
This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeCaTwaLk_z 19830 #14: FANTASMAMEXICO 5048 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[20:33] Caracol}Elocuente Tri.1001 Fisica-QuimicaɐEDROC˿JAMESrCLERKrMAXWELLrEXPLICOrLArRELACIONrENTRErELECTRICIDADrYrMAGNETISMO.rCONrQUIENrDISCUTIArESTOrArGRITOS?r?r [20:33] Caracol}Elocuente
Tri.1001 Fisica-QuimicaɐEDROC˿JAMESrCLERKrMAXWELLrEXPLICOrLArRELACIONrENTRErELECTRICIDADrYrMAGNETISMO.rCONrQUIENrDISCUTIArESTOrArGRITOS?r?r
[20:33] Caracol}Elocuente 1 Pista: *** ** ***** Valor pregunta : 11836 Puntos [20:33] Caracol}Elocuente
1 Pista: *** ** ***** Valor pregunta : 11836 Puntos
[20:33] Grillo-Locuaz por fin [20:33] Grillo-Locuaz
por fin
[20:34] Grillo-Locuaz se puso las pilas manito [20:34] Grillo-Locuaz
se puso las pilas manito
[20:34] Caracol}Elocuente 2 Pista: CON ** ***** 30 segundos y 11836 Puntos [20:34] Caracol}Elocuente
2 Pista: CON ** ***** 30 segundos y 11836 Puntos
[20:34] Caracol}Elocuente 3 Pista: CON *U *E**O 15 segundos y 11836 Puntos [20:34] Caracol}Elocuente
3 Pista: CON *U *E**O 15 segundos y 11836 Puntos
[20:34] Caracol}Elocuente Tiempo! La respuesta es -> CON�U�ERRO <- [20:34] Caracol}Elocuente
Tiempo! La respuesta es -> CON�U�ERRO <-
[20:34] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [20:34] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[20:34] Caracol}Elocuente Tri.17870 Personajesɖivi˿D󮤥wpas󃰱lsujadolescencianHernᮃ01uCort鳿l?l [20:34] Caracol}Elocuente
Tri.17870 Personajesɖivi˿D󮤥wpas󃰱lsujadolescencianHernᮃ01uCort鳿l?l
[20:34] Caracol}Elocuente 1 Pista: ********* Valor pregunta : 9438 Puntos [20:34] Caracol}Elocuente
1 Pista: ********* Valor pregunta : 9438 Puntos
[20:35] Caracol}Elocuente 2 Pista: sal****** 30 segundos y 9438 Puntos [20:35] Caracol}Elocuente
2 Pista: sal****** 30 segundos y 9438 Puntos
[20:35] Caracol}Elocuente 3 Pista: sala*a**a 15 segundos y 9438 Puntos [20:35] Caracol}Elocuente
3 Pista: sala*a**a 15 segundos y 9438 Puntos
[20:35] Caracol}Elocuente Tiempo! La respuesta es -> salamanca <- [20:35] Caracol}Elocuente
Tiempo! La respuesta es -> salamanca <-
[20:35] Grillo-Locuaz salamanca' [20:35] Grillo-Locuaz
salamanca'
[20:35] Grillo-Locuaz diablos [20:35] Grillo-Locuaz
diablos
[20:35] Caracol}Elocuente This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: Rodolfo516 49625 [20:35] Caracol}Elocuente
This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: Rodolfo516 49625
[20:35] Caracol}Elocuente Tri.8564 Economiaɦlipp_er˿Cualxesgelxpaisgmayorhproductorhdezolivacdelxmundo?s?s [20:35] Caracol}Elocuente
Tri.8564 Economiaɦlipp_er˿Cualxesgelxpaisgmayorhproductorhdezolivacdelxmundo?s?s
[20:35] Caracol}Elocuente 1 Pista: ****񪠃 Valor pregunta : 24186 Puntos [20:35] Caracol}Elocuente
1 Pista: ****񪠃 Valor pregunta : 24186 Puntos
[20:36] Caracol}Elocuente 2 Pista: esp*񪠃 30 segundos y 24186 Puntos [20:36] Caracol}Elocuente
2 Pista: esp*񪠃 30 segundos y 24186 Puntos
[20:36] Caracol}Elocuente 3 Pista: espa񡠃 15 segundos y 24186 Puntos [20:36] Caracol}Elocuente
3 Pista: espa񡠃 15 segundos y 24186 Puntos
[20:36] Caracol}Elocuente Tiempo! La respuesta es -> espa񡠃12 <- [20:36] Caracol}Elocuente
Tiempo! La respuesta es -> espa񡠃12 <-
[20:36] Caracol}Elocuente R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206 [20:36] Caracol}Elocuente
R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206
[20:36] Caracol}Elocuente Tri.69 Informaticaɣuchi-˿CAPACIDADmDEmUNmDISKETTEmDEmALTAmDENSIDADm(ENmMB)m?m [20:36] Caracol}Elocuente
Tri.69 Informaticaɣuchi-˿CAPACIDADmDEmUNmDISKETTEmDEmALTAmDENSIDADm(ENmMB)m?m
[20:36] Caracol}Elocuente 1 Pista: *'** Valor pregunta : 16666 Puntos [20:36] Caracol}Elocuente
1 Pista: *'** Valor pregunta : 16666 Puntos
[20:36] Caracol}Elocuente 2 Pista: 1'4* 30 segundos y 16666 Puntos [20:36] Caracol}Elocuente
2 Pista: 1'4* 30 segundos y 16666 Puntos
[20:37] Caracol}Elocuente 3 Pista: 1'4* 15 segundos y 16666 Puntos [20:37] Caracol}Elocuente
3 Pista: 1'4* 15 segundos y 16666 Puntos
[20:37] Caracol}Elocuente Tiempo! La respuesta es -> 1'44 <- [20:37] Caracol}Elocuente
Tiempo! La respuesta es -> 1'44 <-
[20:37] Caracol}Elocuente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [20:37] Caracol}Elocuente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[20:37] Caracol}Elocuente Tri.11867 Cienciaɋoldotxu˿Astronom�iquesplanetasydelwsistemansolarttienenlanillosy?i [20:37] Caracol}Elocuente
Tri.11867 Cienciaɋoldotxu˿Astronom�iquesplanetasydelwsistemansolarttienenlanillosy?i
[20:37] Caracol}Elocuente 1 Pista: ******* ******* * ***** Valor pregunta : 13293 Puntos [20:37] Caracol}Elocuente
1 Pista: ******* ******* * ***** Valor pregunta : 13293 Puntos
[20:37] Jirafa\Letal asi yo mido [20:37] Jirafa\Letal
asi yo mido
[20:37] Jirafa\Letal xD [20:37] Jirafa\Letal
xD
[20:37] Caracol}Elocuente 2 Pista: jup**** ******* * ***** 30 segundos y 13293 Puntos [20:37] Caracol}Elocuente
2 Pista: jup**** ******* * ***** 30 segundos y 13293 Puntos
[20:38] Caracol}Elocuente 3 Pista: jupi*e* *a*u**o * u*a*o 15 segundos y 13293 Puntos [20:38] Caracol}Elocuente
3 Pista: jupi*e* *a*u**o * u*a*o 15 segundos y 13293 Puntos
[20:38] Caracol}Elocuente Tiempo! La respuesta es -> jupiter�aturno��rano <- [20:38] Caracol}Elocuente
Tiempo! La respuesta es -> jupiter�aturno��rano <-
[20:38] Caracol}Elocuente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [20:38] Caracol}Elocuente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[20:38] Caracol}Elocuente Tri.4752 Geografiaɓebosin˿GentilicioldewCalahorrax?l [20:38] Caracol}Elocuente
Tri.4752 Geografiaɓebosin˿GentilicioldewCalahorrax?l
[20:38] Caracol}Elocuente 1 Pista: ************* Valor pregunta : 20568 Puntos [20:38] Caracol}Elocuente
1 Pista: ************* Valor pregunta : 20568 Puntos
[20:38] Caracol}Elocuente 2 Pista: cal********** 30 segundos y 20568 Puntos [20:38] Caracol}Elocuente
2 Pista: cal********** 30 segundos y 20568 Puntos
[20:39] Caracol}Elocuente 3 Pista: cala*u**i*a*o 15 segundos y 20568 Puntos [20:39] Caracol}Elocuente
3 Pista: cala*u**i*a*o 15 segundos y 20568 Puntos
[20:39] Caracol}Elocuente Tiempo! La respuesta es -> calagurritano <- [20:39] Caracol}Elocuente
Tiempo! La respuesta es -> calagurritano <-
[20:39] Caracol}Elocuente R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1181538 #5: siva- 692906 #6: Ketzy 610145 #7: Caiman_Enorme 603526 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481 [20:39] Caracol}Elocuente
R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1181538 #5: siva- 692906 #6: Ketzy 610145 #7: Caiman_Enorme 603526 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481
[20:39] Caracol}Elocuente Tri.19049 GeografiaɍARdeJAVAˍATAMOROSeESeUNAeCIUDADeFRONTERIZAeMEXICANAeAeORILLASeDELeR͏eGRANDEeQUEeENeLOSeڌTIMOSeAяSeHAeEXPERIMENTADOeUNeCRECIMIENTOeINUSITADOeGRACIASeAeLAeIMPLANTACIӎeDEeLASeCɌEBRESeYeCONTROVERTIDASe"MAQUILADORAS".e߅NeQUɃ01eESTADOeMEXICANOeSE [20:39] Caracol}Elocuente
Tri.19049 GeografiaɍARdeJAVAˍATAMOROSeESeUNAeCIUDADeFRONTERIZAeMEXICANAeAeORILLASeDELeR͏eGRANDEeQUEeENeLOSeڌTIMOSeAяSeHAeEXPERIMENTADOeUNeCRECIMIENTOeINUSITADOeGRACIASeAeLAeIMPLANTACIӎeDEeLASeCɌEBRESeYeCONTROVERTIDASe"MAQUILADORAS".e߅NeQUɃ01eESTADOeMEXICANOeSE
[20:39] Caracol}Elocuente 1 Pista: ********** Valor pregunta : 15787 Puntos [20:39] Caracol}Elocuente
1 Pista: ********** Valor pregunta : 15787 Puntos
[20:39] Caracol}Elocuente 2 Pista: tam******* 30 segundos y 15787 Puntos [20:39] Caracol}Elocuente
2 Pista: tam******* 30 segundos y 15787 Puntos
[20:39] Caracol}Elocuente 3 Pista: tamau*i*a* 15 segundos y 15787 Puntos [20:39] Caracol}Elocuente
3 Pista: tamau*i*a* 15 segundos y 15787 Puntos
[20:40] Caracol}Elocuente Tiempo! La respuesta es -> tamaulipas <- [20:40] Caracol}Elocuente
Tiempo! La respuesta es -> tamaulipas <-
[20:40] Caracol}Elocuente We feature over 50,000 Q&A ! [20:40] Caracol}Elocuente
We feature over 50,000 Q&A !
[20:40] Caracol}Elocuente Tri.19385 MitologiaɆrigotora˿Envlanmitologiann󲤩canasambleandondewsewresuelvenvlosnlitigiosnyksewfijanvlasnreglasndewlasnguerras?f?f [20:40] Caracol}Elocuente
Tri.19385 MitologiaɆrigotora˿Envlanmitologiann󲤩canasambleandondewsewresuelvenvlosnlitigiosnyksewfijanvlasnreglasndewlasnguerras?f?f
[20:40] Caracol}Elocuente 1 Pista: ***** Valor pregunta : 15426 Puntos [20:40] Caracol}Elocuente
1 Pista: ***** Valor pregunta : 15426 Puntos
[20:40] Caracol}Elocuente 2 Pista: thi** 30 segundos y 15426 Puntos [20:40] Caracol}Elocuente
2 Pista: thi** 30 segundos y 15426 Puntos
[20:40] Caracol}Elocuente �Absolutamente correcto Jirafa\Letal!! Acertaste "thing" en �1.125 segundos y ganas �5426�12 puntos [20:40] Caracol}Elocuente
�Absolutamente correcto Jirafa\Letal!! Acertaste "thing" en �1.125 segundos y ganas �5426�12 puntos
[20:40] Caracol}Elocuente ACTION awards Jirafa\Letal with a +v for having over 15000 points [20:40] Caracol}Elocuente
ACTION awards Jirafa\Letal with a +v for having over 15000 points
[20:40] Caracol}Elocuente Jirafa\Letal has acertado 1 seguidas!! Puntos HOY: 943213, SEMANA: 1196964 y MES: 2315091 [20:40] Caracol}Elocuente
Jirafa\Letal has acertado 1 seguidas!! Puntos HOY: 943213, SEMANA: 1196964 y MES: 2315091
[20:40] Jirafa\Letal thing [20:40] Jirafa\Letal
thing
[20:40] Caracol}Elocuente R᮫ing de HOY: - #1: Jirafa\Letal 943213 #2: Gladiadora_del_Caribe 686734 #3: Grillo{Naranja 616922 #4: Caiman_Enorme 603526 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: Ketzy 38872 #9: Grillo-Locuaz 23731 #10: * 0 [20:40] Caracol}Elocuente
R᮫ing de HOY: - #1: Jirafa\Letal 943213 #2: Gladiadora_del_Caribe 686734 #3: Grillo{Naranja 616922 #4: Caiman_Enorme 603526 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: Ketzy 38872 #9: Grillo-Locuaz 23731 #10: * 0
[20:40] Caracol}Elocuente Tri.8313 Biologiaɪcrazy_Sp˿DarwingescribiovCuadernospsobreelaltransmutaciongdeelaspespecies,qperovdespuespdeelallecturaldeequeelibrovdeloeconomistalbritanicovThomaspRobertpMalthusp?q [20:40] Caracol}Elocuente
Tri.8313 Biologiaɪcrazy_Sp˿DarwingescribiovCuadernospsobreelaltransmutaciongdeelaspespecies,qperovdespuespdeelallecturaldeequeelibrovdeloeconomistalbritanicovThomaspRobertpMalthusp?q
[20:40] Caracol}Elocuente 1 Pista: ****** ***** ** ********* ** ********* Valor pregunta : 9134 Puntos [20:40] Caracol}Elocuente
1 Pista: ****** ***** ** ********* ** ********* Valor pregunta : 9134 Puntos
[20:40] CaballitoDeMar-Respetable ¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [20:40] CaballitoDeMar-Respetable
¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[20:41] Caracol}Elocuente 2 Pista: ens*** ***** ** ********* ** ********* 30 segundos y 9134 Puntos [20:41] Caracol}Elocuente
2 Pista: ens*** ***** ** ********* ** ********* 30 segundos y 9134 Puntos
[20:41] Caracol}Elocuente 3 Pista: ensa*o *o**e e* **i**i*io *e *o**a*io* 15 segundos y 9134 Puntos [20:41] Caracol}Elocuente
3 Pista: ensa*o *o**e e* **i**i*io *e *o**a*io* 15 segundos y 9134 Puntos
[20:41] Caracol}Elocuente Tiempo! La respuesta es -> ensayo�obre�l�rincipio�e�oblacion <- [20:41] Caracol}Elocuente
Tiempo! La respuesta es -> ensayo�obre�l�rincipio�e�oblacion <-
[20:41] Caracol}Elocuente Tri.17552 Geografiaɂatval˿AVIACION-NOMBREbDELbAEROPUERTObDEbPLYMOUTHb?b [20:41] Caracol}Elocuente
Tri.17552 Geografiaɂatval˿AVIACION-NOMBREbDELbAEROPUERTObDEbPLYMOUTHb?b
[20:41] Caracol}Elocuente 1 Pista: ********* Valor pregunta : 12795 Puntos [20:41] Caracol}Elocuente
1 Pista: ********* Valor pregunta : 12795 Puntos
[20:42] Caracol}Elocuente 2 Pista: rob****** 30 segundos y 12795 Puntos [20:42] Caracol}Elocuente
2 Pista: rob****** 30 segundos y 12795 Puntos
[20:42] Caracol}Elocuente 3 Pista: robo*ou** 15 segundos y 12795 Puntos [20:42] Caracol}Elocuente
3 Pista: robo*ou** 15 segundos y 12795 Puntos
[20:42] Caracol}Elocuente Tiempo! La respuesta es -> roborough <- [20:42] Caracol}Elocuente
Tiempo! La respuesta es -> roborough <-
[20:42] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [20:42] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[20:42] Caracol}Elocuente Tri.8713 MiscelaneaɔeLaRaNhA˿Alemalesegadorplaopaja...d?d [20:42] Caracol}Elocuente
Tri.8713 MiscelaneaɔeLaRaNhA˿Alemalesegadorplaopaja...d?d
[20:42] Caracol}Elocuente 1 Pista: ******* Valor pregunta : 22763 Puntos [20:42] Caracol}Elocuente
1 Pista: ******* Valor pregunta : 22763 Puntos
[20:42] Caracol}Elocuente 2 Pista: est**** 30 segundos y 22763 Puntos [20:42] Caracol}Elocuente
2 Pista: est**** 30 segundos y 22763 Puntos
[20:43] Caracol}Elocuente 3 Pista: esto**a 15 segundos y 22763 Puntos [20:43] Caracol}Elocuente
3 Pista: esto**a 15 segundos y 22763 Puntos
[20:43] Caracol}Elocuente Tiempo! La respuesta es -> estorba <- [20:43] Caracol}Elocuente
Tiempo! La respuesta es -> estorba <-
[20:43] Caracol}Elocuente R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414 [20:43] Caracol}Elocuente
R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414
[20:43] Caracol}Elocuente Tri.12316 LiteraturaɁntiquo˿CUALhFUEhLAhPRIMERAhNOVELAhDEhDELIBES,hGANADORAhDELhPREMIOhNADALh?h [20:43] Caracol}Elocuente
Tri.12316 LiteraturaɁntiquo˿CUALhFUEhLAhPRIMERAhNOVELAhDEhDELIBES,hGANADORAhDELhPREMIOhNADALh?h
[20:43] Caracol}Elocuente 1 Pista: ** ****** *** ****** ** ******** Valor pregunta : 24089 Puntos [20:43] Caracol}Elocuente
1 Pista: ** ****** *** ****** ** ******** Valor pregunta : 24089 Puntos
[20:43] Caracol}Elocuente 2 Pista: la�***** *** ****** ** ******** 30 segundos y 24089 Puntos [20:43] Caracol}Elocuente
2 Pista: la�***** *** ****** ** ******** 30 segundos y 24089 Puntos
[20:44] Caracol}Elocuente 3 Pista: la�o***a *e* *i**e* e* a*a**a*a 15 segundos y 24089 Puntos [20:44] Caracol}Elocuente
3 Pista: la�o***a *e* *i**e* e* a*a**a*a 15 segundos y 24089 Puntos
[20:44] Caracol}Elocuente Tiempo! La respuesta es -> la�ombra�el�ipres�s�largada <- [20:44] Caracol}Elocuente
Tiempo! La respuesta es -> la�ombra�el�ipres�s�largada <-
[20:44] Caracol}Elocuente If you think a Q&A is wrong, please call an OP [20:44] Caracol}Elocuente
If you think a Q&A is wrong, please call an OP
[20:44] Caracol}Elocuente Tri.9326 LiteraturaɍARdeJAVAˑUɃ01eAUTORe(1580-1645)eESCRIBIӃ01e"ePROVIDENCIAeDEeDIOS".e(ASCɔICA)e?e [20:44] Caracol}Elocuente
Tri.9326 LiteraturaɍARdeJAVAˑUɃ01eAUTORe(1580-1645)eESCRIBIӃ01e"ePROVIDENCIAeDEeDIOS".e(ASCɔICA)e?e
[20:44] Caracol}Elocuente 1 Pista: ********* ** ******* Valor pregunta : 10979 Puntos [20:44] Caracol}Elocuente
1 Pista: ********* ** ******* Valor pregunta : 10979 Puntos
[20:44] Caracol}Elocuente 2 Pista: fra****** ** ******* 30 segundos y 10979 Puntos [20:44] Caracol}Elocuente
2 Pista: fra****** ** ******* 30 segundos y 10979 Puntos
[20:45] Caracol}Elocuente 3 Pista: fra**i**o *e *ue*e*o 15 segundos y 10979 Puntos [20:45] Caracol}Elocuente
3 Pista: fra**i**o *e *ue*e*o 15 segundos y 10979 Puntos
[20:45] Caracol}Elocuente Tiempo! La respuesta es -> francisco�e�uevedo <- [20:45] Caracol}Elocuente
Tiempo! La respuesta es -> francisco�e�uevedo <-
[20:45] Caracol}Elocuente R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087 [20:45] Caracol}Elocuente
R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087
[20:45] Caracol}Elocuente Tri.6747 Musicaɬusie˗hitesnakezߣomponente?x?x [20:45] Caracol}Elocuente
Tri.6747 Musicaɬusie˗hitesnakezߣomponente?x?x
[20:45] Caracol}Elocuente 1 Pista: ***** ********* Valor pregunta : 5323 Puntos [20:45] Caracol}Elocuente
1 Pista: ***** ********* Valor pregunta : 5323 Puntos
[20:45] Caracol}Elocuente 2 Pista: dav** ********* 30 segundos y 5323 Puntos [20:45] Caracol}Elocuente
2 Pista: dav** ********* 30 segundos y 5323 Puntos
[20:45] Caracol}Elocuente 3 Pista: davi* *o*e**a*e 15 segundos y 5323 Puntos [20:45] Caracol}Elocuente
3 Pista: davi* *o*e**a*e 15 segundos y 5323 Puntos
[20:46] Caracol}Elocuente Tiempo! La respuesta es -> david�overdale <- [20:46] Caracol}Elocuente
Tiempo! La respuesta es -> david�overdale <-
[20:46] Caracol}Elocuente For The Competitive Edge type !pingme [20:46] Caracol}Elocuente
For The Competitive Edge type !pingme
[20:46] Caracol}Elocuente Tri.5175 Cineɡnghara˿Cuᬃ01xesklarpelidm᳃01kconocidardenMichaelxCurtizl?l [20:46] Caracol}Elocuente
Tri.5175 Cineɡnghara˿Cuᬃ01xesklarpelidm᳃01kconocidardenMichaelxCurtizl?l
[20:46] Caracol}Elocuente 1 Pista: ********** Valor pregunta : 23728 Puntos [20:46] Caracol}Elocuente
1 Pista: ********** Valor pregunta : 23728 Puntos
[20:46] Caracol}Elocuente 2 Pista: cas******* 30 segundos y 23728 Puntos [20:46] Caracol}Elocuente
2 Pista: cas******* 30 segundos y 23728 Puntos
[20:46] Caracol}Elocuente 3 Pista: casa**a**a 15 segundos y 23728 Puntos [20:46] Caracol}Elocuente
3 Pista: casa**a**a 15 segundos y 23728 Puntos
[20:47] Caracol}Elocuente Tiempo! La respuesta es -> casablanca <- [20:47] Caracol}Elocuente
Tiempo! La respuesta es -> casablanca <-
[20:47] Caracol}Elocuente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [20:47] Caracol}Elocuente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[20:47] Caracol}Elocuente Tri.9749 Arteɓibila˿ENfQUegCIUDADfEST�01fELfTAPIZfMEDIEVALfDEf"LAfCREACION"f?f [20:47] Caracol}Elocuente
Tri.9749 Arteɓibila˿ENfQUegCIUDADfEST�01fELfTAPIZfMEDIEVALfDEf"LAfCREACION"f?f
[20:47] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 18857 Puntos [20:47] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 18857 Puntos
[20:47] Caracol}Elocuente 2 Pista: ger*** 30 segundos y 18857 Puntos [20:47] Caracol}Elocuente
2 Pista: ger*** 30 segundos y 18857 Puntos
[20:47] Caracol}Elocuente 3 Pista: gero*a 15 segundos y 18857 Puntos [20:47] Caracol}Elocuente
3 Pista: gero*a 15 segundos y 18857 Puntos
[20:48] Caracol}Elocuente Tiempo! La respuesta es -> gerona <- [20:48] Caracol}Elocuente
Tiempo! La respuesta es -> gerona <-
[20:48] Caracol}Elocuente R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2315091 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 603526 [20:48] Caracol}Elocuente
R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2315091 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 603526
[20:48] Caracol}Elocuente Tri.8179 InformaticaɈdosO˿ENtQUɃ01tSEtDIFERENCIANtUNtORDENADORtPENTIUMtYtUNtAMDt?t [20:48] Caracol}Elocuente
Tri.8179 InformaticaɈdosO˿ENtQUɃ01tSEtDIFERENCIANtUNtORDENADORtPENTIUMtYtUNtAMDt?t
[20:48] Caracol}Elocuente 1 Pista: ** ** *************** Valor pregunta : 22680 Puntos [20:48] Caracol}Elocuente
1 Pista: ** ** *************** Valor pregunta : 22680 Puntos
[20:48] Caracol}Elocuente 2 Pista: en�* *************** 30 segundos y 22680 Puntos [20:48] Caracol}Elocuente
2 Pista: en�* *************** 30 segundos y 22680 Puntos
[20:48] Caracol}Elocuente 3 Pista: en�* *i**o**o*e*a*o* 15 segundos y 22680 Puntos [20:48] Caracol}Elocuente
3 Pista: en�* *i**o**o*e*a*o* 15 segundos y 22680 Puntos
[20:49] Caracol}Elocuente Tiempo! La respuesta es -> en�l�icroprocesador <- [20:49] Caracol}Elocuente
Tiempo! La respuesta es -> en�l�icroprocesador <-
[20:49] Caracol}Elocuente Please refrain from using Extreme Bad Language [20:49] Caracol}Elocuente
Please refrain from using Extreme Bad Language
[20:49] Caracol}Elocuente Tri.17867 BiologiaɍarcaAcme˿Dexquexgustossonxlasrlagrimas?t?t [20:49] Caracol}Elocuente
Tri.17867 BiologiaɍarcaAcme˿Dexquexgustossonxlasrlagrimas?t?t
[20:49] Caracol}Elocuente 1 Pista: ******* Valor pregunta : 5842 Puntos [20:49] Caracol}Elocuente
1 Pista: ******* Valor pregunta : 5842 Puntos
[20:49] Caracol}Elocuente 2 Pista: sal**** 30 segundos y 5842 Puntos [20:49] Caracol}Elocuente
2 Pista: sal**** 30 segundos y 5842 Puntos
[20:49] Caracol}Elocuente 3 Pista: sala*a* 15 segundos y 5842 Puntos [20:49] Caracol}Elocuente
3 Pista: sala*a* 15 segundos y 5842 Puntos
[20:49] Caracol}Elocuente Tiempo! La respuesta es -> saladas <- [20:49] Caracol}Elocuente
Tiempo! La respuesta es -> saladas <-
[20:50] Caracol}Elocuente This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente [20:50] Caracol}Elocuente
This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente
[20:50] Caracol}Elocuente Tri.3524 EconomiaɍarcaAcme˿ComofsewllamabaslasmonedasArgentinasenlepocasdewRa�luAlfonsinl?z?z [20:50] Caracol}Elocuente
Tri.3524 EconomiaɍarcaAcme˿ComofsewllamabaslasmonedasArgentinasenlepocasdewRa�luAlfonsinl?z?z
[20:50] Caracol}Elocuente 1 Pista: ******* Valor pregunta : 12557 Puntos [20:50] Caracol}Elocuente
1 Pista: ******* Valor pregunta : 12557 Puntos
[20:50] Caiman_Enorme cordoba [20:50] Caiman_Enorme
cordoba
[20:50] Caiman_Enorme no [20:50] Caiman_Enorme
no
[20:50] Caracol}Elocuente 2 Pista: aus**** 30 segundos y 12557 Puntos [20:50] Caracol}Elocuente
2 Pista: aus**** 30 segundos y 12557 Puntos
[20:50] Caiman_Enorme austria [20:50] Caiman_Enorme
austria
[20:50] Caiman_Enorme austria [20:50] Caiman_Enorme
austria
[20:50] Elefante-Suave australia [20:50] Elefante-Suave
australia
[20:50] Caracol}Elocuente 3 Pista: aus**a* 15 segundos y 12557 Puntos [20:50] Caracol}Elocuente
3 Pista: aus**a* 15 segundos y 12557 Puntos
[20:50] Elefante-Suave nada [20:50] Elefante-Suave
nada
[20:50] Caiman_Enorme jajja [20:50] Caiman_Enorme
jajja
[20:50] Caiman_Enorme austral [20:50] Caiman_Enorme
austral
[20:50] Caracol}Elocuente �Ol頃04Caiman_Enorme!! Has contestado: "austral" en �7.688 segundos y sumas �2557�12 puntos a tu marcador. �Sigue as� [20:50] Caracol}Elocuente
�Ol頃04Caiman_Enorme!! Has contestado: "austral" en �7.688 segundos y sumas �2557�12 puntos a tu marcador. �Sigue as�
[20:50] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:50] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:50] Caracol}Elocuente Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 616083, SEMANA: 616083 y MES: 616083 [20:50] Caracol}Elocuente
Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 616083, SEMANA: 616083 y MES: 616083
[20:50] Caiman_Enorme siiiiiiiiiiii [20:50] Caiman_Enorme
siiiiiiiiiiii
[20:50] Elefante-Suave no sale nada [20:50] Elefante-Suave
no sale nada
[20:50] Caracol}Elocuente This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: Grillo-Locuaz 23731 #14: LeCaTwaLk_z 19830 #15: FANTASMAMEXICO 5048 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [20:50] Caracol}Elocuente
This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: Grillo-Locuaz 23731 #14: LeCaTwaLk_z 19830 #15: FANTASMAMEXICO 5048 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[20:50] Caracol}Elocuente Tri.3194 Cotilleo-TVɨupper˿DEeQUIENeHACEeKEVINeSMITHeENeXENAeLAePRINCESAeGUERRERA?e?e [20:50] Caracol}Elocuente
Tri.3194 Cotilleo-TVɨupper˿DEeQUIENeHACEeKEVINeSMITHeENeXENAeLAePRINCESAeGUERRERA?e?e
[20:50] Caracol}Elocuente 1 Pista: **** Pregunta de BONUS : 25000 Puntos [20:50] Caracol}Elocuente
1 Pista: **** Pregunta de BONUS : 25000 Puntos
[20:50] Elefante-Suave si por fin [20:50] Elefante-Suave
si por fin
[20:51] Caiman_Enorme ni idea [20:51] Caiman_Enorme
ni idea
[20:51] Caracol}Elocuente 2 Pista: are* 30 segundos y 25000 Puntos [20:51] Caracol}Elocuente
2 Pista: are* 30 segundos y 25000 Puntos
[20:51] Caiman_Enorme aren [20:51] Caiman_Enorme
aren
[20:51] Caiman_Enorme ares [20:51] Caiman_Enorme
ares
[20:51] Caracol}Elocuente �Suma y sigue Caiman_Enorme!! La respuesta: "ares" incrementa tu marcador en �5000�12 puntos [20:51] Caracol}Elocuente
�Suma y sigue Caiman_Enorme!! La respuesta: "ares" incrementa tu marcador en �5000�12 puntos
[20:51] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:51] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:51] Caracol}Elocuente Caiman_Enorme has acertado 2 seguidas!! Puntos HOY: 641083, SEMANA: 641083 y MES: 641083 [20:51] Caracol}Elocuente
Caiman_Enorme has acertado 2 seguidas!! Puntos HOY: 641083, SEMANA: 641083 y MES: 641083
[20:51] Elefante-Suave yo menos xD [20:51] Elefante-Suave
yo menos xD
[20:51] Caiman_Enorme arer [20:51] Caiman_Enorme
arer
[20:51] Caiman_Enorme arel [20:51] Caiman_Enorme
arel
[20:51] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [20:51] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[20:51] Caracol}Elocuente Tri.4833 BiologiaɞYanira^˿Durantedquedpreiodosaparecieronllosxprimerosxartropodos,tlosxtrilobitesx?t [20:51] Caracol}Elocuente
Tri.4833 BiologiaɞYanira^˿Durantedquedpreiodosaparecieronllosxprimerosxartropodos,tlosxtrilobitesx?t
[20:51] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 20799 Puntos [20:51] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 20799 Puntos
[20:51] Elefante-Suave primitivo [20:51] Elefante-Suave
primitivo
[20:51] Caracol}Elocuente 2 Pista: cam***** 30 segundos y 20799 Puntos [20:51] Caracol}Elocuente
2 Pista: cam***** 30 segundos y 20799 Puntos
[20:51] Elefante-Suave sepa [20:51] Elefante-Suave
sepa
[20:51] Caracol}Elocuente 3 Pista: cam**i*o 15 segundos y 20799 Puntos [20:51] Caracol}Elocuente
3 Pista: cam**i*o 15 segundos y 20799 Puntos
[20:51] Caiman_Enorme camprito [20:51] Caiman_Enorme
camprito
[20:52] Caiman_Enorme jaja [20:52] Caiman_Enorme
jaja
[20:52] Caiman_Enorme cambrito [20:52] Caiman_Enorme
cambrito
[20:52] Elefante-Suave hahahaha [20:52] Elefante-Suave
hahahaha
[20:52] Caracol}Elocuente Tiempo! La respuesta es -> cambrico <- [20:52] Caracol}Elocuente
Tiempo! La respuesta es -> cambrico <-
[20:52] Caiman_Enorme camprito [20:52] Caiman_Enorme
camprito
[20:52] Caiman_Enorme ah [20:52] Caiman_Enorme
ah
[20:52] Caiman_Enorme anda ahi [20:52] Caiman_Enorme
anda ahi
[20:52] Caracol}Elocuente This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: Rodolfo516 49625 [20:52] Caracol}Elocuente
This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: Rodolfo516 49625
[20:52] Caracol}Elocuente Tri.7260 InformaticaɌucky_LuK˿DISPOSITIVOeDEeALMACENAMIENTOeDEeACCESOeALEATORIOeQUEeGRABAeLOSeDATOSeENeFORMAeDEeSE񁌅SeMAGNETICASe?e [20:52] Caracol}Elocuente
Tri.7260 InformaticaɌucky_LuK˿DISPOSITIVOeDEeALMACENAMIENTOeDEeACCESOeALEATORIOeQUEeGRABAeLOSeDATOSeENeFORMAeDEeSE񁌅SeMAGNETICASe?e
[20:52] Caracol}Elocuente 1 Pista: ***** Valor pregunta : 19537 Puntos [20:52] Caracol}Elocuente
1 Pista: ***** Valor pregunta : 19537 Puntos
[20:52] Caracol}Elocuente 2 Pista: dis** 30 segundos y 19537 Puntos [20:52] Caracol}Elocuente
2 Pista: dis** 30 segundos y 19537 Puntos
[20:52] Caracol}Elocuente �Elefante-Suave acert󡡠La respuesta era: "disco" y contest󠥮 �0.391 segundos. Se lleva: �9537�12 puntos [20:52] Caracol}Elocuente
�Elefante-Suave acert󡡠La respuesta era: "disco" y contest󠥮 �0.391 segundos. Se lleva: �9537�12 puntos
[20:52] Caracol}Elocuente ACTION awards Elefante-Suave with a +v for having over 15000 points [20:52] Caracol}Elocuente
ACTION awards Elefante-Suave with a +v for having over 15000 points
[20:52] Caracol}Elocuente Elefante-Suave has acertado 1 seguidas!! Puntos HOY: 962750, SEMANA: 1216501 y MES: 2334628 [20:52] Caracol}Elocuente
Elefante-Suave has acertado 1 seguidas!! Puntos HOY: 962750, SEMANA: 1216501 y MES: 2334628
[20:52] Elefante-Suave disco [20:52] Elefante-Suave
disco
[20:52] Caiman_Enorme bn [20:52] Caiman_Enorme
bn
[20:52] Caracol}Elocuente R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206 [20:52] Caracol}Elocuente
R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206
[20:52] Caracol}Elocuente Tri.12285 Arteɖivian˿C󭯃01cseillamabadladcasaddondeiGoyadvivi󃰱qantesxdeisueexiliocadFranciadensladqueirealiz󃰱qsusxfamosasxPinturasxnegras?q?q [20:52] Caracol}Elocuente
Tri.12285 Arteɖivian˿C󭯃01cseillamabadladcasaddondeiGoyadvivi󃰱qantesxdeisueexiliocadFranciadensladqueirealiz󃰱qsusxfamosasxPinturasxnegras?q?q
[20:52] Caracol}Elocuente 1 Pista: ** ****** *** ***** Valor pregunta : 13925 Puntos [20:52] Caracol}Elocuente
1 Pista: ** ****** *** ***** Valor pregunta : 13925 Puntos
[20:52] Elefante-Suave gracias [20:52] Elefante-Suave
gracias
[20:53] Caracol}Elocuente 2 Pista: la�***** *** ***** 30 segundos y 13925 Puntos [20:53] Caracol}Elocuente
2 Pista: la�***** *** ***** 30 segundos y 13925 Puntos
[20:53] Caracol}Elocuente 3 Pista: la�ui**a *e* *o**o 15 segundos y 13925 Puntos [20:53] Caracol}Elocuente
3 Pista: la�ui**a *e* *o**o 15 segundos y 13925 Puntos
[20:53] Caracol}Elocuente Tiempo! La respuesta es -> la�uinta�el�ordo <- [20:53] Caracol}Elocuente
Tiempo! La respuesta es -> la�uinta�el�ordo <-
[20:53] Caracol}Elocuente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [20:53] Caracol}Elocuente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[20:53] Caracol}Elocuente Tri.5335 Eros-SexɁrzobispo˿Comoaseillamananlanpromesanqueihacentlosireligiososideinoatenerjrelacionesisexuales?e?e [20:53] Caracol}Elocuente
Tri.5335 Eros-SexɁrzobispo˿Comoaseillamananlanpromesanqueihacentlosireligiososideinoatenerjrelacionesisexuales?e?e
[20:53] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 24300 Puntos [20:53] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 24300 Puntos
[20:53] Caracol}Elocuente 2 Pista: cel***** 30 segundos y 24300 Puntos [20:53] Caracol}Elocuente
2 Pista: cel***** 30 segundos y 24300 Puntos
[20:54] Caracol}Elocuente 3 Pista: celi*a*o 15 segundos y 24300 Puntos [20:54] Caracol}Elocuente
3 Pista: celi*a*o 15 segundos y 24300 Puntos
[20:54] Caiman_Enorme celicato [20:54] Caiman_Enorme
celicato
[20:54] Caiman_Enorme celigato [20:54] Caiman_Enorme
celigato
[20:54] Caracol}Elocuente Tiempo! La respuesta es -> celibato <- [20:54] Caracol}Elocuente
Tiempo! La respuesta es -> celibato <-
[20:54] Caiman_Enorme esa [20:54] Caiman_Enorme
esa
[20:54] LeonBrillante nada [20:54] LeonBrillante
nada
[20:54] Caracol}Elocuente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [20:54] Caracol}Elocuente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[20:54] Caracol}Elocuente Tri.17055 Fisica-Quimicaɘove˿DekDondekprovieneklasRfdekLASERf?f [20:54] Caracol}Elocuente
Tri.17055 Fisica-Quimicaɘove˿DekDondekprovieneklasRfdekLASERf?f
[20:54] Caracol}Elocuente 1 Pista: ********* Pregunta de BONUS : 25000 Puntos [20:54] Caracol}Elocuente
1 Pista: ********* Pregunta de BONUS : 25000 Puntos
[20:54] Caiman_Enorme por ahi era [20:54] Caiman_Enorme
por ahi era
[20:54] LeonBrillante si era [20:54] LeonBrillante
si era
[20:54] Caiman_Enorme celibato [20:54] Caiman_Enorme
celibato
[20:54] LeonBrillante aja [20:54] LeonBrillante
aja
[20:54] Caracol}Elocuente 2 Pista: rad****** 30 segundos y 25000 Puntos [20:54] Caracol}Elocuente
2 Pista: rad****** 30 segundos y 25000 Puntos
[20:55] LeonBrillante radacion [20:55] LeonBrillante
radacion
[20:55] Caiman_Enorme randical [20:55] Caiman_Enorme
randical
[20:55] Caracol}Elocuente 3 Pista: radia*io* 15 segundos y 25000 Puntos [20:55] Caracol}Elocuente
3 Pista: radia*io* 15 segundos y 25000 Puntos
[20:55] Caiman_Enorme radiacion [20:55] Caiman_Enorme
radiacion
[20:55] LeonBrillante mas or menos [20:55] LeonBrillante
mas or menos
[20:55] Caiman_Enorme radiasion [20:55] Caiman_Enorme
radiasion
[20:55] LeonBrillante radiation [20:55] LeonBrillante
radiation
[20:55] Caracol}Elocuente �Increible!! LeonBrillante contest󺠃04"radiation" en �4.953 segundos, y ha ganado �5000�12 puntos [20:55] Caracol}Elocuente
�Increible!! LeonBrillante contest󺠃04"radiation" en �4.953 segundos, y ha ganado �5000�12 puntos
[20:55] Caracol}Elocuente ACTION awards LeonBrillante with a +v for having over 15000 points [20:55] Caracol}Elocuente
ACTION awards LeonBrillante with a +v for having over 15000 points
[20:55] Caracol}Elocuente LeonBrillante has acertado 1 seguidas!! Puntos HOY: 25000, SEMANA: 25000 y MES: 25000 [20:55] Caracol}Elocuente
LeonBrillante has acertado 1 seguidas!! Puntos HOY: 25000, SEMANA: 25000 y MES: 25000
[20:55] Caiman_Enorme radiacion [20:55] Caiman_Enorme
radiacion
[20:55] LeonBrillante era en ingles [20:55] LeonBrillante
era en ingles
[20:55] Caiman_Enorme inglish [20:55] Caiman_Enorme
inglish
[20:55] Caracol}Elocuente R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1216501 #5: siva- 692906 #6: Caiman_Enorme 641083 #7: Ketzy 610145 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481 [20:55] Caracol}Elocuente
R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1216501 #5: siva- 692906 #6: Caiman_Enorme 641083 #7: Ketzy 610145 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481
[20:55] Caracol}Elocuente Tri.19885 Biologiaɋyla˿Indicarfelynombrewdewunygrupor(clase)xdewPlatelmintos,xcuYosfrepresentantesfnorpresentanyorganosfdewfijacionyenyelyestadoradultor?x [20:55] Caracol}Elocuente
Tri.19885 Biologiaɋyla˿Indicarfelynombrewdewunygrupor(clase)xdewPlatelmintos,xcuYosfrepresentantesfnorpresentanyorganosfdewfijacionyenyelyestadoradultor?x
[20:55] Caracol}Elocuente 1 Pista: *********** Valor pregunta : 23946 Puntos [20:55] Caracol}Elocuente
1 Pista: *********** Valor pregunta : 23946 Puntos
[20:55] LeonBrillante la respuesta [20:55] LeonBrillante
la respuesta
[20:55] Caracol}Elocuente 2 Pista: tur******** 30 segundos y 23946 Puntos [20:55] Caracol}Elocuente
2 Pista: tur******** 30 segundos y 23946 Puntos
[20:55] CaballitoDeMar-Respetable ¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [20:55] CaballitoDeMar-Respetable
¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[20:56] Caracol}Elocuente 3 Pista: tur*e*a*io* 15 segundos y 23946 Puntos [20:56] Caracol}Elocuente
3 Pista: tur*e*a*io* 15 segundos y 23946 Puntos
[20:56] Caracol}Elocuente Tiempo! La respuesta es -> turbelarios <- [20:56] Caracol}Elocuente
Tiempo! La respuesta es -> turbelarios <-
[20:56] Caiman_Enorme quieor ser operadora aqui [20:56] Caiman_Enorme
quieor ser operadora aqui
[20:56] Caiman_Enorme quiero* [20:56] Caiman_Enorme
quiero*
[20:56] Caracol}Elocuente We feature over 50,000 Q&A ! [20:56] Caracol}Elocuente
We feature over 50,000 Q&A !
[20:56] Caracol}Elocuente Tri.2649 Medicina-Saludɚytox˿Cavidadqdeblasbmandibulasbdondebsebinsertaxelpdienteb?k [20:56] Caracol}Elocuente
Tri.2649 Medicina-Saludɚytox˿Cavidadqdeblasbmandibulasbdondebsebinsertaxelpdienteb?k
[20:56] Caracol}Elocuente 1 Pista: ******* Valor pregunta : 12243 Puntos [20:56] Caracol}Elocuente
1 Pista: ******* Valor pregunta : 12243 Puntos
[20:56] Caracol}Elocuente 2 Pista: alv**** 30 segundos y 12243 Puntos [20:56] Caracol}Elocuente
2 Pista: alv**** 30 segundos y 12243 Puntos
[20:56] LeonBrillante missmaxis un tema para pedir a la radio de reggaeton [20:56] LeonBrillante
missmaxis un tema para pedir a la radio de reggaeton
[20:56] LeonBrillante \yo no mas lo pongo [20:56] LeonBrillante
\yo no mas lo pongo
[20:57] Caracol}Elocuente 3 Pista: alveo*o 15 segundos y 12243 Puntos [20:57] Caracol}Elocuente
3 Pista: alveo*o 15 segundos y 12243 Puntos
[20:57] Caiman_Enorme suben ami [20:57] Caiman_Enorme
suben ami
[20:57] LeonBrillante subrn ami [20:57] LeonBrillante
subrn ami
[20:57] Caracol}Elocuente Tiempo! La respuesta es -> alveolo <- [20:57] Caracol}Elocuente
Tiempo! La respuesta es -> alveolo <-
[20:57] LeonBrillante asi es [20:57] LeonBrillante
asi es
[20:57] Caiman_Enorme como op. [20:57] Caiman_Enorme
como op.
[20:57] Caracol}Elocuente R᮫ing de HOY: - #1: Jirafa\Letal 962750 #2: Gladiadora_del_Caribe 686734 #3: Caiman_Enorme 641083 #4: Grillo{Naranja 616922 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: Ketzy 38872 #9: LeonBrillante 25000 #10: Grillo-Locuaz 23731 [20:57] Caracol}Elocuente
R᮫ing de HOY: - #1: Jirafa\Letal 962750 #2: Gladiadora_del_Caribe 686734 #3: Caiman_Enorme 641083 #4: Grillo{Naranja 616922 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: Ketzy 38872 #9: LeonBrillante 25000 #10: Grillo-Locuaz 23731
[20:57] Caracol}Elocuente Tri.6119 Idiomasɓebosin˿Diccionario-Qu郰1ipalabraxquierevdecirn"simultaneidadadevhechos"?i?i [20:57] Caracol}Elocuente
Tri.6119 Idiomasɓebosin˿Diccionario-Qu郰1ipalabraxquierevdecirn"simultaneidadadevhechos"?i?i
[20:57] Caracol}Elocuente 1 Pista: ************* Valor pregunta : 14653 Puntos [20:57] Caracol}Elocuente
1 Pista: ************* Valor pregunta : 14653 Puntos
[20:57] Caracol}Elocuente 2 Pista: con********** 30 segundos y 14653 Puntos [20:57] Caracol}Elocuente
2 Pista: con********** 30 segundos y 14653 Puntos
[20:57] Caracol}Elocuente 3 Pista: con*o*i*a**ia 15 segundos y 14653 Puntos [20:57] Caracol}Elocuente
3 Pista: con*o*i*a**ia 15 segundos y 14653 Puntos
[20:58] LeonBrillante tienes que entrar a la sala [20:58] LeonBrillante
tienes que entrar a la sala
[20:58] Caracol}Elocuente Tiempo! La respuesta es -> concomitancia <- [20:58] Caracol}Elocuente
Tiempo! La respuesta es -> concomitancia <-
[20:58] Caracol}Elocuente Tri.1777 Informaticaɴjmm.com˃ient�covque,mporcencargovdelhCERN,minvent󃰱mlajWorldaWidehWebw(WWW)menhInterneth(1989),malabadovsea.m?m [20:58] Caracol}Elocuente
Tri.1777 Informaticaɴjmm.com˃ient�covque,mporcencargovdelhCERN,minvent󃰱mlajWorldaWidehWebw(WWW)menhInterneth(1989),malabadovsea.m?m
[20:58] Caracol}Elocuente 1 Pista: ******* *******-*** Valor pregunta : 24527 Puntos [20:58] Caracol}Elocuente
1 Pista: ******* *******-*** Valor pregunta : 24527 Puntos
[20:58] Caracol}Elocuente 2 Pista: Tim**** *******-*** 30 segundos y 24527 Puntos [20:58] Caracol}Elocuente
2 Pista: Tim**** *******-*** 30 segundos y 24527 Puntos
[20:58] Caracol}Elocuente 3 Pista: Timo*** *e**e**-*ee 15 segundos y 24527 Puntos [20:58] Caracol}Elocuente
3 Pista: Timo*** *e**e**-*ee 15 segundos y 24527 Puntos
[20:59] Caracol}Elocuente Tiempo! La respuesta es -> Timothy�erners-Lee <- [20:59] Caracol}Elocuente
Tiempo! La respuesta es -> Timothy�erners-Lee <-
[20:59] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [20:59] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[20:59] Caracol}Elocuente Tri.5721 BiologiaɃyBeRLoKa˿C󭯃01hsezllamafeliorg᮵lohm󶩬iconeunafestructuraftubulart"9+2"?q?q [20:59] Caracol}Elocuente
Tri.5721 BiologiaɃyBeRLoKa˿C󭯃01hsezllamafeliorg᮵lohm󶩬iconeunafestructuraftubulart"9+2"?q?q
[20:59] Caracol}Elocuente 1 Pista: ***** Valor pregunta : 23140 Puntos [20:59] Caracol}Elocuente
1 Pista: ***** Valor pregunta : 23140 Puntos
[20:59] Elefante-Suave ya regrese esta limpiado la oficina [20:59] Elefante-Suave
ya regrese esta limpiado la oficina
[20:59] Caracol}Elocuente 2 Pista: cil** 30 segundos y 23140 Puntos [20:59] Caracol}Elocuente
2 Pista: cil** 30 segundos y 23140 Puntos
[20:59] Caracol}Elocuente 3 Pista: cilio 15 segundos y 23140 Puntos [20:59] Caracol}Elocuente
3 Pista: cilio 15 segundos y 23140 Puntos
[20:59] Caiman_Enorme cilio [20:59] Caiman_Enorme
cilio
[20:59] Caracol}Elocuente �Muy bien Caiman_Enorme!! Acertaste "cilio" en tan s󬯠�4.047 segundos y por eso has ganado: �3140�12 puntos [20:59] Caracol}Elocuente
�Muy bien Caiman_Enorme!! Acertaste "cilio" en tan s󬯠�4.047 segundos y por eso has ganado: �3140�12 puntos
[20:59] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [20:59] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[20:59] Caracol}Elocuente Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 664223, SEMANA: 664223 y MES: 664223 [20:59] Caracol}Elocuente
Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 664223, SEMANA: 664223 y MES: 664223
[21:00] Caracol}Elocuente R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414 [21:00] Caracol}Elocuente
R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414
[21:00] Caracol}Elocuente Tri.17177 DeporteɔeLaRaNhA˿Campe󮃰1ldexlawSupercopawdexEspa񡃰1w2002y?y [21:00] Caracol}Elocuente
Tri.17177 DeporteɔeLaRaNhA˿Campe󮃰1ldexlawSupercopawdexEspa񡃰1w2002y?y
[21:00] Caracol}Elocuente 1 Pista: *** ****񪠃 Valor pregunta : 19538 Puntos [21:00] Caracol}Elocuente
1 Pista: *** ****񪠃 Valor pregunta : 19538 Puntos
[21:00] Caracol}Elocuente 2 Pista: rcd ****񪠃 30 segundos y 19538 Puntos [21:00] Caracol}Elocuente
2 Pista: rcd ****񪠃 30 segundos y 19538 Puntos
[21:00] Caracol}Elocuente 3 Pista: rcd *o*u񡠃 15 segundos y 19538 Puntos [21:00] Caracol}Elocuente
3 Pista: rcd *o*u񡠃 15 segundos y 19538 Puntos
[21:00] Caracol}Elocuente Tiempo! La respuesta es -> rcd�oru񡠃12 <- [21:00] Caracol}Elocuente
Tiempo! La respuesta es -> rcd�oru񡠃12 <-
[21:00] Caracol}Elocuente If you think a Q&A is wrong, please call an OP [21:00] Caracol}Elocuente
If you think a Q&A is wrong, please call an OP
[21:00] Caracol}Elocuente Tri.10697 Medicina-Saludɦilloa˿Comodselllamawlawregionlposteriorxdellawrodillaw?e [21:00] Caracol}Elocuente
Tri.10697 Medicina-Saludɦilloa˿Comodselllamawlawregionlposteriorxdellawrodillaw?e
[21:00] Caracol}Elocuente 1 Pista: ***** ******** Valor pregunta : 19147 Puntos [21:00] Caracol}Elocuente
1 Pista: ***** ******** Valor pregunta : 19147 Puntos
[21:01] Caracol}Elocuente 2 Pista: hue** ******** 30 segundos y 19147 Puntos [21:01] Caracol}Elocuente
2 Pista: hue** ******** 30 segundos y 19147 Puntos
[21:01] Caracol}Elocuente 3 Pista: hue*o *o**i*eo 15 segundos y 19147 Puntos [21:01] Caracol}Elocuente
3 Pista: hue*o *o**i*eo 15 segundos y 19147 Puntos
[21:01] Caracol}Elocuente Tiempo! La respuesta es -> hueco�opliteo <- [21:01] Caracol}Elocuente
Tiempo! La respuesta es -> hueco�opliteo <-
[21:01] Caracol}Elocuente R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087 [21:01] Caracol}Elocuente
R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087
[21:01] Caracol}Elocuente Tri.16303 GeografiaɍARdeJAVA˿DESDEhQUɃ01hPLAZAhPARTENhLAShTREShV́ShM�hFAMOSAShDEhROMA?h?h [21:01] Caracol}Elocuente
Tri.16303 GeografiaɍARdeJAVA˿DESDEhQUɃ01hPLAZAhPARTENhLAShTREShV́ShM�hFAMOSAShDEhROMA?h?h
[21:01] Caracol}Elocuente 1 Pista: ****** *** ****** Valor pregunta : 9903 Puntos [21:01] Caracol}Elocuente
1 Pista: ****** *** ****** Valor pregunta : 9903 Puntos
[21:02] Caracol}Elocuente 2 Pista: pia*** *** ****** 30 segundos y 9903 Puntos [21:02] Caracol}Elocuente
2 Pista: pia*** *** ****** 30 segundos y 9903 Puntos
[21:02] Caracol}Elocuente 3 Pista: pia**a *e* *o*o*o 15 segundos y 9903 Puntos [21:02] Caracol}Elocuente
3 Pista: pia**a *e* *o*o*o 15 segundos y 9903 Puntos
[21:02] Caracol}Elocuente Tiempo! La respuesta es -> piazza�el�opolo <- [21:02] Caracol}Elocuente
Tiempo! La respuesta es -> piazza�el�opolo <-
[21:02] Caracol}Elocuente For The Competitive Edge type !pingme [21:02] Caracol}Elocuente
For The Competitive Edge type !pingme
[21:02] Caracol}Elocuente Tri.17455 Deporteɲaziel9˿BALONCESTO:ENyQUEyEQUIPOyESTABAyENy2003/04yELyJUGADORyJOHNyBROWNy?y [21:02] Caracol}Elocuente
Tri.17455 Deporteɲaziel9˿BALONCESTO:ENyQUEyEQUIPOyESTABAyENy2003/04yELyJUGADORyJOHNyBROWNy?y
[21:02] Caracol}Elocuente 1 Pista: ***** ******* Valor pregunta : 12166 Puntos [21:02] Caracol}Elocuente
1 Pista: ***** ******* Valor pregunta : 12166 Puntos
[21:03] Caracol}Elocuente 2 Pista: ric** ******* 30 segundos y 12166 Puntos [21:03] Caracol}Elocuente
2 Pista: ric** ******* 30 segundos y 12166 Puntos
[21:03] Elefante-Suave !peticion Don Omar - Hasta Abajo [21:03] Elefante-Suave
!peticion Don Omar - Hasta Abajo
[21:03] Caracol}Elocuente 3 Pista: rico* *a**e*a 15 segundos y 12166 Puntos [21:03] Caracol}Elocuente
3 Pista: rico* *a**e*a 15 segundos y 12166 Puntos
[21:03] Elefante-Suave oppps sala equibocada [21:03] Elefante-Suave
oppps sala equibocada
[21:03] Caracol}Elocuente Tiempo! La respuesta es -> ricoh�anresa <- [21:03] Caracol}Elocuente
Tiempo! La respuesta es -> ricoh�anresa <-
[21:03] Caracol}Elocuente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [21:03] Caracol}Elocuente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[21:03] Caracol}Elocuente Tri.1328 HistoriaɊAVEA˿CONyQUEyPAISyFIRMAyFRANCIAyUNyACUERDOySECRETOyDEyNEUTRALIDADyRECIPROCAyENyAFRICAyENy1902y?y [21:03] Caracol}Elocuente
Tri.1328 HistoriaɊAVEA˿CONyQUEyPAISyFIRMAyFRANCIAyUNyACUERDOySECRETOyDEyNEUTRALIDADyRECIPROCAyENyAFRICAyENy1902y?y
[21:03] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 7356 Puntos [21:03] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 7356 Puntos
[21:03] Caracol}Elocuente 2 Pista: ITA*** 30 segundos y 7356 Puntos [21:03] Caracol}Elocuente
2 Pista: ITA*** 30 segundos y 7356 Puntos
[21:04] Elefante-Suave italia [21:04] Elefante-Suave
italia
[21:04] Caracol}Elocuente �Suma y sigue Elefante-Suave!! La respuesta: "italia" incrementa tu marcador en �356�12 puntos [21:04] Caracol}Elocuente
�Suma y sigue Elefante-Suave!! La respuesta: "italia" incrementa tu marcador en �356�12 puntos
[21:04] Caracol}Elocuente ACTION awards Elefante-Suave with a +v for having over 15000 points [21:04] Caracol}Elocuente
ACTION awards Elefante-Suave with a +v for having over 15000 points
[21:04] Caracol}Elocuente Elefante-Suave has acertado 1 seguidas!! Puntos HOY: 970106, SEMANA: 1223857 y MES: 2341984 [21:04] Caracol}Elocuente
Elefante-Suave has acertado 1 seguidas!! Puntos HOY: 970106, SEMANA: 1223857 y MES: 2341984
[21:04] Caracol}Elocuente R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2334628 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 664223 [21:04] Caracol}Elocuente
R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2334628 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 664223
[21:04] Caracol}Elocuente Tri.9823 Historiaɦrederikˎombrebdelyarmapquebm᳃01ppersonasphapmatadokhastaplapaparici󮃰1ydeblapp󬶯rap(e.j.dEnylapbatallapdebcannaspacab󃰱dconylapvidapdeb80.000dlegionariospRomanos)d?d [21:04] Caracol}Elocuente
Tri.9823 Historiaɦrederikˎombrebdelyarmapquebm᳃01ppersonasphapmatadokhastaplapaparici󮃰1ydeblapp󬶯rap(e.j.dEnylapbatallapdebcannaspacab󃰱dconylapvidapdeb80.000dlegionariospRomanos)d?d
[21:04] Caracol}Elocuente 1 Pista: ******* ************ * ****** ***** ****񪪪 Valor pregunta : 18229 Puntos [21:04] Caracol}Elocuente
1 Pista: ******* ************ * ****** ***** ****񪪪 Valor pregunta : 18229 Puntos
[21:04] Caracol}Elocuente 2 Pista: gla**** ************ * ****** ***** ****񪪪 30 segundos y 18229 Puntos [21:04] Caracol}Elocuente
2 Pista: gla**** ************ * ****** ***** ****񪪪 30 segundos y 18229 Puntos
[21:04] Elefante-Suave missxaxis donde estas [21:04] Elefante-Suave
missxaxis donde estas
[21:04] Caracol}Elocuente 3 Pista: gla*iu* *i**a*ie**i* o e**a*a *o**a e**a񯪡 15 segundos y 18229 Puntos [21:04] Caracol}Elocuente
3 Pista: gla*iu* *i**a*ie**i* o e**a*a *o**a e**a񯪡 15 segundos y 18229 Puntos
[21:04] Elefante-Suave ya se durmio [21:04] Elefante-Suave
ya se durmio
[21:05] Caracol}Elocuente Tiempo! La respuesta es -> gladius�ispaniensis��spada�orta�spa񯬡 <- [21:05] Caracol}Elocuente
Tiempo! La respuesta es -> gladius�ispaniensis��spada�orta�spa񯬡 <-
[21:05] Caracol}Elocuente Please refrain from using Extreme Bad Language [21:05] Caracol}Elocuente
Please refrain from using Extreme Bad Language
[21:05] Caracol}Elocuente Tri.5611 Idiomasɦlipp_er˿FRANCES--->ESPAяL:chocolatzauglaitz?u [21:05] Caracol}Elocuente
Tri.5611 Idiomasɦlipp_er˿FRANCES--->ESPAяL:chocolatzauglaitz?u
[21:05] Caracol}Elocuente 1 Pista: ********* *** ***** Pregunta de BONUS : 200000 Puntos [21:05] Caracol}Elocuente
1 Pista: ********* *** ***** Pregunta de BONUS : 200000 Puntos
[21:05] Caracol}Elocuente 2 Pista: cho****** *** ***** 30 segundos y 200000 Puntos [21:05] Caracol}Elocuente
2 Pista: cho****** *** ***** 30 segundos y 200000 Puntos
[21:05] Caracol}Elocuente 3 Pista: cho*o*a*e *o* *e**e 15 segundos y 200000 Puntos [21:05] Caracol}Elocuente
3 Pista: cho*o*a*e *o* *e**e 15 segundos y 200000 Puntos
[21:05] Caracol}Elocuente Tiempo! La respuesta es -> chocolate�on�eche <- [21:05] Caracol}Elocuente
Tiempo! La respuesta es -> chocolate�on�eche <-
[21:06] Caracol}Elocuente This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente [21:06] Caracol}Elocuente
This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente
[21:06] Caracol}Elocuente Tri.15711 Arteɍento˿CualesqdehmonumentosqdehSal󮩣assehhangdeclaradocpatrimoniocculturalvdehlashumanidade?i [21:06] Caracol}Elocuente
Tri.15711 Arteɍento˿CualesqdehmonumentosqdehSal󮩣assehhangdeclaradocpatrimoniocculturalvdehlashumanidade?i
[21:06] Caracol}Elocuente 1 Pista: *************** * ********** Valor pregunta : 21076 Puntos [21:06] Caracol}Elocuente
1 Pista: *************** * ********** Valor pregunta : 21076 Puntos
[21:06] Caracol}Elocuente 2 Pista: pal************ * ********** 30 segundos y 21076 Puntos [21:06] Caracol}Elocuente
2 Pista: pal************ * ********** 30 segundos y 21076 Puntos
[21:06] Caracol}Elocuente 3 Pista: paleo**i**ia*o* * *i*a**i*o* 15 segundos y 21076 Puntos [21:06] Caracol}Elocuente
3 Pista: paleo**i**ia*o* * *i*a**i*o* 15 segundos y 21076 Puntos
[21:06] Caracol}Elocuente Tiempo! La respuesta es -> paleocristianos��izantinos <- [21:06] Caracol}Elocuente
Tiempo! La respuesta es -> paleocristianos��izantinos <-
[21:07] Caracol}Elocuente This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeonBrillante 25000 #14: Grillo-Locuaz 23731 #15: LeCaTwaLk_z 19830 #16: FANTASMAMEXICO 5048 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [21:07] Caracol}Elocuente
This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeonBrillante 25000 #14: Grillo-Locuaz 23731 #15: LeCaTwaLk_z 19830 #16: FANTASMAMEXICO 5048 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[21:07] Caracol}Elocuente Tri.16763 Musicaɬusie˿C󭯃01psefllamaxlaxcantantefprincipaljenlunax󰥲a?v?v [21:07] Caracol}Elocuente
Tri.16763 Musicaɬusie˿C󭯃01psefllamaxlaxcantantefprincipaljenlunax󰥲a?v?v
[21:07] Caracol}Elocuente 1 Pista: ***** ***** Valor pregunta : 19276 Puntos [21:07] Caracol}Elocuente
1 Pista: ***** ***** Valor pregunta : 19276 Puntos
[21:07] Caracol}Elocuente 2 Pista: pri** ***** 30 segundos y 19276 Puntos [21:07] Caracol}Elocuente
2 Pista: pri** ***** 30 segundos y 19276 Puntos
[21:07] Caracol}Elocuente 3 Pista: pri*a *o**a 15 segundos y 19276 Puntos [21:07] Caracol}Elocuente
3 Pista: pri*a *o**a 15 segundos y 19276 Puntos
[21:07] Caracol}Elocuente Tiempo! La respuesta es -> prima�onna <- [21:07] Caracol}Elocuente
Tiempo! La respuesta es -> prima�onna <-
[21:08] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [21:08] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[21:08] Caracol}Elocuente Tri.10973 Historiaɳtephenwo˿Enpqu郰1upa�01mseycreoylasfigurasdelwprimeriministro?u?u [21:08] Caracol}Elocuente
Tri.10973 Historiaɳtephenwo˿Enpqu郰1upa�01mseycreoylasfigurasdelwprimeriministro?u?u
[21:08] Caracol}Elocuente 1 Pista: ********** Valor pregunta : 21288 Puntos [21:08] Caracol}Elocuente
1 Pista: ********** Valor pregunta : 21288 Puntos
[21:08] Caracol}Elocuente 2 Pista: ing******* 30 segundos y 21288 Puntos [21:08] Caracol}Elocuente
2 Pista: ing******* 30 segundos y 21288 Puntos
[21:08] Caracol}Elocuente �Enhorabuena Caiman_Enorme!! Has contestado "inglaterra" y por ello has ganado �1288�12 puntos [21:08] Caracol}Elocuente
�Enhorabuena Caiman_Enorme!! Has contestado "inglaterra" y por ello has ganado �1288�12 puntos
[21:08] Caracol}Elocuente ACTION awards Caiman_Enorme with a +v for having over 15000 points [21:08] Caracol}Elocuente
ACTION awards Caiman_Enorme with a +v for having over 15000 points
[21:08] Caracol}Elocuente Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 685511, SEMANA: 685511 y MES: 685511 [21:08] Caracol}Elocuente
Caiman_Enorme has acertado 1 seguidas!! Puntos HOY: 685511, SEMANA: 685511 y MES: 685511
[21:08] Caiman_Enorme inglaterra [21:08] Caiman_Enorme
inglaterra
[21:08] Caracol}Elocuente This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: Rodolfo516 49625 [21:08] Caracol}Elocuente
This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: Rodolfo516 49625
[21:08] Caracol}Elocuente Tri.5232 Gastronomiaɋwahamot˿Desquescomunidadlautonomajeslpropiotelnpanuhuntadotconutomates?u [21:08] Caracol}Elocuente
Tri.5232 Gastronomiaɋwahamot˿Desquescomunidadlautonomajeslpropiotelnpanuhuntadotconutomates?u
[21:08] Caracol}Elocuente 1 Pista: ******񪠃 Valor pregunta : 10316 Puntos [21:08] Caracol}Elocuente
1 Pista: ******񪠃 Valor pregunta : 10316 Puntos
[21:08] Elefante-Suave buena missmaxis me ganaste [21:08] Elefante-Suave
buena missmaxis me ganaste
[21:08] Caracol}Elocuente 2 Pista: cat***񪠃 30 segundos y 10316 Puntos [21:08] Caracol}Elocuente
2 Pista: cat***񪠃 30 segundos y 10316 Puntos
[21:08] Elefante-Suave asi hasta abajo soy yo [21:08] Elefante-Suave
asi hasta abajo soy yo
[21:09] Caracol}Elocuente 3 Pista: cata*u񡠃 15 segundos y 10316 Puntos [21:09] Caracol}Elocuente
3 Pista: cata*u񡠃 15 segundos y 10316 Puntos
[21:09] Caracol}Elocuente Tiempo! La respuesta es -> catalu񡠃12 <- [21:09] Caracol}Elocuente
Tiempo! La respuesta es -> catalu񡠃12 <-
[21:09] Caracol}Elocuente R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206 [21:09] Caracol}Elocuente
R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206
[21:09] Caracol}Elocuente Tri.9853 Biologiaɴarraˌansacarosa,vlanmaltosa,vlanlactosa,vellalmid󮬃01vlancelulosanyhlanglucosanson.....v?v [21:09] Caracol}Elocuente
Tri.9853 Biologiaɴarraˌansacarosa,vlanmaltosa,vlanlactosa,vellalmid󮬃01vlancelulosanyhlanglucosanson.....v?v
[21:09] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 18928 Puntos [21:09] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 18928 Puntos
[21:09] Elefante-Suave xD [21:09] Elefante-Suave
xD
[21:09] Caracol}Elocuente 2 Pista: glu***** 30 segundos y 18928 Puntos [21:09] Caracol}Elocuente
2 Pista: glu***** 30 segundos y 18928 Puntos
[21:09] Caracol}Elocuente 3 Pista: glu*i*o* 15 segundos y 18928 Puntos [21:09] Caracol}Elocuente
3 Pista: glu*i*o* 15 segundos y 18928 Puntos
[21:10] Caracol}Elocuente Tiempo! La respuesta es -> glucidos <- [21:10] Caracol}Elocuente
Tiempo! La respuesta es -> glucidos <-
[21:10] Caracol}Elocuente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [21:10] Caracol}Elocuente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[21:10] Caracol}Elocuente Tri.3435 Arteɐsico666˿Asquienqseklekdebe?sLapCenapdeklosbEruditosb?s [21:10] Caracol}Elocuente
Tri.3435 Arteɐsico666˿Asquienqseklekdebe?sLapCenapdeklosbEruditosb?s
[21:10] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 13444 Puntos [21:10] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 13444 Puntos
[21:10] Caracol}Elocuente 2 Pista: ate*** 30 segundos y 13444 Puntos [21:10] Caracol}Elocuente
2 Pista: ate*** 30 segundos y 13444 Puntos
[21:10] Caracol}Elocuente 3 Pista: ate*eo 15 segundos y 13444 Puntos [21:10] Caracol}Elocuente
3 Pista: ate*eo 15 segundos y 13444 Puntos
[21:10] CaballitoDeMar-Respetable ¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [21:10] CaballitoDeMar-Respetable
¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[21:11] Caracol}Elocuente Tiempo! La respuesta es -> ateneo <- [21:11] Caracol}Elocuente
Tiempo! La respuesta es -> ateneo <-
[21:11] Caracol}Elocuente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [21:11] Caracol}Elocuente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[21:11] Caracol}Elocuente Tri.14099 CineɔeLaRaNhA˿EsbMorrisbPaleyzenn"SkyzCaptainnyzeldmundoudeldma񡮡"y?y [21:11] Caracol}Elocuente
Tri.14099 CineɔeLaRaNhA˿EsbMorrisbPaleyzenn"SkyzCaptainnyzeldmundoudeldma񡮡"y?y
[21:11] Caracol}Elocuente 1 Pista: ******* ****** Valor pregunta : 19560 Puntos [21:11] Caracol}Elocuente
1 Pista: ******* ****** Valor pregunta : 19560 Puntos
[21:11] Caracol}Elocuente 2 Pista: mic**** ****** 30 segundos y 19560 Puntos [21:11] Caracol}Elocuente
2 Pista: mic**** ****** 30 segundos y 19560 Puntos
[21:11] Caracol}Elocuente 3 Pista: mic*ae* *a**o* 15 segundos y 19560 Puntos [21:11] Caracol}Elocuente
3 Pista: mic*ae* *a**o* 15 segundos y 19560 Puntos
[21:12] Caracol}Elocuente Tiempo! La respuesta es -> michael�ambon <- [21:12] Caracol}Elocuente
Tiempo! La respuesta es -> michael�ambon <-
[21:12] Caracol}Elocuente R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1223857 #5: siva- 692906 #6: Caiman_Enorme 685511 #7: Ketzy 610145 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481 [21:12] Caracol}Elocuente
R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1223857 #5: siva- 692906 #6: Caiman_Enorme 685511 #7: Ketzy 610145 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481
[21:12] Caracol}Elocuente Tri.18638 PersonajesɍARdeJAVA˄IBUJOSuANIMADOS:u߃ӍOuSEuLLAMABAuELuSIMP�ICOuPERRITOuQUEuCREӃ01uELuDIBUJANTEuSCHULZuENu1950?u?u [21:12] Caracol}Elocuente
Tri.18638 PersonajesɍARdeJAVA˄IBUJOSuANIMADOS:u߃ӍOuSEuLLAMABAuELuSIMP�ICOuPERRITOuQUEuCREӃ01uELuDIBUJANTEuSCHULZuENu1950?u?u
[21:12] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 22548 Puntos [21:12] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 22548 Puntos
[21:12] Caracol}Elocuente 2 Pista: sno*** 30 segundos y 22548 Puntos [21:12] Caracol}Elocuente
2 Pista: sno*** 30 segundos y 22548 Puntos
[21:12] Caracol}Elocuente 3 Pista: snoo** 15 segundos y 22548 Puntos [21:12] Caracol}Elocuente
3 Pista: snoo** 15 segundos y 22548 Puntos
[21:12] Caracol}Elocuente Tiempo! La respuesta es -> snoopy <- [21:12] Caracol}Elocuente
Tiempo! La respuesta es -> snoopy <-
[21:13] Caracol}Elocuente We feature over 50,000 Q&A ! [21:13] Caracol}Elocuente
We feature over 50,000 Q&A !
[21:13] Caracol}Elocuente Tri.19847 Cienciaɓebosin˿Cuᬃ01uesllacvozsjaponesacparacdesignarqacunacolacmarinacderorigengs�ico?s?s [21:13] Caracol}Elocuente
Tri.19847 Cienciaɓebosin˿Cuᬃ01uesllacvozsjaponesacparacdesignarqacunacolacmarinacderorigengs�ico?s?s
[21:13] Caracol}Elocuente 1 Pista: ******* Valor pregunta : 10413 Puntos [21:13] Caracol}Elocuente
1 Pista: ******* Valor pregunta : 10413 Puntos
[21:13] Caracol}Elocuente 2 Pista: tsu**** 30 segundos y 10413 Puntos [21:13] Caracol}Elocuente
2 Pista: tsu**** 30 segundos y 10413 Puntos
[21:13] Caracol}Elocuente 3 Pista: tsu*a*i 15 segundos y 10413 Puntos [21:13] Caracol}Elocuente
3 Pista: tsu*a*i 15 segundos y 10413 Puntos
[21:13] LeonBrillante tsunami [21:13] LeonBrillante
tsunami
[21:13] Caracol}Elocuente �LeonBrillante acert󡡠La respuesta era: "tsunami" y contest󠥮 �0.343 segundos. Se lleva: �0413�12 puntos [21:13] Caracol}Elocuente
�LeonBrillante acert󡡠La respuesta era: "tsunami" y contest󠥮 �0.343 segundos. Se lleva: �0413�12 puntos
[21:13] Caracol}Elocuente ACTION awards LeonBrillante with a +v for having over 15000 points [21:13] Caracol}Elocuente
ACTION awards LeonBrillante with a +v for having over 15000 points
[21:13] Caracol}Elocuente LeonBrillante has acertado 1 seguidas!! Puntos HOY: 35413, SEMANA: 35413 y MES: 35413 [21:13] Caracol}Elocuente
LeonBrillante has acertado 1 seguidas!! Puntos HOY: 35413, SEMANA: 35413 y MES: 35413
[21:13] LeonBrillante yeahhh [21:13] LeonBrillante
yeahhh
[21:13] Caracol}Elocuente R᮫ing de HOY: - #1: Jirafa\Letal 970106 #2: Gladiadora_del_Caribe 686734 #3: Caiman_Enorme 685511 #4: Grillo{Naranja 616922 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: Ketzy 38872 #9: LeonBrillante 35413 #10: Grillo-Locuaz 23731 [21:13] Caracol}Elocuente
R᮫ing de HOY: - #1: Jirafa\Letal 970106 #2: Gladiadora_del_Caribe 686734 #3: Caiman_Enorme 685511 #4: Grillo{Naranja 616922 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: Ketzy 38872 #9: LeonBrillante 35413 #10: Grillo-Locuaz 23731
[21:13] Caracol}Elocuente Tri.20879 Cancionesɤassler˿Aequ郰1ediscojdeeJoaquinjSabinajperteneceelajcanci󮃰1j"Elgrocksandqrollgdeelosdidiotas"e?"e?e [21:13] Caracol}Elocuente
Tri.20879 Cancionesɤassler˿Aequ郰1ediscojdeeJoaquinjSabinajperteneceelajcanci󮃰1j"Elgrocksandqrollgdeelosdidiotas"e?"e?e
[21:13] Caracol}Elocuente 1 Pista: ** ** ** ******* Valor pregunta : 8516 Puntos [21:13] Caracol}Elocuente
1 Pista: ** ** ** ******* Valor pregunta : 8516 Puntos
[21:14] Caracol}Elocuente 2 Pista: yo�* ** ******* 30 segundos y 8516 Puntos [21:14] Caracol}Elocuente
2 Pista: yo�* ** ******* 30 segundos y 8516 Puntos
[21:14] Caracol}Elocuente 3 Pista: yo�i *e *o**i*o 15 segundos y 8516 Puntos [21:14] Caracol}Elocuente
3 Pista: yo�i *e *o**i*o 15 segundos y 8516 Puntos
[21:14] Caracol}Elocuente Tiempo! La respuesta es -> yo�i�e�ontigo <- [21:14] Caracol}Elocuente
Tiempo! La respuesta es -> yo�i�e�ontigo <-
[21:14] Caracol}Elocuente Tri.11380 Musicaɳtephenwo˿Cualcesxelcverdaderoanombrendenjamiroquay?y?y [21:14] Caracol}Elocuente
Tri.11380 Musicaɳtephenwo˿Cualcesxelcverdaderoanombrendenjamiroquay?y?y
[21:14] Caracol}Elocuente 1 Pista: *** **** Valor pregunta : 20156 Puntos [21:14] Caracol}Elocuente
1 Pista: *** **** Valor pregunta : 20156 Puntos
[21:15] Caracol}Elocuente 2 Pista: jay **** 30 segundos y 20156 Puntos [21:15] Caracol}Elocuente
2 Pista: jay **** 30 segundos y 20156 Puntos
[21:15] Caracol}Elocuente 3 Pista: jay *ua* 15 segundos y 20156 Puntos [21:15] Caracol}Elocuente
3 Pista: jay *ua* 15 segundos y 20156 Puntos
[21:15] Caracol}Elocuente Tiempo! La respuesta es -> jay�uay <- [21:15] Caracol}Elocuente
Tiempo! La respuesta es -> jay�uay <-
[21:15] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [21:15] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[21:15] Caracol}Elocuente Tri.18753 InformaticaɉRC-Domain˿HErramientasxdeaaccesibilidad:uproporcionaoadvertenciasxvisualesxparaolosxsonidosxdelxsistemao?u [21:15] Caracol}Elocuente
Tri.18753 InformaticaɉRC-Domain˿HErramientasxdeaaccesibilidad:uproporcionaoadvertenciasxvisualesxparaolosxsonidosxdelxsistemao?u
[21:15] Caracol}Elocuente 1 Pista: *********** Valor pregunta : 20726 Puntos [21:15] Caracol}Elocuente
1 Pista: *********** Valor pregunta : 20726 Puntos
[21:16] Caracol}Elocuente 2 Pista: sou******** 30 segundos y 20726 Puntos [21:16] Caracol}Elocuente
2 Pista: sou******** 30 segundos y 20726 Puntos
[21:16] Caracol}Elocuente 3 Pista: sou***e**** 15 segundos y 20726 Puntos [21:16] Caracol}Elocuente
3 Pista: sou***e**** 15 segundos y 20726 Puntos
[21:16] Caracol}Elocuente Tiempo! La respuesta es -> soundsentry <- [21:16] Caracol}Elocuente
Tiempo! La respuesta es -> soundsentry <-
[21:16] Caracol}Elocuente R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414 [21:16] Caracol}Elocuente
R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414
[21:16] Caracol}Elocuente Tri.17491 Cotilleo-TVɚytox˿ComomsetllamaxlaxhijaxartistaxdetMilikie?b [21:16] Caracol}Elocuente
Tri.17491 Cotilleo-TVɚytox˿ComomsetllamaxlaxhijaxartistaxdetMilikie?b
[21:16] Caracol}Elocuente 1 Pista: **** ******* Valor pregunta : 15833 Puntos [21:16] Caracol}Elocuente
1 Pista: **** ******* Valor pregunta : 15833 Puntos
[21:16] Caracol}Elocuente 2 Pista: rit* ******* 30 segundos y 15833 Puntos [21:16] Caracol}Elocuente
2 Pista: rit* ******* 30 segundos y 15833 Puntos
[21:17] Caracol}Elocuente 3 Pista: rita i*a*e*a 15 segundos y 15833 Puntos [21:17] Caracol}Elocuente
3 Pista: rita i*a*e*a 15 segundos y 15833 Puntos
[21:17] Caracol}Elocuente Tiempo! La respuesta es -> rita�rasema <- [21:17] Caracol}Elocuente
Tiempo! La respuesta es -> rita�rasema <-
[21:17] Caracol}Elocuente If you think a Q&A is wrong, please call an OP [21:17] Caracol}Elocuente
If you think a Q&A is wrong, please call an OP
[21:17] Caracol}Elocuente Tri.17757 Cotilleo-TVɚytox˿Comofsecllamabajlajcalabazajmascotajdell1,2,3m?m [21:17] Caracol}Elocuente
Tri.17757 Cotilleo-TVɚytox˿Comofsecllamabajlajcalabazajmascotajdell1,2,3m?m
[21:17] Caracol}Elocuente 1 Pista: ******* Valor pregunta : 21895 Puntos [21:17] Caracol}Elocuente
1 Pista: ******* Valor pregunta : 21895 Puntos
[21:17] Grillo{Naranja !Stats [21:17] Grillo{Naranja
!Stats
[21:17] Caracol\Enorme Realización de estadísticas en curso. Solicitadas por: Grillo{Naranja. [21:17] Caracol\Enorme
Realización de estadísticas en curso. Solicitadas por: Grillo{Naranja.
[21:17] Caracol}Elocuente 2 Pista: rup**** 30 segundos y 21895 Puntos [21:17] Caracol}Elocuente
2 Pista: rup**** 30 segundos y 21895 Puntos
[21:18] Caracol\Enorme Resumen de estadísticas - Los que más han escrito hoy -> Caracol}Elocuente ( 3701 ), Jirafa\Letal ( 224), Caiman_Enorme ( 98), Gladiadora_del_Caribe ( 83), Paulus ( 60), Luna-Petunia ( 53), Moog ( 45), Grillo{Naranja ( 42), _Elektra_ ( 41), Cosmo ( 28 ) [21:18] Caracol\Enorme
Resumen de estadísticas - Los que más han escrito hoy -> Caracol}Elocuente ( 3701 ), Jirafa\Letal ( 224), Caiman_Enorme ( 98), Gladiadora_del_Caribe ( 83), Paulus ( 60), Luna-Petunia ( 53), Moog ( 45), Grillo{Naranja ( 42), _Elektra_ ( 41), Cosmo ( 28 )
[21:18] Caracol\Enorme Estadísticas actualizadas por Grillo{Naranja. Visite las estadísticas en https://www.winstats.es/stats/mexico.html [21:18] Caracol\Enorme
Estadísticas actualizadas por Grillo{Naranja. Visite las estadísticas en https://www.winstats.es/stats/mexico.html
[21:18] Caracol}Elocuente 3 Pista: rupe**a 15 segundos y 21895 Puntos [21:18] Caracol}Elocuente
3 Pista: rupe**a 15 segundos y 21895 Puntos
[21:18] Caracol}Elocuente Tiempo! La respuesta es -> ruperta <- [21:18] Caracol}Elocuente
Tiempo! La respuesta es -> ruperta <-
[21:18] Caracol}Elocuente R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087 [21:18] Caracol}Elocuente
R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087
[21:18] Caracol}Elocuente Tri.15073 LiteraturaɞIrati˿Cuᬃ01xerabelxnombregdeglabamantegdegJamesoJoyce?v?v [21:18] Caracol}Elocuente
Tri.15073 LiteraturaɞIrati˿Cuᬃ01xerabelxnombregdeglabamantegdegJamesoJoyce?v?v
[21:18] Caracol}Elocuente 1 Pista: **** ******** Valor pregunta : 7547 Puntos [21:18] Caracol}Elocuente
1 Pista: **** ******** Valor pregunta : 7547 Puntos
[21:18] Caracol}Elocuente 2 Pista: nor* ******** 30 segundos y 7547 Puntos [21:18] Caracol}Elocuente
2 Pista: nor* ******** 30 segundos y 7547 Puntos
[21:19] Caracol}Elocuente 3 Pista: nora *a**a**e 15 segundos y 7547 Puntos [21:19] Caracol}Elocuente
3 Pista: nora *a**a**e 15 segundos y 7547 Puntos
[21:19] Caracol}Elocuente Tiempo! La respuesta es -> nora�arnacle <- [21:19] Caracol}Elocuente
Tiempo! La respuesta es -> nora�arnacle <-
[21:19] Caracol}Elocuente For The Competitive Edge type !pingme [21:19] Caracol}Elocuente
For The Competitive Edge type !pingme
[21:19] Caracol}Elocuente Tri.19255 LiteraturaɍARdeJAVA˨184-159).tAUTORt"tLOStADELFOS".t?t [21:19] Caracol}Elocuente
Tri.19255 LiteraturaɍARdeJAVA˨184-159).tAUTORt"tLOStADELFOS".t?t
[21:19] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 16641 Puntos [21:19] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 16641 Puntos
[21:19] Caracol}Elocuente 2 Pista: ter***** 30 segundos y 16641 Puntos [21:19] Caracol}Elocuente
2 Pista: ter***** 30 segundos y 16641 Puntos
[21:20] Caracol}Elocuente 3 Pista: tere**io 15 segundos y 16641 Puntos [21:20] Caracol}Elocuente
3 Pista: tere**io 15 segundos y 16641 Puntos
[21:20] Caracol}Elocuente Tiempo! La respuesta es -> terencio <- [21:20] Caracol}Elocuente
Tiempo! La respuesta es -> terencio <-
[21:20] Caracol}Elocuente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [21:20] Caracol}Elocuente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[21:20] Caracol}Elocuente Tri.6272 Geografiaɬusie˿C󭯃01dsezllamajellestudioddescriptivoddezunajdistribuci󮃰1penpellespacio.c?c?c [21:20] Caracol}Elocuente
Tri.6272 Geografiaɬusie˿C󭯃01dsezllamajellestudioddescriptivoddezunajdistribuci󮃰1penpellespacio.c?c?c
[21:20] Caracol}Elocuente 1 Pista: ********* Valor pregunta : 18007 Puntos [21:20] Caracol}Elocuente
1 Pista: ********* Valor pregunta : 18007 Puntos
[21:20] Caracol}Elocuente 2 Pista: cor****** 30 segundos y 18007 Puntos [21:20] Caracol}Elocuente
2 Pista: cor****** 30 segundos y 18007 Puntos
[21:20] Caracol}Elocuente 3 Pista: coro*o*ia 15 segundos y 18007 Puntos [21:20] Caracol}Elocuente
3 Pista: coro*o*ia 15 segundos y 18007 Puntos
[21:21] CaballitoDeMar-Respetable « Anguila{Agil en emisión » Radio Luna de Miel · Temática: Música variada · País: · https://www.radiolunademiel.com [21:21] CaballitoDeMar-Respetable
« Anguila{Agil en emisión » Radio Luna de Miel · Temática: Música variada · País: · https://www.radiolunademiel.com
[21:21] Caracol}Elocuente Tiempo! La respuesta es -> corologia <- [21:21] Caracol}Elocuente
Tiempo! La respuesta es -> corologia <-
[21:21] Caracol}Elocuente R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2341984 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 685511 [21:21] Caracol}Elocuente
R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2341984 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 685511
[21:21] Caracol}Elocuente Tri.10253 Politicaɴjmm.comːresidenteddedAfganistᮃ01wabDiciembredded2004,oelhprimerouelegidoudemocrᴩcamented?o [21:21] Caracol}Elocuente
Tri.10253 Politicaɴjmm.comːresidenteddedAfganistᮃ01wabDiciembredded2004,oelhprimerouelegidoudemocrᴩcamented?o
[21:21] Caracol}Elocuente 1 Pista: ***** ****** Valor pregunta : 17686 Puntos [21:21] Caracol}Elocuente
1 Pista: ***** ****** Valor pregunta : 17686 Puntos
[21:21] Caracol}Elocuente 2 Pista: ham** ****** 30 segundos y 17686 Puntos [21:21] Caracol}Elocuente
2 Pista: ham** ****** 30 segundos y 17686 Puntos
[21:21] Caracol}Elocuente 3 Pista: hami* *a**ai 15 segundos y 17686 Puntos [21:21] Caracol}Elocuente
3 Pista: hami* *a**ai 15 segundos y 17686 Puntos
[21:22] Caracol}Elocuente Tiempo! La respuesta es -> hamid�arzai <- [21:22] Caracol}Elocuente
Tiempo! La respuesta es -> hamid�arzai <-
[21:22] Caracol}Elocuente Please refrain from using Extreme Bad Language [21:22] Caracol}Elocuente
Please refrain from using Extreme Bad Language
[21:22] Caracol}Elocuente Tri.14278 Medicina-SaludɃygna˿C󭯃01fsedllamaalaaparteddedlaaanatom�01adescriptivaaquedestudiaalosfm�sculos?e?e [21:22] Caracol}Elocuente
Tri.14278 Medicina-SaludɃygna˿C󭯃01fsedllamaalaaparteddedlaaanatom�01adescriptivaaquedestudiaalosfm�sculos?e?e
[21:22] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 19334 Puntos [21:22] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 19334 Puntos
[21:22] Caracol}Elocuente 2 Pista: mio***** 30 segundos y 19334 Puntos [21:22] Caracol}Elocuente
2 Pista: mio***** 30 segundos y 19334 Puntos
[21:22] Caracol}Elocuente 3 Pista: mio*o*ia 15 segundos y 19334 Puntos [21:22] Caracol}Elocuente
3 Pista: mio*o*ia 15 segundos y 19334 Puntos
[21:22] Elefante-Suave miotogia [21:22] Elefante-Suave
miotogia
[21:23] Caracol}Elocuente Tiempo! La respuesta es -> miologia <- [21:23] Caracol}Elocuente
Tiempo! La respuesta es -> miologia <-
[21:23] Elefante-Suave diablosss [21:23] Elefante-Suave
diablosss
[21:23] Caracol}Elocuente This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente [21:23] Caracol}Elocuente
This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente
[21:23] Caracol}Elocuente Tri.20032 Idiomasɦlipp_er˿FRANCES--->ESPAяL:unhbouquetidebfleursj?v [21:23] Caracol}Elocuente
Tri.20032 Idiomasɦlipp_er˿FRANCES--->ESPAяL:unhbouquetidebfleursj?v
[21:23] Caracol}Elocuente 1 Pista: ** **** ** ****** Valor pregunta : 15292 Puntos [21:23] Caracol}Elocuente
1 Pista: ** **** ** ****** Valor pregunta : 15292 Puntos
[21:23] Elefante-Suave por mil demonios [21:23] Elefante-Suave
por mil demonios
[21:23] Caracol}Elocuente 2 Pista: un�*** ** ****** 30 segundos y 15292 Puntos [21:23] Caracol}Elocuente
2 Pista: un�*** ** ****** 30 segundos y 15292 Puntos
[21:23] Caracol}Elocuente 3 Pista: un�a*o *e **o*e* 15 segundos y 15292 Puntos [21:23] Caracol}Elocuente
3 Pista: un�a*o *e **o*e* 15 segundos y 15292 Puntos
[21:23] Caracol}Elocuente Tiempo! La respuesta es -> un�amo�e�lores <- [21:23] Caracol}Elocuente
Tiempo! La respuesta es -> un�amo�e�lores <-
[21:24] Caracol}Elocuente This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeonBrillante 35413 #14: Grillo-Locuaz 23731 #15: LeCaTwaLk_z 19830 #16: FANTASMAMEXICO 5048 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [21:24] Caracol}Elocuente
This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeonBrillante 35413 #14: Grillo-Locuaz 23731 #15: LeCaTwaLk_z 19830 #16: FANTASMAMEXICO 5048 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[21:24] Caracol}Elocuente Tri.13258 EconomiaɊarreando˿CualyesdelysignificadoldeolasdsiglasdMIBOR?q?q [21:24] Caracol}Elocuente
Tri.13258 EconomiaɊarreando˿CualyesdelysignificadoldeolasdsiglasdMIBOR?q?q
[21:24] Caracol}Elocuente 1 Pista: ****** ********* ******* **** Valor pregunta : 14790 Puntos [21:24] Caracol}Elocuente
1 Pista: ****** ********* ******* **** Valor pregunta : 14790 Puntos
[21:24] Caracol}Elocuente 2 Pista: mad*** ********* ******* **** 30 segundos y 14790 Puntos [21:24] Caracol}Elocuente
2 Pista: mad*** ********* ******* **** 30 segundos y 14790 Puntos
[21:24] Caracol}Elocuente 3 Pista: mad*i* i**e**a** o**e*e* *a*e 15 segundos y 14790 Puntos [21:24] Caracol}Elocuente
3 Pista: mad*i* i**e**a** o**e*e* *a*e 15 segundos y 14790 Puntos
[21:24] Caracol}Elocuente Tiempo! La respuesta es -> madrid�nterbank�ffered�ate <- [21:24] Caracol}Elocuente
Tiempo! La respuesta es -> madrid�nterbank�ffered�ate <-
[21:25] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [21:25] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[21:25] Caracol}Elocuente Tri.5337 Musicaɖivian˿Desquientesrelqalbumk"Song"o?o [21:25] Caracol}Elocuente
Tri.5337 Musicaɖivian˿Desquientesrelqalbumk"Song"o?o
[21:25] Caracol}Elocuente 1 Pista: ****** **** Valor pregunta : 8007 Puntos [21:25] Caracol}Elocuente
1 Pista: ****** **** Valor pregunta : 8007 Puntos
[21:25] Caracol}Elocuente 2 Pista: cel*** **** 30 segundos y 8007 Puntos [21:25] Caracol}Elocuente
2 Pista: cel*** **** 30 segundos y 8007 Puntos
[21:25] Caracol}Elocuente 3 Pista: celi*e *io* 15 segundos y 8007 Puntos [21:25] Caracol}Elocuente
3 Pista: celi*e *io* 15 segundos y 8007 Puntos
[21:25] Caracol}Elocuente Tiempo! La respuesta es -> celine�ion <- [21:25] Caracol}Elocuente
Tiempo! La respuesta es -> celine�ion <-
[21:25] Caracol}Elocuente This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: Rodolfo516 49625 [21:25] Caracol}Elocuente
This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: Rodolfo516 49625
[21:25] Caracol}Elocuente Tri.10020 Geografiaɓebosin˿Akqu郰1kpa�01zperteneceklagislagdekCos?k?k [21:25] Caracol}Elocuente
Tri.10020 Geografiaɓebosin˿Akqu郰1kpa�01zperteneceklagislagdekCos?k?k
[21:25] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 23915 Puntos [21:25] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 23915 Puntos
[21:26] Caracol}Elocuente 2 Pista: gre*** 30 segundos y 23915 Puntos [21:26] Caracol}Elocuente
2 Pista: gre*** 30 segundos y 23915 Puntos
[21:26] Anguila{Agil .kiss Grillo{Naranja [21:26] Anguila{Agil
.kiss Grillo{Naranja
[21:26] Anguila{Agil ACTION Grillo{Naranja muassssssssssssssssssssss sssssssssssssssssssssssssssssssssssssssssssss sssssssssssssssssssssssssssssssssssssssssssssssssssssss ssssssssssssssssssssssssssssssssssssssss. [21:26] Anguila{Agil
ACTION Grillo{Naranja muassssssssssssssssssssss sssssssssssssssssssssssssssssssssssssssssssss sssssssssssssssssssssssssssssssssssssssssssssssssssssss ssssssssssssssssssssssssssssssssssssssss.
[21:26] LeonBrillante grecia [21:26] LeonBrillante
grecia
[21:26] Caracol}Elocuente �Absolutamente correcto LeonBrillante!! Acertaste "grecia" en �5.828 segundos y ganas �3915�12 puntos [21:26] Caracol}Elocuente
�Absolutamente correcto LeonBrillante!! Acertaste "grecia" en �5.828 segundos y ganas �3915�12 puntos
[21:26] Caracol}Elocuente ACTION awards LeonBrillante with a +v for having over 15000 points [21:26] Caracol}Elocuente
ACTION awards LeonBrillante with a +v for having over 15000 points
[21:26] Caracol}Elocuente LeonBrillante has acertado 2 seguidas!! Puntos HOY: 59328, SEMANA: 59328 y MES: 59328 [21:26] Caracol}Elocuente
LeonBrillante has acertado 2 seguidas!! Puntos HOY: 59328, SEMANA: 59328 y MES: 59328
[21:26] Caracol}Elocuente R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206 [21:26] Caracol}Elocuente
R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206
[21:26] Caracol}Elocuente Tri.20706 Cotilleo-TVɃarPEnTer˿(LosrSimpson-5ʃ01dtemporada)dQu郰1dtresrpersonajesrintervienensensunamescenamenslosrconductosrdegventilaci󮃰1squegparodiamamAliensenselgepisodion"Lamcanci󮃰1srudamdelgdulcegSeymourcSkinner"d?d [21:26] Caracol}Elocuente
Tri.20706 Cotilleo-TVɃarPEnTer˿(LosrSimpson-5ʃ01dtemporada)dQu郰1dtresrpersonajesrintervienensensunamescenamenslosrconductosrdegventilaci󮃰1squegparodiamamAliensenselgepisodion"Lamcanci󮃰1srudamdelgdulcegSeymourcSkinner"d?d
[21:26] Caracol}Elocuente 1 Pista: ****** ******* * ******** ** ***** ***** Valor pregunta : 23658 Puntos [21:26] Caracol}Elocuente
1 Pista: ****** ******* * ******** ** ***** ***** Valor pregunta : 23658 Puntos
[21:26] Caracol}Elocuente 2 Pista: wil*** ******* * ******** ** ***** ***** 30 segundos y 23658 Puntos [21:26] Caracol}Elocuente
2 Pista: wil*** ******* * ******** ** ***** ***** 30 segundos y 23658 Puntos
[21:27] Caracol}Elocuente 3 Pista: wil*ie **i**e* * a**e**i* *e *a**a **au* 15 segundos y 23658 Puntos [21:27] Caracol}Elocuente
3 Pista: wil*ie **i**e* * a**e**i* *e *a**a **au* 15 segundos y 23658 Puntos
[21:27] Caracol}Elocuente Tiempo! La respuesta es -> willie�kinner��prendiz�e�anta�laus <- [21:27] Caracol}Elocuente
Tiempo! La respuesta es -> willie�kinner��prendiz�e�anta�laus <-
[21:27] Caracol}Elocuente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [21:27] Caracol}Elocuente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[21:27] Caracol}Elocuente Tri.2025 Fisica-Quimicaɳtephenwo˿Compuestozqu�cozquepdisueltozenzaguaeproducepionesidephidr󧥮o?i?i [21:27] Caracol}Elocuente
Tri.2025 Fisica-Quimicaɳtephenwo˿Compuestozqu�cozquepdisueltozenzaguaeproducepionesidephidr󧥮o?i?i
[21:27] Caracol}Elocuente 1 Pista: ***** Valor pregunta : 7453 Puntos [21:27] Caracol}Elocuente
1 Pista: ***** Valor pregunta : 7453 Puntos
[21:27] Caracol}Elocuente 2 Pista: aci** 30 segundos y 7453 Puntos [21:27] Caracol}Elocuente
2 Pista: aci** 30 segundos y 7453 Puntos
[21:27] Caracol}Elocuente 3 Pista: aci*o 15 segundos y 7453 Puntos [21:27] Caracol}Elocuente
3 Pista: aci*o 15 segundos y 7453 Puntos
[21:28] Caracol}Elocuente Tiempo! La respuesta es -> acido <- [21:28] Caracol}Elocuente
Tiempo! La respuesta es -> acido <-
[21:28] Caiman_Enorme acido [21:28] Caiman_Enorme
acido
[21:28] Caracol}Elocuente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [21:28] Caracol}Elocuente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[21:28] Caracol}Elocuente Tri.20245 Arteɰendejo˿DEcQUIeNcEScELcCUADROc"ELcPRENDIMIENTO"(APELLIDO)"c?c [21:28] Caracol}Elocuente
Tri.20245 Arteɰendejo˿DEcQUIeNcEScELcCUADROc"ELcPRENDIMIENTO"(APELLIDO)"c?c
[21:28] Caracol}Elocuente 1 Pista: *** **** Valor pregunta : 16466 Puntos [21:28] Caracol}Elocuente
1 Pista: *** **** Valor pregunta : 16466 Puntos
[21:28] Caracol}Elocuente 2 Pista: van **** 30 segundos y 16466 Puntos [21:28] Caracol}Elocuente
2 Pista: van **** 30 segundos y 16466 Puntos
[21:28] Caracol}Elocuente 3 Pista: van **** 15 segundos y 16466 Puntos [21:28] Caracol}Elocuente
3 Pista: van **** 15 segundos y 16466 Puntos
[21:29] Caracol}Elocuente Tiempo! La respuesta es -> van�yck <- [21:29] Caracol}Elocuente
Tiempo! La respuesta es -> van�yck <-
[21:29] Caracol}Elocuente R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1223857 #5: siva- 692906 #6: Caiman_Enorme 685511 #7: Ketzy 610145 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481 [21:29] Caracol}Elocuente
R᮫ing SEMANA: - #1: Grillo{Naranja 3621371 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1223857 #5: siva- 692906 #6: Caiman_Enorme 685511 #7: Ketzy 610145 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481
[21:29] Caracol}Elocuente Tri.17218 Literaturaɭartuniki˿AjQUEjNOVELAjPERTENECEjELjCERDOj"NAPOLEӎ"j?j [21:29] Caracol}Elocuente
Tri.17218 Literaturaɭartuniki˿AjQUEjNOVELAjPERTENECEjELjCERDOj"NAPOLEӎ"j?j
[21:29] Caracol}Elocuente 1 Pista: ******** ** ** ****** Valor pregunta : 22678 Puntos [21:29] Caracol}Elocuente
1 Pista: ******** ** ** ****** Valor pregunta : 22678 Puntos
[21:29] Caracol}Elocuente 2 Pista: reb***** ** ** ****** 30 segundos y 22678 Puntos [21:29] Caracol}Elocuente
2 Pista: reb***** ** ** ****** 30 segundos y 22678 Puntos
[21:29] Caracol}Elocuente 3 Pista: rebe*io* e* *a **a**a 15 segundos y 22678 Puntos [21:29] Caracol}Elocuente
3 Pista: rebe*io* e* *a **a**a 15 segundos y 22678 Puntos
[21:30] Caracol}Elocuente Tiempo! La respuesta es -> rebelion�n�a�ranja <- [21:30] Caracol}Elocuente
Tiempo! La respuesta es -> rebelion�n�a�ranja <-
[21:30] Caracol}Elocuente We feature over 50,000 Q&A ! [21:30] Caracol}Elocuente
We feature over 50,000 Q&A !
[21:30] Caracol}Elocuente Tri.16632 HistoriaɊAVEA˿25-5-11:QUExDICTADORxMEXICANOxDESPUESxDEx31xAяSxDExPODERxABANDONAxLAxPRESIDENCIAxDExMEXICOx?x [21:30] Caracol}Elocuente
Tri.16632 HistoriaɊAVEA˿25-5-11:QUExDICTADORxMEXICANOxDESPUESxDEx31xAяSxDExPODERxABANDONAxLAxPRESIDENCIAxDExMEXICOx?x
[21:30] Caracol}Elocuente 1 Pista: ******** **** Valor pregunta : 6132 Puntos [21:30] Caracol}Elocuente
1 Pista: ******** **** Valor pregunta : 6132 Puntos
[21:30] Caracol}Elocuente 2 Pista: por***** **** 30 segundos y 6132 Puntos [21:30] Caracol}Elocuente
2 Pista: por***** **** 30 segundos y 6132 Puntos
[21:30] Caracol}Elocuente 3 Pista: por*i*io *ia* 15 segundos y 6132 Puntos [21:30] Caracol}Elocuente
3 Pista: por*i*io *ia* 15 segundos y 6132 Puntos
[21:30] Caracol}Elocuente Tiempo! La respuesta es -> porfirio�iaz <- [21:30] Caracol}Elocuente
Tiempo! La respuesta es -> porfirio�iaz <-
[21:31] Caracol}Elocuente R᮫ing de HOY: - #1: Jirafa\Letal 970106 #2: Gladiadora_del_Caribe 686734 #3: Caiman_Enorme 685511 #4: Grillo{Naranja 616922 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: LeonBrillante 59328 #9: Ketzy 38872 #10: Grillo-Locuaz 23731 [21:31] Caracol}Elocuente
R᮫ing de HOY: - #1: Jirafa\Letal 970106 #2: Gladiadora_del_Caribe 686734 #3: Caiman_Enorme 685511 #4: Grillo{Naranja 616922 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: LeonBrillante 59328 #9: Ketzy 38872 #10: Grillo-Locuaz 23731
[21:31] Caracol}Elocuente Tri.20195 GeografiaɁcuarios˿CUALaESaLAaTERCERAaCIUDADaESPA񏌁aENaCUANTOaNUMEROaDEaHABITANTESa?a [21:31] Caracol}Elocuente
Tri.20195 GeografiaɁcuarios˿CUALaESaLAaTERCERAaCIUDADaESPA񏌁aENaCUANTOaNUMEROaDEaHABITANTESa?a
[21:31] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 20991 Puntos [21:31] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 20991 Puntos
[21:31] Caracol}Elocuente 2 Pista: val***** 30 segundos y 20991 Puntos [21:31] Caracol}Elocuente
2 Pista: val***** 30 segundos y 20991 Puntos
[21:31] Caracol}Elocuente 3 Pista: vale**ia 15 segundos y 20991 Puntos [21:31] Caracol}Elocuente
3 Pista: vale**ia 15 segundos y 20991 Puntos
[21:31] Caracol}Elocuente Tiempo! La respuesta es -> valencia <- [21:31] Caracol}Elocuente
Tiempo! La respuesta es -> valencia <-
[21:32] Caracol}Elocuente Tri.3901 Economiaɐsico666˔rasnacionalxquetademasydetinventartelxDDTlyylasyaspirinasyfabricorgasyletalxparavHitler...l?l [21:32] Caracol}Elocuente
Tri.3901 Economiaɐsico666˔rasnacionalxquetademasydetinventartelxDDTlyylasyaspirinasyfabricorgasyletalxparavHitler...l?l
[21:32] Caracol}Elocuente 1 Pista: ***** Pregunta de BONUS : 25000 Puntos [21:32] Caracol}Elocuente
1 Pista: ***** Pregunta de BONUS : 25000 Puntos
[21:32] Caracol}Elocuente 2 Pista: bay** 30 segundos y 25000 Puntos [21:32] Caracol}Elocuente
2 Pista: bay** 30 segundos y 25000 Puntos
[21:32] Caracol}Elocuente 3 Pista: baye* 15 segundos y 25000 Puntos [21:32] Caracol}Elocuente
3 Pista: baye* 15 segundos y 25000 Puntos
[21:32] Caracol}Elocuente Tiempo! La respuesta es -> bayer <- [21:32] Caracol}Elocuente
Tiempo! La respuesta es -> bayer <-
[21:33] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [21:33] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[21:33] Caracol}Elocuente Tri.4559 Arteɣreek˿Arquitectobypescultorgitaliano,squeuconstruy󃰱sendFlorenciaselkpalaciobPittiv?s [21:33] Caracol}Elocuente
Tri.4559 Arteɣreek˿Arquitectobypescultorgitaliano,squeuconstruy󃰱sendFlorenciaselkpalaciobPittiv?s
[21:33] Caracol}Elocuente 1 Pista: ************ Valor pregunta : 20614 Puntos [21:33] Caracol}Elocuente
1 Pista: ************ Valor pregunta : 20614 Puntos
[21:33] Caracol}Elocuente 2 Pista: bru********* 30 segundos y 20614 Puntos [21:33] Caracol}Elocuente
2 Pista: bru********* 30 segundos y 20614 Puntos
[21:33] Caracol}Elocuente 3 Pista: bru*e**e***i 15 segundos y 20614 Puntos [21:33] Caracol}Elocuente
3 Pista: bru*e**e***i 15 segundos y 20614 Puntos
[21:33] Caracol}Elocuente Tiempo! La respuesta es -> brunelleschi <- [21:33] Caracol}Elocuente
Tiempo! La respuesta es -> brunelleschi <-
[21:33] Elefante-Suave missmaxis de donde te comunicas [21:33] Elefante-Suave
missmaxis de donde te comunicas
[21:33] Caracol}Elocuente R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414 [21:33] Caracol}Elocuente
R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414
[21:33] Caracol}Elocuente Tri.17544 Literaturaɭeji˿Autoridew"cromosomaf6"w?w [21:33] Caracol}Elocuente
Tri.17544 Literaturaɭeji˿Autoridew"cromosomaf6"w?w
[21:33] Caracol}Elocuente 1 Pista: ***** **** Valor pregunta : 11005 Puntos [21:33] Caracol}Elocuente
1 Pista: ***** **** Valor pregunta : 11005 Puntos
[21:34] Caracol}Elocuente 2 Pista: rob** **** 30 segundos y 11005 Puntos [21:34] Caracol}Elocuente
2 Pista: rob** **** 30 segundos y 11005 Puntos
[21:34] Caracol}Elocuente 3 Pista: robi* *oo* 15 segundos y 11005 Puntos [21:34] Caracol}Elocuente
3 Pista: robi* *oo* 15 segundos y 11005 Puntos
[21:34] Caracol}Elocuente Tiempo! La respuesta es -> robin�ook <- [21:34] Caracol}Elocuente
Tiempo! La respuesta es -> robin�ook <-
[21:34] Caracol}Elocuente If you think a Q&A is wrong, please call an OP [21:34] Caracol}Elocuente
If you think a Q&A is wrong, please call an OP
[21:34] Caracol}Elocuente Tri.10002 InformaticaɞLorien^˿(OpenGL)eQuezsignificanwlasgsiglasgGLUTe?e [21:34] Caracol}Elocuente
Tri.10002 InformaticaɞLorien^˿(OpenGL)eQuezsignificanwlasgsiglasgGLUTe?e
[21:34] Caracol}Elocuente 1 Pista: ******* ******** ********* ******* Valor pregunta : 10657 Puntos [21:34] Caracol}Elocuente
1 Pista: ******* ******** ********* ******* Valor pregunta : 10657 Puntos
[21:35] Caracol}Elocuente 2 Pista: gra**** ******** ********* ******* 30 segundos y 10657 Puntos [21:35] Caracol}Elocuente
2 Pista: gra**** ******** ********* ******* 30 segundos y 10657 Puntos
[21:35] Caracol}Elocuente 3 Pista: gra**i* *a**ua*e u*i*i*ie* *oo**i* 15 segundos y 10657 Puntos [21:35] Caracol}Elocuente
3 Pista: gra**i* *a**ua*e u*i*i*ie* *oo**i* 15 segundos y 10657 Puntos
[21:35] Caracol}Elocuente Tiempo! La respuesta es -> graphic�anguage�tilities�oolkit <- [21:35] Caracol}Elocuente
Tiempo! La respuesta es -> graphic�anguage�tilities�oolkit <-
[21:35] Caracol}Elocuente R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087 [21:35] Caracol}Elocuente
R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087
[21:35] Caracol}Elocuente Tri.17030 CineɔeLaRaNhA˿Frasesjdedpel�la:v-"ߑuieresjsergvenerado?vVetedajlajIndiajybmuge."v?v [21:35] Caracol}Elocuente
Tri.17030 CineɔeLaRaNhA˿Frasesjdedpel�la:v-"ߑuieresjsergvenerado?vVetedajlajIndiajybmuge."v?v
[21:35] Caracol}Elocuente 1 Pista: **** **** Pregunta de BONUS : 25000 Puntos [21:35] Caracol}Elocuente
1 Pista: **** **** Pregunta de BONUS : 25000 Puntos
[21:36] Caracol}Elocuente 2 Pista: qui* **** 30 segundos y 25000 Puntos [21:36] Caracol}Elocuente
2 Pista: qui* **** 30 segundos y 25000 Puntos
[21:36] CaballitoDeMar-Respetable ¦ Emitiendo ( Anguila{Agil ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [21:36] CaballitoDeMar-Respetable
¦ Emitiendo ( Anguila{Agil ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[21:36] Caracol}Elocuente 3 Pista: qui* **o* 15 segundos y 25000 Puntos [21:36] Caracol}Elocuente
3 Pista: qui* **o* 15 segundos y 25000 Puntos
[21:36] Caracol}Elocuente Tiempo! La respuesta es -> quiz�how <- [21:36] Caracol}Elocuente
Tiempo! La respuesta es -> quiz�how <-
[21:36] Caracol}Elocuente For The Competitive Edge type !pingme [21:36] Caracol}Elocuente
For The Competitive Edge type !pingme
[21:36] Caracol}Elocuente Tri.12170 DeporteɔDI˿CUALsFUEsELsULTIMOsPARTIDOsOFICIALsDEsRICARDOsZAMORAsCONsELsREALsMADRIDs?s [21:36] Caracol}Elocuente
Tri.12170 DeporteɔDI˿CUALsFUEsELsULTIMOsPARTIDOsOFICIALsDEsRICARDOsZAMORAsCONsELsREALsMADRIDs?s
[21:36] Caracol}Elocuente 1 Pista: ** ***** ** **** *** ** Valor pregunta : 20393 Puntos [21:36] Caracol}Elocuente
1 Pista: ** ***** ** **** *** ** Valor pregunta : 20393 Puntos
[21:36] Caracol}Elocuente 2 Pista: la�**** ** **** *** ** 30 segundos y 20393 Puntos [21:36] Caracol}Elocuente
2 Pista: la�**** ** **** *** ** 30 segundos y 20393 Puntos
[21:37] Caracol}Elocuente 3 Pista: la�i*a* *e *o*a *e* ** 15 segundos y 20393 Puntos [21:37] Caracol}Elocuente
3 Pista: la�i*a* *e *o*a *e* ** 15 segundos y 20393 Puntos
[21:37] Caracol}Elocuente Tiempo! La respuesta es -> la�inal�e�opa�el�6 <- [21:37] Caracol}Elocuente
Tiempo! La respuesta es -> la�inal�e�opa�el�6 <-
[21:37] Caracol}Elocuente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [21:37] Caracol}Elocuente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[21:37] Caracol}Elocuente Tri.14329 Idiomasɓebosin˿Diccionario-sonartlaslnarices?q?q [21:37] Caracol}Elocuente
Tri.14329 Idiomasɓebosin˿Diccionario-sonartlaslnarices?q?q
[21:37] Caracol}Elocuente 1 Pista: ***** Valor pregunta : 24352 Puntos [21:37] Caracol}Elocuente
1 Pista: ***** Valor pregunta : 24352 Puntos
[21:37] Caracol}Elocuente 2 Pista: moc** 30 segundos y 24352 Puntos [21:37] Caracol}Elocuente
2 Pista: moc** 30 segundos y 24352 Puntos
[21:38] Caracol}Elocuente 3 Pista: moca* 15 segundos y 24352 Puntos [21:38] Caracol}Elocuente
3 Pista: moca* 15 segundos y 24352 Puntos
[21:38] Caracol}Elocuente Tiempo! La respuesta es -> mocar <- [21:38] Caracol}Elocuente
Tiempo! La respuesta es -> mocar <-
[21:38] Caracol}Elocuente R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2341984 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 685511 [21:38] Caracol}Elocuente
R᮫ing MES: - #1: Grillo{Naranja 14836528 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2341984 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 685511
[21:38] Caracol}Elocuente Tri.19923 Miscelaneaɭeji˿Eresymasyfeomquehprosineckyamontadomendund....t?t [21:38] Caracol}Elocuente
Tri.19923 Miscelaneaɭeji˿Eresymasyfeomquehprosineckyamontadomendund....t?t
[21:38] Caracol}Elocuente 1 Pista: ****** Pregunta de BONUS : 25000 Puntos [21:38] Caracol}Elocuente
1 Pista: ****** Pregunta de BONUS : 25000 Puntos
[21:38] Caracol}Elocuente 2 Pista: twi*** 30 segundos y 25000 Puntos [21:38] Caracol}Elocuente
2 Pista: twi*** 30 segundos y 25000 Puntos
[21:39] Caracol}Elocuente 3 Pista: twi**o 15 segundos y 25000 Puntos [21:39] Caracol}Elocuente
3 Pista: twi**o 15 segundos y 25000 Puntos
[21:39] Caracol}Elocuente Tiempo! La respuesta es -> twingo <- [21:39] Caracol}Elocuente
Tiempo! La respuesta es -> twingo <-
[21:39] Caracol}Elocuente Please refrain from using Extreme Bad Language [21:39] Caracol}Elocuente
Please refrain from using Extreme Bad Language
[21:39] Caracol}Elocuente Tri.17002 LiteraturaɂRUJI˿CELEBREtOBRAtDEtSPENCERtJOHNSONtQUEtREPITENtLOStTRIVIALEROSt?t [21:39] Caracol}Elocuente
Tri.17002 LiteraturaɂRUJI˿CELEBREtOBRAtDEtSPENCERtJOHNSONtQUEtREPITENtLOStTRIVIALEROSt?t
[21:39] Caracol}Elocuente 1 Pista: ***** ** ** ******* ** ***** Valor pregunta : 11996 Puntos [21:39] Caracol}Elocuente
1 Pista: ***** ** ** ******* ** ***** Valor pregunta : 11996 Puntos
[21:39] Caracol}Elocuente 2 Pista: qui** ** ** ******* ** ***** 30 segundos y 11996 Puntos [21:39] Caracol}Elocuente
2 Pista: qui** ** ** ******* ** ***** 30 segundos y 11996 Puntos
[21:39] Caracol}Elocuente 3 Pista: quie* *e *a **e*a*o *i *ue*o 15 segundos y 11996 Puntos [21:39] Caracol}Elocuente
3 Pista: quie* *e *a **e*a*o *i *ue*o 15 segundos y 11996 Puntos
[21:40] Caracol}Elocuente Tiempo! La respuesta es -> quien�e�a�levado�i�ueso <- [21:40] Caracol}Elocuente
Tiempo! La respuesta es -> quien�e�a�levado�i�ueso <-
[21:40] Caracol}Elocuente This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente [21:40] Caracol}Elocuente
This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente
[21:40] Caracol}Elocuente Tri.5924 Biologiaɳica˿DElTODOSlLOSlREPTILESlQUElEXISTENlENlLAlACTUALIDADlCUALlESlELlQUElMASlSElPARECElALlDINOSAURIOlES..l?l [21:40] Caracol}Elocuente
Tri.5924 Biologiaɳica˿DElTODOSlLOSlREPTILESlQUElEXISTENlENlLAlACTUALIDADlCUALlESlELlQUElMASlSElPARECElALlDINOSAURIOlES..l?l
[21:40] Caracol}Elocuente 1 Pista: ********* Valor pregunta : 21661 Puntos [21:40] Caracol}Elocuente
1 Pista: ********* Valor pregunta : 21661 Puntos
[21:40] Caracol}Elocuente 2 Pista: coc****** 30 segundos y 21661 Puntos [21:40] Caracol}Elocuente
2 Pista: coc****** 30 segundos y 21661 Puntos
[21:40] Caracol}Elocuente 3 Pista: coco**i*o 15 segundos y 21661 Puntos [21:40] Caracol}Elocuente
3 Pista: coco**i*o 15 segundos y 21661 Puntos
[21:41] Grillo{Naranja cocodrilo [21:41] Grillo{Naranja
cocodrilo
[21:41] Caracol}Elocuente �Enhorabuena Grillo{Naranja!! Has contestado "cocodrilo" y por ello has ganado �1661�12 puntos [21:41] Caracol}Elocuente
�Enhorabuena Grillo{Naranja!! Has contestado "cocodrilo" y por ello has ganado �1661�12 puntos
[21:41] Caracol}Elocuente Grillo{Naranja has acertado 1 seguidas!! Puntos HOY: 638583, SEMANA: 3643032 y MES: 14858189 [21:41] Caracol}Elocuente
Grillo{Naranja has acertado 1 seguidas!! Puntos HOY: 638583, SEMANA: 3643032 y MES: 14858189
[21:41] Caracol}Elocuente This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeonBrillante 59328 #14: Grillo-Locuaz 23731 #15: LeCaTwaLk_z 19830 #16: FANTASMAMEXICO 5048 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [21:41] Caracol}Elocuente
This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeonBrillante 59328 #14: Grillo-Locuaz 23731 #15: LeCaTwaLk_z 19830 #16: FANTASMAMEXICO 5048 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[21:41] Caracol}Elocuente Tri.884 GastronomiaɌuik˿DEsQUEsCOMUNDADsAUTONOMAsESsLAsDENOMINACIONsDEsORIGENs"JEREZ"s?s [21:41] Caracol}Elocuente
Tri.884 GastronomiaɌuik˿DEsQUEsCOMUNDADsAUTONOMAsESsLAsDENOMINACIONsDEsORIGENs"JEREZ"s?s
[21:41] Caracol}Elocuente 1 Pista: ********* Valor pregunta : 12082 Puntos [21:41] Caracol}Elocuente
1 Pista: ********* Valor pregunta : 12082 Puntos
[21:41] Caracol}Elocuente 2 Pista: And****** 30 segundos y 12082 Puntos [21:41] Caracol}Elocuente
2 Pista: And****** 30 segundos y 12082 Puntos
[21:41] Grillo{Naranja andalucia [21:41] Grillo{Naranja
andalucia
[21:41] Caracol}Elocuente �Muy bien Grillo{Naranja!! Acertaste "andalucia" en tan s󬯠�5.187 segundos y por eso has ganado: �2082�12 puntos [21:41] Caracol}Elocuente
�Muy bien Grillo{Naranja!! Acertaste "andalucia" en tan s󬯠�5.187 segundos y por eso has ganado: �2082�12 puntos
[21:41] Caracol}Elocuente Grillo{Naranja has acertado 2 seguidas!! Puntos HOY: 650665, SEMANA: 3655114 y MES: 14870271 [21:41] Caracol}Elocuente
Grillo{Naranja has acertado 2 seguidas!! Puntos HOY: 650665, SEMANA: 3655114 y MES: 14870271
[21:41] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [21:41] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[21:41] Caracol}Elocuente Tri.12661 PoliticaɁntiquo˿Cuᬃ01gesvlaaleyzbᳩcaaprocesalgespa񯬡a?y [21:41] Caracol}Elocuente
Tri.12661 PoliticaɁntiquo˿Cuᬃ01gesvlaaleyzbᳩcaaprocesalgespa񯬡a?y
[21:41] Caracol}Elocuente 1 Pista: *** ******** *** ***** ******** Valor pregunta : 15162 Puntos [21:41] Caracol}Elocuente
1 Pista: *** ******** *** ***** ******** Valor pregunta : 15162 Puntos
[21:41] Caracol}Elocuente 2 Pista: ley ******** *** ***** ******** 30 segundos y 15162 Puntos [21:41] Caracol}Elocuente
2 Pista: ley ******** *** ***** ******** 30 segundos y 15162 Puntos
[21:42] Caracol}Elocuente 3 Pista: ley o**a*i*a *e* *o*e* *u*i*ia* 15 segundos y 15162 Puntos [21:42] Caracol}Elocuente
3 Pista: ley o**a*i*a *e* *o*e* *u*i*ia* 15 segundos y 15162 Puntos
[21:42] Caracol}Elocuente Tiempo! La respuesta es -> ley�rganica�el�oder�udicial <- [21:42] Caracol}Elocuente
Tiempo! La respuesta es -> ley�rganica�el�oder�udicial <-
[21:42] Caracol}Elocuente This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: LeonBrillante 59328 [21:42] Caracol}Elocuente
This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: LeonBrillante 59328
[21:42] Caracol}Elocuente Tri.6561 Cotilleo-TVɚytox˿Denquennacionalidadoeskelwex-maridovdenIsabelwGemiov?n [21:42] Caracol}Elocuente
Tri.6561 Cotilleo-TVɚytox˿Denquennacionalidadoeskelwex-maridovdenIsabelwGemiov?n
[21:42] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 10786 Puntos [21:42] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 10786 Puntos
[21:42] Grillo{Naranja cubano [21:42] Grillo{Naranja
cubano
[21:42] Caracol}Elocuente �Suma y sigue Grillo{Naranja!! La respuesta: "cubano" incrementa tu marcador en �0786�12 puntos [21:42] Caracol}Elocuente
�Suma y sigue Grillo{Naranja!! La respuesta: "cubano" incrementa tu marcador en �0786�12 puntos
[21:42] Caracol}Elocuente Grillo{Naranja has acertado 3 seguidas!! Puntos HOY: 661451, SEMANA: 3665900 y MES: 14881057 [21:42] Caracol}Elocuente
Grillo{Naranja has acertado 3 seguidas!! Puntos HOY: 661451, SEMANA: 3665900 y MES: 14881057
[21:42] Caracol}Elocuente R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206 [21:42] Caracol}Elocuente
R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206
[21:42] Caracol}Elocuente Tri.14226 DeporteɔeLaRaNhA˿Futbol:tCampeoncdelsupercopaaeuropeaa2003-2004t?t [21:42] Caracol}Elocuente
Tri.14226 DeporteɔeLaRaNhA˿Futbol:tCampeoncdelsupercopaaeuropeaa2003-2004t?t
[21:42] Caracol}Elocuente 1 Pista: ***** Valor pregunta : 6361 Puntos [21:42] Caracol}Elocuente
1 Pista: ***** Valor pregunta : 6361 Puntos
[21:43] Caracol}Elocuente 2 Pista: mil** 30 segundos y 6361 Puntos [21:43] Caracol}Elocuente
2 Pista: mil** 30 segundos y 6361 Puntos
[21:43] Grillo{Naranja milan [21:43] Grillo{Naranja
milan
[21:43] Caracol}Elocuente �Grillo{Naranja acert󡡠La respuesta era: "milan" y contest󠥮 �9.313 segundos. Se lleva: �361�12 puntos [21:43] Caracol}Elocuente
�Grillo{Naranja acert󡡠La respuesta era: "milan" y contest󠥮 �9.313 segundos. Se lleva: �361�12 puntos
[21:43] Caracol}Elocuente Grillo{Naranja has acertado 4 seguidas!! Puntos HOY: 667812, SEMANA: 3672261 y MES: 14887418 [21:43] Caracol}Elocuente
Grillo{Naranja has acertado 4 seguidas!! Puntos HOY: 667812, SEMANA: 3672261 y MES: 14887418
[21:43] Caracol}Elocuente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [21:43] Caracol}Elocuente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[21:43] Caracol}Elocuente Tri.16073 LiteraturaɔeLaRaNhA˿Autorkden"razonjdenamor"f?f [21:43] Caracol}Elocuente
Tri.16073 LiteraturaɔeLaRaNhA˿Autorkden"razonjdenamor"f?f
[21:43] Caracol}Elocuente 1 Pista: ***** ******* Valor pregunta : 18424 Puntos [21:43] Caracol}Elocuente
1 Pista: ***** ******* Valor pregunta : 18424 Puntos
[21:43] Caracol}Elocuente 2 Pista: ped** ******* 30 segundos y 18424 Puntos [21:43] Caracol}Elocuente
2 Pista: ped** ******* 30 segundos y 18424 Puntos
[21:43] Caracol}Elocuente 3 Pista: ped*o *a*i*a* 15 segundos y 18424 Puntos [21:43] Caracol}Elocuente
3 Pista: ped*o *a*i*a* 15 segundos y 18424 Puntos
[21:44] Caracol}Elocuente Tiempo! La respuesta es -> pedro�alinas <- [21:44] Caracol}Elocuente
Tiempo! La respuesta es -> pedro�alinas <-
[21:44] Caracol}Elocuente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [21:44] Caracol}Elocuente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[21:44] Caracol}Elocuente Tri.5493 Cineɥrboni˿GUIONISTAhYhPROTAGONISTAhMASCULINOhDEh"FIELMENTEhTUYA"h?h [21:44] Caracol}Elocuente
Tri.5493 Cineɥrboni˿GUIONISTAhYhPROTAGONISTAhMASCULINOhDEh"FIELMENTEhTUYA"h?h
[21:44] Caracol}Elocuente 1 Pista: ***** ********** Valor pregunta : 5538 Puntos [21:44] Caracol}Elocuente
1 Pista: ***** ********** Valor pregunta : 5538 Puntos
[21:44] Caracol}Elocuente 2 Pista: cha** ********** 30 segundos y 5538 Puntos [21:44] Caracol}Elocuente
2 Pista: cha** ********** 30 segundos y 5538 Puntos
[21:44] Caracol}Elocuente 3 Pista: cha** *a**i**e*i 15 segundos y 5538 Puntos [21:44] Caracol}Elocuente
3 Pista: cha** *a**i**e*i 15 segundos y 5538 Puntos
[21:45] Caracol}Elocuente Tiempo! La respuesta es -> chazz�alminteri <- [21:45] Caracol}Elocuente
Tiempo! La respuesta es -> chazz�alminteri <-
[21:45] Caracol}Elocuente R᮫ing SEMANA: - #1: Grillo{Naranja 3672261 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1223857 #5: siva- 692906 #6: Caiman_Enorme 685511 #7: Ketzy 610145 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481 [21:45] Caracol}Elocuente
R᮫ing SEMANA: - #1: Grillo{Naranja 3672261 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1223857 #5: siva- 692906 #6: Caiman_Enorme 685511 #7: Ketzy 610145 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481
[21:45] Caracol}Elocuente Tri.7058 Miscelaneaɐsico666˱uezfestividadwsezcelebraeenkM鸩cozelw1mdeznoviembre?m?m [21:45] Caracol}Elocuente
Tri.7058 Miscelaneaɐsico666˱uezfestividadwsezcelebraeenkM鸩cozelw1mdeznoviembre?m?m
[21:45] Caracol}Elocuente 1 Pista: *** ** ******* Valor pregunta : 18335 Puntos [21:45] Caracol}Elocuente
1 Pista: *** ** ******* Valor pregunta : 18335 Puntos
[21:45] Caracol}Elocuente 2 Pista: dia ** ******* 30 segundos y 18335 Puntos [21:45] Caracol}Elocuente
2 Pista: dia ** ******* 30 segundos y 18335 Puntos
[21:45] Caracol}Elocuente 3 Pista: dia *e *ue**o* 15 segundos y 18335 Puntos [21:45] Caracol}Elocuente
3 Pista: dia *e *ue**o* 15 segundos y 18335 Puntos
[21:45] Grillo{Naranja dia de muertos [21:45] Grillo{Naranja
dia de muertos
[21:45] Caracol}Elocuente �Enhorabuena Grillo{Naranja!! Has contestado "dia de muertos" y por ello has ganado �8335�12 puntos [21:45] Caracol}Elocuente
�Enhorabuena Grillo{Naranja!! Has contestado "dia de muertos" y por ello has ganado �8335�12 puntos
[21:45] Caracol}Elocuente Grillo{Naranja has acertado 5 seguidas!! Puntos HOY: 686147, SEMANA: 3690596 y MES: 14905753 [21:45] Caracol}Elocuente
Grillo{Naranja has acertado 5 seguidas!! Puntos HOY: 686147, SEMANA: 3690596 y MES: 14905753
[21:46] Caracol}Elocuente We feature over 50,000 Q&A ! [21:46] Caracol}Elocuente
We feature over 50,000 Q&A !
[21:46] Caracol}Elocuente Tri.14831 Medicina-SaludɎisko˿Cualesasonjlosalinfocitosamasaabundantesa?m [21:46] Caracol}Elocuente
Tri.14831 Medicina-SaludɎisko˿Cualesasonjlosalinfocitosamasaabundantesa?m
[21:46] Caracol}Elocuente 1 Pista: *********** Valor pregunta : 17751 Puntos [21:46] Caracol}Elocuente
1 Pista: *********** Valor pregunta : 17751 Puntos
[21:46] Caracol}Elocuente 2 Pista: neu******** 30 segundos y 17751 Puntos [21:46] Caracol}Elocuente
2 Pista: neu******** 30 segundos y 17751 Puntos
[21:46] Caracol}Elocuente 3 Pista: neu**o*i*o* 15 segundos y 17751 Puntos [21:46] Caracol}Elocuente
3 Pista: neu**o*i*o* 15 segundos y 17751 Puntos
[21:46] Caracol}Elocuente Tiempo! La respuesta es -> neutrofilos <- [21:46] Caracol}Elocuente
Tiempo! La respuesta es -> neutrofilos <-
[21:47] Caracol}Elocuente R᮫ing de HOY: - #1: Jirafa\Letal 970106 #2: Gladiadora_del_Caribe 686734 #3: Grillo{Naranja 686147 #4: Caiman_Enorme 685511 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: LeonBrillante 59328 #9: Ketzy 38872 #10: Grillo-Locuaz 23731 [21:47] Caracol}Elocuente
R᮫ing de HOY: - #1: Jirafa\Letal 970106 #2: Gladiadora_del_Caribe 686734 #3: Grillo{Naranja 686147 #4: Caiman_Enorme 685511 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: LeonBrillante 59328 #9: Ketzy 38872 #10: Grillo-Locuaz 23731
[21:47] Caracol}Elocuente Tri.7971 Cotilleo-TVɃarPEnTer˿(LoseSimpson)lAlqu郰1lescuadr󮃰1mpertenec�,lentrebotros,lAbebSimpson,lMontyqBurnseyqelncaboqGumbleb(elnpadrebdebBarney)l?l [21:47] Caracol}Elocuente
Tri.7971 Cotilleo-TVɃarPEnTer˿(LoseSimpson)lAlqu郰1lescuadr󮃰1mpertenec�,lentrebotros,lAbebSimpson,lMontyqBurnseyqelncaboqGumbleb(elnpadrebdebBarney)l?l
[21:47] Caracol}Elocuente 1 Pista: ** *** ******* Valor pregunta : 13135 Puntos [21:47] Caracol}Elocuente
1 Pista: ** *** ******* Valor pregunta : 13135 Puntos
[21:47] Caracol}Elocuente 2 Pista: el�** ******* 30 segundos y 13135 Puntos [21:47] Caracol}Elocuente
2 Pista: el�** ******* 30 segundos y 13135 Puntos
[21:47] Caracol}Elocuente 3 Pista: el�e* *o*a*o* 15 segundos y 13135 Puntos [21:47] Caracol}Elocuente
3 Pista: el�e* *o*a*o* 15 segundos y 13135 Puntos
[21:47] Caracol}Elocuente Tiempo! La respuesta es -> el�ez�olador <- [21:47] Caracol}Elocuente
Tiempo! La respuesta es -> el�ez�olador <-
[21:47] Caracol}Elocuente Tri.7410 LiteraturaɃarPEnTer˿(ElvSe񯲃01adeslosdAnillos)qCompleta:q"EnglavTierravdesMordor,q..."q?q [21:47] Caracol}Elocuente
Tri.7410 LiteraturaɃarPEnTer˿(ElvSe񯲃01adeslosdAnillos)qCompleta:q"EnglavTierravdesMordor,q..."q?q
[21:47] Caracol}Elocuente 1 Pista: ***** ** ********* *** ******* Valor pregunta : 12559 Puntos [21:47] Caracol}Elocuente
1 Pista: ***** ** ********* *** ******* Valor pregunta : 12559 Puntos
[21:48] Caracol}Elocuente 2 Pista: don** ** ********* *** ******* 30 segundos y 12559 Puntos [21:48] Caracol}Elocuente
2 Pista: don** ** ********* *** ******* 30 segundos y 12559 Puntos
[21:48] Caracol}Elocuente 3 Pista: don*e *e e**ie**e* *a* *o***a* 15 segundos y 12559 Puntos [21:48] Caracol}Elocuente
3 Pista: don*e *e e**ie**e* *a* *o***a* 15 segundos y 12559 Puntos
[21:48] Caracol}Elocuente Tiempo! La respuesta es -> donde�e�xtienden�as�ombras <- [21:48] Caracol}Elocuente
Tiempo! La respuesta es -> donde�e�xtienden�as�ombras <-
[21:48] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [21:48] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[21:48] Caracol}Elocuente Tri.10512 Medicina-Saludɚytox˿Dondexsexalmacenanjlasoproteinasoplasmaticasodexlarcoagulacionjenjelehombrex?x [21:48] Caracol}Elocuente
Tri.10512 Medicina-Saludɚytox˿Dondexsexalmacenanjlasoproteinasoplasmaticasodexlarcoagulacionjenjelehombrex?x
[21:48] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 17500 Puntos [21:48] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 17500 Puntos
[21:49] Caracol}Elocuente 2 Pista: hig*** 30 segundos y 17500 Puntos [21:49] Caracol}Elocuente
2 Pista: hig*** 30 segundos y 17500 Puntos
[21:49] Elefante-Suave higado [21:49] Elefante-Suave
higado
[21:49] Caracol}Elocuente �e nota que sabes mucho de esto Elefante-Suave! Tu respuesta "higado" es correcta y ganas �7500�12 puntos [21:49] Caracol}Elocuente
�e nota que sabes mucho de esto Elefante-Suave! Tu respuesta "higado" es correcta y ganas �7500�12 puntos
[21:49] Caracol}Elocuente ACTION awards Elefante-Suave with a +v for having over 15000 points [21:49] Caracol}Elocuente
ACTION awards Elefante-Suave with a +v for having over 15000 points
[21:49] Caracol}Elocuente Elefante-Suave has acertado 1 seguidas!! Puntos HOY: 987606, SEMANA: 1241357 y MES: 2359484 [21:49] Caracol}Elocuente
Elefante-Suave has acertado 1 seguidas!! Puntos HOY: 987606, SEMANA: 1241357 y MES: 2359484
[21:49] Caracol}Elocuente R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414 [21:49] Caracol}Elocuente
R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414
[21:49] Caracol}Elocuente Tri.3294 Fisica-QuimicaɍaGo0˿Elementogsituadogenmlastablasperi󤩣asporgdebajogdelqfosforog?e [21:49] Caracol}Elocuente
Tri.3294 Fisica-QuimicaɍaGo0˿Elementogsituadogenmlastablasperi󤩣asporgdebajogdelqfosforog?e
[21:49] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 17005 Puntos [21:49] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 17005 Puntos
[21:49] Caracol}Elocuente 2 Pista: ars***** 30 segundos y 17005 Puntos [21:49] Caracol}Elocuente
2 Pista: ars***** 30 segundos y 17005 Puntos
[21:49] Elefante-Suave arsenal [21:49] Elefante-Suave
arsenal
[21:49] Grillo{Naranja arsenico [21:49] Grillo{Naranja
arsenico
[21:49] Caracol}Elocuente �Bien Grillo{Naranja!! Tu respuesta: "arsenico" es correcta y ganas �7005�12 puntos [21:49] Caracol}Elocuente
�Bien Grillo{Naranja!! Tu respuesta: "arsenico" es correcta y ganas �7005�12 puntos
[21:49] Caracol}Elocuente Grillo{Naranja has acertado 1 seguidas!! Puntos HOY: 703152, SEMANA: 3707601 y MES: 14922758 [21:49] Caracol}Elocuente
Grillo{Naranja has acertado 1 seguidas!! Puntos HOY: 703152, SEMANA: 3707601 y MES: 14922758
[21:49] Caracol}Elocuente If you think a Q&A is wrong, please call an OP [21:49] Caracol}Elocuente
If you think a Q&A is wrong, please call an OP
[21:49] Caracol}Elocuente Tri.19474 Miscelaneaɭuvmancer˿HAYuDOSuPALABRASuQUEuTEuABRIRANuMUCHASuPUERTASu?u [21:49] Caracol}Elocuente
Tri.19474 Miscelaneaɭuvmancer˿HAYuDOSuPALABRASuQUEuTEuABRIRANuMUCHASuPUERTASu?u
[21:49] Caracol}Elocuente 1 Pista: **** * ****** Valor pregunta : 12547 Puntos [21:49] Caracol}Elocuente
1 Pista: **** * ****** Valor pregunta : 12547 Puntos
[21:50] Caracol}Elocuente 2 Pista: tir* * ****** 30 segundos y 12547 Puntos [21:50] Caracol}Elocuente
2 Pista: tir* * ****** 30 segundos y 12547 Puntos
[21:50] Caracol}Elocuente 3 Pista: tire * e**u*e 15 segundos y 12547 Puntos [21:50] Caracol}Elocuente
3 Pista: tire * e**u*e 15 segundos y 12547 Puntos
[21:50] Grillo{Naranja tira y empuje [21:50] Grillo{Naranja
tira y empuje
[21:50] Caracol}Elocuente Tiempo! La respuesta es -> tire��mpuje <- [21:50] Caracol}Elocuente
Tiempo! La respuesta es -> tire��mpuje <-
[21:50] Caracol}Elocuente R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087 [21:50] Caracol}Elocuente
R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087
[21:50] Caracol}Elocuente Tri.18551 BiologiaɈdosO˿Comoisehllamailaiconexionaentrehneuronasv?y [21:50] Caracol}Elocuente
Tri.18551 BiologiaɈdosO˿Comoisehllamailaiconexionaentrehneuronasv?y
[21:50] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 13052 Puntos [21:50] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 13052 Puntos
[21:51] CaballitoDeMar-Respetable ¦ Emitiendo ( Anguila{Agil ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [21:51] CaballitoDeMar-Respetable
¦ Emitiendo ( Anguila{Agil ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[21:51] Caracol}Elocuente 2 Pista: sin***** 30 segundos y 13052 Puntos [21:51] Caracol}Elocuente
2 Pista: sin***** 30 segundos y 13052 Puntos
[21:51] Grillo{Naranja sinapsis [21:51] Grillo{Naranja
sinapsis
[21:51] Caracol}Elocuente �Increible!! Grillo{Naranja contest󺠃04"sinapsis" en �5.36 segundos, y ha ganado �3052�12 puntos [21:51] Caracol}Elocuente
�Increible!! Grillo{Naranja contest󺠃04"sinapsis" en �5.36 segundos, y ha ganado �3052�12 puntos
[21:51] Caracol}Elocuente Grillo{Naranja has acertado 2 seguidas!! Puntos HOY: 716204, SEMANA: 3720653 y MES: 14935810 [21:51] Caracol}Elocuente
Grillo{Naranja has acertado 2 seguidas!! Puntos HOY: 716204, SEMANA: 3720653 y MES: 14935810
[21:51] Caracol}Elocuente For The Competitive Edge type !pingme [21:51] Caracol}Elocuente
For The Competitive Edge type !pingme
[21:51] Caracol}Elocuente Tri.7663 Miscelaneaɓebosin˿C󭯃01useyllamananlanfiguranpuestanancaballo?y?y [21:51] Caracol}Elocuente
Tri.7663 Miscelaneaɓebosin˿C󭯃01useyllamananlanfiguranpuestanancaballo?y?y
[21:51] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 17747 Puntos [21:51] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 17747 Puntos
[21:51] Caracol}Elocuente 2 Pista: ecu***** 30 segundos y 17747 Puntos [21:51] Caracol}Elocuente
2 Pista: ecu***** 30 segundos y 17747 Puntos
[21:51] Caracol}Elocuente 3 Pista: ecue***e 15 segundos y 17747 Puntos [21:51] Caracol}Elocuente
3 Pista: ecue***e 15 segundos y 17747 Puntos
[21:52] Caracol}Elocuente Tiempo! La respuesta es -> ecuestre <- [21:52] Caracol}Elocuente
Tiempo! La respuesta es -> ecuestre <-
[21:52] CaballitoDeMar-Respetable » Ahora suena: - Dj Online · https://www.radiolunademiel.com [21:52] CaballitoDeMar-Respetable
» Ahora suena: - Dj Online · https://www.radiolunademiel.com
[21:52] Grillo{Naranja .tema [21:52] Grillo{Naranja
.tema
[21:52] Caracol}Elocuente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [21:52] Caracol}Elocuente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[21:52] Caracol}Elocuente Tri.16839 Miscelaneaɓebosin˿Frases-ANӎIMO:m"Lagprosperidadzhaceoamistades,mydlagadversidadzlasz..."?m?m [21:52] Caracol}Elocuente
Tri.16839 Miscelaneaɓebosin˿Frases-ANӎIMO:m"Lagprosperidadzhaceoamistades,mydlagadversidadzlasz..."?m?m
[21:52] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 9534 Puntos [21:52] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 9534 Puntos
[21:52] Caracol}Elocuente 2 Pista: pru*** 30 segundos y 9534 Puntos [21:52] Caracol}Elocuente
2 Pista: pru*** 30 segundos y 9534 Puntos
[21:52] Caracol}Elocuente 3 Pista: prue*a 15 segundos y 9534 Puntos [21:52] Caracol}Elocuente
3 Pista: prue*a 15 segundos y 9534 Puntos
[21:52] Elefante-Suave prueba [21:52] Elefante-Suave
prueba
[21:52] Caracol}Elocuente �Elefante-Suave acert󡡠La respuesta era: "prueba" y contest󠥮 �3.296 segundos. Se lleva: �534�12 puntos [21:52] Caracol}Elocuente
�Elefante-Suave acert󡡠La respuesta era: "prueba" y contest󠥮 �3.296 segundos. Se lleva: �534�12 puntos
[21:52] Caracol}Elocuente ACTION awards Elefante-Suave with a +v for having over 15000 points [21:52] Caracol}Elocuente
ACTION awards Elefante-Suave with a +v for having over 15000 points
[21:52] Caracol}Elocuente Elefante-Suave has acertado 1 seguidas!! Puntos HOY: 997140, SEMANA: 1250891 y MES: 2369018 [21:52] Caracol}Elocuente
Elefante-Suave has acertado 1 seguidas!! Puntos HOY: 997140, SEMANA: 1250891 y MES: 2369018
[21:53] Caracol}Elocuente R᮫ing MES: - #1: Grillo{Naranja 14935810 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2359484 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 685511 [21:53] Caracol}Elocuente
R᮫ing MES: - #1: Grillo{Naranja 14935810 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2359484 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 685511
[21:53] Caracol}Elocuente Tri.4726 Gastronomiaɬea˿Detqu郰1bprovinciaysonzcaracter�icasplasptortitaspdetcamaronesp?b [21:53] Caracol}Elocuente
Tri.4726 Gastronomiaɬea˿Detqu郰1bprovinciaysonzcaracter�icasplasptortitaspdetcamaronesp?b
[21:53] Caracol}Elocuente 1 Pista: ***** Valor pregunta : 20502 Puntos [21:53] Caracol}Elocuente
1 Pista: ***** Valor pregunta : 20502 Puntos
[21:53] Caracol}Elocuente 2 Pista: cad** 30 segundos y 20502 Puntos [21:53] Caracol}Elocuente
2 Pista: cad** 30 segundos y 20502 Puntos
[21:53] Grillo{Naranja cadiz [21:53] Grillo{Naranja
cadiz
[21:53] Caracol}Elocuente �Absolutamente correcto Grillo{Naranja!! Acertaste "cadiz" en �0.718 segundos y ganas �0502�12 puntos [21:53] Caracol}Elocuente
�Absolutamente correcto Grillo{Naranja!! Acertaste "cadiz" en �0.718 segundos y ganas �0502�12 puntos
[21:53] Elefante-Suave cadiz [21:53] Elefante-Suave
cadiz
[21:53] Caracol}Elocuente Grillo{Naranja has acertado 1 seguidas!! Puntos HOY: 736706, SEMANA: 3741155 y MES: 14956312 [21:53] Caracol}Elocuente
Grillo{Naranja has acertado 1 seguidas!! Puntos HOY: 736706, SEMANA: 3741155 y MES: 14956312
[21:53] Caracol}Elocuente Please refrain from using Extreme Bad Language [21:53] Caracol}Elocuente
Please refrain from using Extreme Bad Language
[21:53] Caracol}Elocuente Tri.15113 Deporteɚytox˿Atletismo:Recordmanjmundialqdeelosr1.500y(updatede2000)y?y [21:53] Caracol}Elocuente
Tri.15113 Deporteɚytox˿Atletismo:Recordmanjmundialqdeelosr1.500y(updatede2000)y?y
[21:53] Caracol}Elocuente 1 Pista: ********** ******* Valor pregunta : 7254 Puntos [21:53] Caracol}Elocuente
1 Pista: ********** ******* Valor pregunta : 7254 Puntos
[21:53] Elefante-Suave eyyy trampa manito [21:53] Elefante-Suave
eyyy trampa manito
[21:53] Elefante-Suave ? [21:53] Elefante-Suave
?
[21:53] Elefante-Suave ya no juego [21:53] Elefante-Suave
ya no juego
[21:53] Caracol}Elocuente 2 Pista: nou******* ******* 30 segundos y 7254 Puntos [21:53] Caracol}Elocuente
2 Pista: nou******* ******* 30 segundos y 7254 Puntos
[21:54] Caracol}Elocuente 3 Pista: nou*e**i*e *o**e*i 15 segundos y 7254 Puntos [21:54] Caracol}Elocuente
3 Pista: nou*e**i*e *o**e*i 15 segundos y 7254 Puntos
[21:54] Elefante-Suave maldito sea tu nombre manito [21:54] Elefante-Suave
maldito sea tu nombre manito
[21:54] Elefante-Suave \m/ [21:54] Elefante-Suave
\m/
[21:54] Caracol}Elocuente Tiempo! La respuesta es -> noureddine�orceli <- [21:54] Caracol}Elocuente
Tiempo! La respuesta es -> noureddine�orceli <-
[21:54] Grillo{Naranja [Elefante-Suave] k pasa? [21:54] Grillo{Naranja
[Elefante-Suave] k pasa?
[21:54] Caracol}Elocuente This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente [21:54] Caracol}Elocuente
This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente
[21:54] Caracol}Elocuente Tri.16825 Personajesɓebosin˿-COMPLETARdLAdCITA-R.L.dSTEVENSON:d"Dejadaquexhablexcualquierarciertoftiempofyever驳ucomofconsiguex..."?d?d [21:54] Caracol}Elocuente
Tri.16825 Personajesɓebosin˿-COMPLETARdLAdCITA-R.L.dSTEVENSON:d"Dejadaquexhablexcualquierarciertoftiempofyever驳ucomofconsiguex..."?d?d
[21:54] Caracol}Elocuente 1 Pista: ********** Valor pregunta : 16726 Puntos [21:54] Caracol}Elocuente
1 Pista: ********** Valor pregunta : 16726 Puntos
[21:54] Elefante-Suave toy cantado [21:54] Elefante-Suave
toy cantado
[21:54] Caracol}Elocuente 2 Pista: pro******* 30 segundos y 16726 Puntos [21:54] Caracol}Elocuente
2 Pista: pro******* 30 segundos y 16726 Puntos
[21:54] Elefante-Suave el coro [21:54] Elefante-Suave
el coro
[21:55] Caracol}Elocuente 3 Pista: pro*e*i*o* 15 segundos y 16726 Puntos [21:55] Caracol}Elocuente
3 Pista: pro*e*i*o* 15 segundos y 16726 Puntos
[21:55] Grillo{Naranja no mientes [21:55] Grillo{Naranja
no mientes
[21:55] Caracol}Elocuente Tiempo! La respuesta es -> proselitos <- [21:55] Caracol}Elocuente
Tiempo! La respuesta es -> proselitos <-
[21:55] Caracol}Elocuente This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeonBrillante 59328 #14: Grillo-Locuaz 23731 #15: LeCaTwaLk_z 19830 #16: FANTASMAMEXICO 5048 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [21:55] Caracol}Elocuente
This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeonBrillante 59328 #14: Grillo-Locuaz 23731 #15: LeCaTwaLk_z 19830 #16: FANTASMAMEXICO 5048 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[21:55] Caracol}Elocuente Tri.2832 Cancionesɖonk˿Desquienqesdlawcancionqmasddueles?k [21:55] Caracol}Elocuente
Tri.2832 Cancionesɖonk˿Desquienqesdlawcancionqmasddueles?k
[21:55] Caracol}Elocuente 1 Pista: ****** ******** Valor pregunta : 14075 Puntos [21:55] Caracol}Elocuente
1 Pista: ****** ******** Valor pregunta : 14075 Puntos
[21:55] Caracol}Elocuente 2 Pista: and*** ******** 30 segundos y 14075 Puntos [21:55] Caracol}Elocuente
2 Pista: and*** ******** 30 segundos y 14075 Puntos
[21:55] Elefante-Suave si escucha maldito sea tu nombre los angeles del infieno [21:55] Elefante-Suave
si escucha maldito sea tu nombre los angeles del infieno
[21:56] Caracol}Elocuente 3 Pista: and*e* *a*a*a*o 15 segundos y 14075 Puntos [21:56] Caracol}Elocuente
3 Pista: and*e* *a*a*a*o 15 segundos y 14075 Puntos
[21:56] Elefante-Suave es rock [21:56] Elefante-Suave
es rock
[21:56] Elefante-Suave ya regreso [21:56] Elefante-Suave
ya regreso
[21:56] Caracol}Elocuente Tiempo! La respuesta es -> andres�alamaro <- [21:56] Caracol}Elocuente
Tiempo! La respuesta es -> andres�alamaro <-
[21:56] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [21:56] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[21:56] Caracol}Elocuente Tri.15998 Arteɴjmm.com˿Estegpintorsnaci󃰱xeniAlemaniahperoevivi󃰱xeniSuiza.xFuegprofesorsenilahBauhausleginfluy󃰱xenielhsurrealismoeybelhexpresionismoeabstracto.x?x [21:56] Caracol}Elocuente
Tri.15998 Arteɴjmm.com˿Estegpintorsnaci󃰱xeniAlemaniahperoevivi󃰱xeniSuiza.xFuegprofesorsenilahBauhausleginfluy󃰱xenielhsurrealismoeybelhexpresionismoeabstracto.x?x
[21:56] Caracol}Elocuente 1 Pista: **** **** Valor pregunta : 16734 Puntos [21:56] Caracol}Elocuente
1 Pista: **** **** Valor pregunta : 16734 Puntos
[21:56] Caracol}Elocuente 2 Pista: pau* **** 30 segundos y 16734 Puntos [21:56] Caracol}Elocuente
2 Pista: pau* **** 30 segundos y 16734 Puntos
[21:56] Caracol}Elocuente 3 Pista: pau* **ee 15 segundos y 16734 Puntos [21:56] Caracol}Elocuente
3 Pista: pau* **ee 15 segundos y 16734 Puntos
[21:57] Caracol}Elocuente Tiempo! La respuesta es -> paul�lee <- [21:57] Caracol}Elocuente
Tiempo! La respuesta es -> paul�lee <-
[21:57] Caracol}Elocuente This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: LeonBrillante 59328 [21:57] Caracol}Elocuente
This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: LeonBrillante 59328
[21:57] Caracol}Elocuente Tri.12591 Miscelaneaɓebosin˿CUALzSOBRA?(PISTA:zTodosqsonePapasqdelnsiglofXXzexceptofunofquewesqdelnXIX)zBenedictofXV,zP�01fXII,zJuaneXXIII,zPablofVI,zLeoneXIII?z?z [21:57] Caracol}Elocuente
Tri.12591 Miscelaneaɓebosin˿CUALzSOBRA?(PISTA:zTodosqsonePapasqdelnsiglofXXzexceptofunofquewesqdelnXIX)zBenedictofXV,zP�01fXII,zJuaneXXIII,zPablofVI,zLeoneXIII?z?z
[21:57] Caracol}Elocuente 1 Pista: **** **** Valor pregunta : 20921 Puntos [21:57] Caracol}Elocuente
1 Pista: **** **** Valor pregunta : 20921 Puntos
[21:57] Caracol}Elocuente 2 Pista: leo* **** 30 segundos y 20921 Puntos [21:57] Caracol}Elocuente
2 Pista: leo* **** 30 segundos y 20921 Puntos
[21:57] Grillo{Naranja leon xiii [21:57] Grillo{Naranja
leon xiii
[21:57] Caracol}Elocuente �emuestra lo que sabes Grillo{Naranja! Has respondido "leon xiii" correctamente y eso te da: �0921�12 puntos [21:57] Caracol}Elocuente
�emuestra lo que sabes Grillo{Naranja! Has respondido "leon xiii" correctamente y eso te da: �0921�12 puntos
[21:57] Caracol}Elocuente Grillo{Naranja has acertado 2 seguidas!! Puntos HOY: 757627, SEMANA: 3762076 y MES: 14977233 [21:57] Caracol}Elocuente
Grillo{Naranja has acertado 2 seguidas!! Puntos HOY: 757627, SEMANA: 3762076 y MES: 14977233
[21:57] Caracol}Elocuente R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206 [21:57] Caracol}Elocuente
R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206
[21:57] Caracol}Elocuente Tri.20865 IdiomasɎEVIVA˿FRANCeS-ESPA񏌃01w"BOURGEON"w?w [21:57] Caracol}Elocuente
Tri.20865 IdiomasɎEVIVA˿FRANCeS-ESPA񏌃01w"BOURGEON"w?w
[21:57] Caracol}Elocuente 1 Pista: **** Pregunta de BONUS : 200000 Puntos [21:57] Caracol}Elocuente
1 Pista: **** Pregunta de BONUS : 200000 Puntos
[21:58] Caracol}Elocuente 2 Pista: yem* 30 segundos y 200000 Puntos [21:58] Caracol}Elocuente
2 Pista: yem* 30 segundos y 200000 Puntos
[21:58] Grillo{Naranja yema [21:58] Grillo{Naranja
yema
[21:58] Caracol}Elocuente �Est᳠que lo tiras Grillo{Naranja!! ߃󭯠supiste que "yema" era la respuesta? Venga, �00000�12 puntos suben a tu marcador [21:58] Caracol}Elocuente
�Est᳠que lo tiras Grillo{Naranja!! ߃󭯠supiste que "yema" era la respuesta? Venga, �00000�12 puntos suben a tu marcador
[21:58] Caracol}Elocuente Grillo{Naranja has acertado 3 seguidas!! Puntos HOY: 957627, SEMANA: 3962076 y MES: 15177233 [21:58] Caracol}Elocuente
Grillo{Naranja has acertado 3 seguidas!! Puntos HOY: 957627, SEMANA: 3962076 y MES: 15177233
[21:58] Elefante-Suave yeme [21:58] Elefante-Suave
yeme
[21:58] Caracol}Elocuente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [21:58] Caracol}Elocuente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[21:58] Caracol}Elocuente Tri.17633 Idiomasɴjmm.com˄etingl鳃01xailat�j"Romansxgoxhome"j(Det"LaividaidetBrian").j?j [21:58] Caracol}Elocuente
Tri.17633 Idiomasɴjmm.com˄etingl鳃01xailat�j"Romansxgoxhome"j(Det"LaividaidetBrian").j?j
[21:58] Caracol}Elocuente 1 Pista: ****** *** ***** Pregunta de BONUS : 25000 Puntos [21:58] Caracol}Elocuente
1 Pista: ****** *** ***** Pregunta de BONUS : 25000 Puntos
[21:58] Caracol}Elocuente 2 Pista: rom*** *** ***** 30 segundos y 25000 Puntos [21:58] Caracol}Elocuente
2 Pista: rom*** *** ***** 30 segundos y 25000 Puntos
[21:58] Caracol}Elocuente 3 Pista: roma*i i*e *o*u* 15 segundos y 25000 Puntos [21:58] Caracol}Elocuente
3 Pista: roma*i i*e *o*u* 15 segundos y 25000 Puntos
[21:59] Caracol}Elocuente Tiempo! La respuesta es -> romani�te�omum <- [21:59] Caracol}Elocuente
Tiempo! La respuesta es -> romani�te�omum <-
[21:59] Caracol}Elocuente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [21:59] Caracol}Elocuente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[21:59] Caracol}Elocuente Tri.16222 Miscelaneaɂuzzati˿(COSTURA)oLABORoDEoPUNTADASoMUYoJUNTAS,oQUEoSEoHACENoVOLVIENDOoLAoAGUJAoHACIAoATR�oDESPUɓoDEoCADAoPUNTOo?o [21:59] Caracol}Elocuente
Tri.16222 Miscelaneaɂuzzati˿(COSTURA)oLABORoDEoPUNTADASoMUYoJUNTAS,oQUEoSEoHACENoVOLVIENDOoLAoAGUJAoHACIAoATR�oDESPUɓoDEoCADAoPUNTOo?o
[21:59] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 24731 Puntos [21:59] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 24731 Puntos
[21:59] Caracol}Elocuente 2 Pista: pes***** 30 segundos y 24731 Puntos [21:59] Caracol}Elocuente
2 Pista: pes***** 30 segundos y 24731 Puntos
[21:59] Caracol}Elocuente 3 Pista: pes*u**e 15 segundos y 24731 Puntos [21:59] Caracol}Elocuente
3 Pista: pes*u**e 15 segundos y 24731 Puntos
[21:59] Grillo{Naranja pespunte [21:59] Grillo{Naranja
pespunte
[21:59] Caracol}Elocuente �Increible!! Grillo{Naranja contest󺠃04"pespunte" en �7.828 segundos, y ha ganado �4731�12 puntos [21:59] Caracol}Elocuente
�Increible!! Grillo{Naranja contest󺠃04"pespunte" en �7.828 segundos, y ha ganado �4731�12 puntos
[21:59] Caracol}Elocuente Grillo{Naranja has acertado 4 seguidas!! Puntos HOY: 982358, SEMANA: 3986807 y MES: 15201964 [21:59] Caracol}Elocuente
Grillo{Naranja has acertado 4 seguidas!! Puntos HOY: 982358, SEMANA: 3986807 y MES: 15201964
[22:00] Caracol}Elocuente R᮫ing SEMANA: - #1: Grillo{Naranja 3986807 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1250891 #5: siva- 692906 #6: Caiman_Enorme 685511 #7: Ketzy 610145 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481 [22:00] Caracol}Elocuente
R᮫ing SEMANA: - #1: Grillo{Naranja 3986807 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1250891 #5: siva- 692906 #6: Caiman_Enorme 685511 #7: Ketzy 610145 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481
[22:00] Caracol}Elocuente Tri.12484 LiteraturaɔeLaRaNhA˿Autortdex"lapcamisa"k?k [22:00] Caracol}Elocuente
Tri.12484 LiteraturaɔeLaRaNhA˿Autortdex"lapcamisa"k?k
[22:00] Caracol}Elocuente 1 Pista: ***** **** Valor pregunta : 19399 Puntos [22:00] Caracol}Elocuente
1 Pista: ***** **** Valor pregunta : 19399 Puntos
[22:00] Elefante-Suave missmaxis ya me voy se cuida despues entro mas tarde \o [22:00] Elefante-Suave
missmaxis ya me voy se cuida despues entro mas tarde \o
[22:00] Caracol}Elocuente 2 Pista: lau** **** 30 segundos y 19399 Puntos [22:00] Caracol}Elocuente
2 Pista: lau** **** 30 segundos y 19399 Puntos
[22:00] Caracol}Elocuente 3 Pista: lau*o o**o 15 segundos y 19399 Puntos [22:00] Caracol}Elocuente
3 Pista: lau*o o**o 15 segundos y 19399 Puntos
[22:00] Caracol}Elocuente Tiempo! La respuesta es -> lauro�lmo <- [22:00] Caracol}Elocuente
Tiempo! La respuesta es -> lauro�lmo <-
[22:01] Caracol}Elocuente We feature over 50,000 Q&A ! [22:01] Caracol}Elocuente
We feature over 50,000 Q&A !
[22:01] Caracol}Elocuente Tri.4636 GastronomiaɁnghara˿Huevosoconxqueso,xtomates,xaceite,xpanxrallado,xajo,xaz�car,xpimientawygsalvesoden?x [22:01] Caracol}Elocuente
Tri.4636 GastronomiaɁnghara˿Huevosoconxqueso,xtomates,xaceite,xpanxrallado,xajo,xaz�car,xpimientawygsalvesoden?x
[22:01] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 6673 Puntos [22:01] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 6673 Puntos
[22:01] Caiman_Enorme [22:01] Caiman_Enorme
[22:01] Caracol}Elocuente 2 Pista: bur*** 30 segundos y 6673 Puntos [22:01] Caracol}Elocuente
2 Pista: bur*** 30 segundos y 6673 Puntos
[22:01] Grillo{Naranja burgos [22:01] Grillo{Naranja
burgos
[22:01] Caracol}Elocuente �Eso es Grillo{Naranja!! Dijiste: "burgos" y ello te ha valido: �673�12 puntos [22:01] Caracol}Elocuente
�Eso es Grillo{Naranja!! Dijiste: "burgos" y ello te ha valido: �673�12 puntos
[22:01] Caracol}Elocuente Grillo{Naranja has acertado 5 seguidas!! Puntos HOY: 989031, SEMANA: 3993480 y MES: 15208637 [22:01] Caracol}Elocuente
Grillo{Naranja has acertado 5 seguidas!! Puntos HOY: 989031, SEMANA: 3993480 y MES: 15208637
[22:01] Caracol}Elocuente R᮫ing de HOY: - #1: Jirafa\Letal 997140 #2: Grillo{Naranja 989031 #3: Gladiadora_del_Caribe 686734 #4: Caiman_Enorme 685511 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: LeonBrillante 59328 #9: Ketzy 38872 #10: Grillo-Locuaz 23731 [22:01] Caracol}Elocuente
R᮫ing de HOY: - #1: Jirafa\Letal 997140 #2: Grillo{Naranja 989031 #3: Gladiadora_del_Caribe 686734 #4: Caiman_Enorme 685511 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: LeonBrillante 59328 #9: Ketzy 38872 #10: Grillo-Locuaz 23731
[22:01] Caracol}Elocuente Tri.13511 CancionesɃHESARE˿EnvelwrecopilatorioidelMiliki,cquienvcantaxconvelwelwtemax"Susanita"c?c [22:01] Caracol}Elocuente
Tri.13511 CancionesɃHESARE˿EnvelwrecopilatorioidelMiliki,cquienvcantaxconvelwelwtemax"Susanita"c?c
[22:01] Caracol}Elocuente 1 Pista: ******* ****** Valor pregunta : 14605 Puntos [22:01] Caracol}Elocuente
1 Pista: ******* ****** Valor pregunta : 14605 Puntos
[22:01] Elefante-Suave abrazo y beso para ti missmaxis chaito [22:01] Elefante-Suave
abrazo y beso para ti missmaxis chaito
[22:01] Caracol}Elocuente 2 Pista: mar**** ****** 30 segundos y 14605 Puntos [22:01] Caracol}Elocuente
2 Pista: mar**** ****** 30 segundos y 14605 Puntos
[22:02] Caracol}Elocuente 3 Pista: mar*e*a *o*e*o 15 segundos y 14605 Puntos [22:02] Caracol}Elocuente
3 Pista: mar*e*a *o*e*o 15 segundos y 14605 Puntos
[22:02] Caracol}Elocuente Tiempo! La respuesta es -> marcela�orelo <- [22:02] Caracol}Elocuente
Tiempo! La respuesta es -> marcela�orelo <-
[22:02] Caracol}Elocuente Tri.8602 Miscelaneaɴjmm.com˿Bricolaje:uPeque񯳃01bcilindrosbdedmaderanquedsedusansencoladosbedintroducidosbensagujerosbparanensamblarrmaderas.u?u [22:02] Caracol}Elocuente
Tri.8602 Miscelaneaɴjmm.com˿Bricolaje:uPeque񯳃01bcilindrosbdedmaderanquedsedusansencoladosbedintroducidosbensagujerosbparanensamblarrmaderas.u?u
[22:02] Caracol}Elocuente 1 Pista: ******* Valor pregunta : 18452 Puntos [22:02] Caracol}Elocuente
1 Pista: ******* Valor pregunta : 18452 Puntos
[22:02] Caracol}Elocuente 2 Pista: esp**** 30 segundos y 18452 Puntos [22:02] Caracol}Elocuente
2 Pista: esp**** 30 segundos y 18452 Puntos
[22:03] Caracol}Elocuente 3 Pista: espi*a* 15 segundos y 18452 Puntos [22:03] Caracol}Elocuente
3 Pista: espi*a* 15 segundos y 18452 Puntos
[22:03] Caracol}Elocuente Tiempo! La respuesta es -> espigas <- [22:03] Caracol}Elocuente
Tiempo! La respuesta es -> espigas <-
[22:03] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [22:03] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[22:03] Caracol}Elocuente Tri.5994 Fisica-Quimicaɐsico666ˡnᬩsisgqu�cojbasadojenplaqmedidaqdewlaqintensidadpdelfcoloradewlasgdisolucionesg?g [22:03] Caracol}Elocuente
Tri.5994 Fisica-Quimicaɐsico666ˡnᬩsisgqu�cojbasadojenplaqmedidaqdewlaqintensidadpdelfcoloradewlasgdisolucionesg?g
[22:03] Caracol}Elocuente 1 Pista: ************ Valor pregunta : 6968 Puntos [22:03] Caracol}Elocuente
1 Pista: ************ Valor pregunta : 6968 Puntos
[22:03] Caracol}Elocuente 2 Pista: col********* 30 segundos y 6968 Puntos [22:03] Caracol}Elocuente
2 Pista: col********* 30 segundos y 6968 Puntos
[22:03] Caracol}Elocuente 3 Pista: colo*i*e**ia 15 segundos y 6968 Puntos [22:03] Caracol}Elocuente
3 Pista: colo*i*e**ia 15 segundos y 6968 Puntos
[22:04] Caracol}Elocuente Tiempo! La respuesta es -> colorimetria <- [22:04] Caracol}Elocuente
Tiempo! La respuesta es -> colorimetria <-
[22:04] Caracol}Elocuente R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414 [22:04] Caracol}Elocuente
R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414
[22:04] Caracol}Elocuente Tri.9061 LiteraturaɂRUJI˿CIENCIAnQUEnSEnOCUPAnDELnESTUDIOnDEnLAnLENGUAnYnLAnLITERATURAn?n [22:04] Caracol}Elocuente
Tri.9061 LiteraturaɂRUJI˿CIENCIAnQUEnSEnOCUPAnDELnESTUDIOnDEnLAnLENGUAnYnLAnLITERATURAn?n
[22:04] Caracol}Elocuente 1 Pista: ********* Valor pregunta : 22529 Puntos [22:04] Caracol}Elocuente
1 Pista: ********* Valor pregunta : 22529 Puntos
[22:04] Caracol}Elocuente 2 Pista: fil****** 30 segundos y 22529 Puntos [22:04] Caracol}Elocuente
2 Pista: fil****** 30 segundos y 22529 Puntos
[22:04] Caracol}Elocuente 3 Pista: filo*o*ia 15 segundos y 22529 Puntos [22:04] Caracol}Elocuente
3 Pista: filo*o*ia 15 segundos y 22529 Puntos
[22:05] Grillo{Naranja filosofia [22:05] Grillo{Naranja
filosofia
[22:05] Caracol}Elocuente Tiempo! La respuesta es -> filologia <- [22:05] Caracol}Elocuente
Tiempo! La respuesta es -> filologia <-
[22:05] Caracol}Elocuente If you think a Q&A is wrong, please call an OP [22:05] Caracol}Elocuente
If you think a Q&A is wrong, please call an OP
[22:05] Caracol}Elocuente Tri.18159 Cineɴovarich˿ENvQUEvPELICULAvDEvORSONvWELLESvAPARECIAvMARLENEvDIETRICHvENvUNvBREVEvPEROvSUSTANCIOSOvPAPELv?v [22:05] Caracol}Elocuente
Tri.18159 Cineɴovarich˿ENvQUEvPELICULAvDEvORSONvWELLESvAPARECIAvMARLENEvDIETRICHvENvUNvBREVEvPEROvSUSTANCIOSOvPAPELv?v
[22:05] Caracol}Elocuente 1 Pista: *** ** *** Valor pregunta : 21350 Puntos [22:05] Caracol}Elocuente
1 Pista: *** ** *** Valor pregunta : 21350 Puntos
[22:05] Caracol}Elocuente 2 Pista: sed ** *** 30 segundos y 21350 Puntos [22:05] Caracol}Elocuente
2 Pista: sed ** *** 30 segundos y 21350 Puntos
[22:05] Caracol}Elocuente 3 Pista: sed *e *a* 15 segundos y 21350 Puntos [22:05] Caracol}Elocuente
3 Pista: sed *e *a* 15 segundos y 21350 Puntos
[22:06] Caracol}Elocuente Tiempo! La respuesta es -> sed�e�al <- [22:06] Caracol}Elocuente
Tiempo! La respuesta es -> sed�e�al <-
[22:06] CaballitoDeMar-Respetable ¦ Emitiendo ( Anguila{Agil ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [22:06] CaballitoDeMar-Respetable
¦ Emitiendo ( Anguila{Agil ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[22:06] Caracol}Elocuente R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087 [22:06] Caracol}Elocuente
R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087
[22:06] Caracol}Elocuente Tri.551 Biologiaɦlipp_er˿Cuantosltiposldetacidoslribonucleicoslhay?(numeros)n?n [22:06] Caracol}Elocuente
Tri.551 Biologiaɦlipp_er˿Cuantosltiposldetacidoslribonucleicoslhay?(numeros)n?n
[22:06] Caracol}Elocuente 1 Pista: * Valor pregunta : 12487 Puntos [22:06] Caracol}Elocuente
1 Pista: * Valor pregunta : 12487 Puntos
[22:06] Caracol}Elocuente 2 Pista: 3 30 segundos y 12487 Puntos [22:06] Caracol}Elocuente
2 Pista: 3 30 segundos y 12487 Puntos
[22:06] Grillo{Naranja 3 [22:06] Grillo{Naranja
3
[22:06] Caracol}Elocuente �Est᳠que lo tiras Grillo{Naranja!! ߃󭯠supiste que "3" era la respuesta? Venga, �2487�12 puntos suben a tu marcador [22:06] Caracol}Elocuente
�Est᳠que lo tiras Grillo{Naranja!! ߃󭯠supiste que "3" era la respuesta? Venga, �2487�12 puntos suben a tu marcador
[22:06] Caracol}Elocuente Grillo{Naranja has acertado 6 seguidas!! Puntos HOY: 1001518, SEMANA: 4005967 y MES: 15221124 [22:06] Caracol}Elocuente
Grillo{Naranja has acertado 6 seguidas!! Puntos HOY: 1001518, SEMANA: 4005967 y MES: 15221124
[22:06] Caracol}Elocuente For The Competitive Edge type !pingme [22:06] Caracol}Elocuente
For The Competitive Edge type !pingme
[22:06] Caracol}Elocuente Tri.4464 MitologiaɅME^˿HIJOlDElAPOLOlCELEBRElENlELlARTElDElLAlADIVINACIONl?l [22:06] Caracol}Elocuente
Tri.4464 MitologiaɅME^˿HIJOlDElAPOLOlCELEBRElENlELlARTElDElLAlADIVINACIONl?l
[22:06] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 8620 Puntos [22:06] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 8620 Puntos
[22:06] Caracol}Elocuente 2 Pista: bra*** 30 segundos y 8620 Puntos [22:06] Caracol}Elocuente
2 Pista: bra*** 30 segundos y 8620 Puntos
[22:07] Caracol}Elocuente 3 Pista: bra**o 15 segundos y 8620 Puntos [22:07] Caracol}Elocuente
3 Pista: bra**o 15 segundos y 8620 Puntos
[22:07] Caracol}Elocuente Tiempo! La respuesta es -> branco <- [22:07] Caracol}Elocuente
Tiempo! La respuesta es -> branco <-
[22:07] Caracol}Elocuente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [22:07] Caracol}Elocuente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[22:07] Caracol}Elocuente Tri.7859 Cineɨowlita˿Frasesddebcine:v"Tuynosdebesdtenermebmiedo.vDebesdtenerqpanico"v?v [22:07] Caracol}Elocuente
Tri.7859 Cineɨowlita˿Frasesddebcine:v"Tuynosdebesdtenermebmiedo.vDebesdtenerqpanico"v?v
[22:07] Caracol}Elocuente 1 Pista: ** ****** **** Valor pregunta : 22720 Puntos [22:07] Caracol}Elocuente
1 Pista: ** ****** **** Valor pregunta : 22720 Puntos
[22:07] Caracol}Elocuente 2 Pista: el�***** **** 30 segundos y 22720 Puntos [22:07] Caracol}Elocuente
2 Pista: el�***** **** 30 segundos y 22720 Puntos
[22:08] Caracol}Elocuente 3 Pista: el�*a*o* *o*o 15 segundos y 22720 Puntos [22:08] Caracol}Elocuente
3 Pista: el�*a*o* *o*o 15 segundos y 22720 Puntos
[22:08] Caracol}Elocuente Tiempo! La respuesta es -> el�ragon�ojo <- [22:08] Caracol}Elocuente
Tiempo! La respuesta es -> el�ragon�ojo <-
[22:08] Caracol}Elocuente R᮫ing MES: - #1: Grillo{Naranja 15221124 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2369018 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 685511 [22:08] Caracol}Elocuente
R᮫ing MES: - #1: Grillo{Naranja 15221124 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2369018 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 685511
[22:08] Caracol}Elocuente Tri.13482 Geografiaɭartuniki˿ELgTAJOgDESEMBOCAgENgLISBOAgFORMANDOgUNgESTUARIOgLLAMADOg?g [22:08] Caracol}Elocuente
Tri.13482 Geografiaɭartuniki˿ELgTAJOgDESEMBOCAgENgLISBOAgFORMANDOgUNgESTUARIOgLLAMADOg?g
[22:08] Caracol}Elocuente 1 Pista: *** ** ** **** Valor pregunta : 24893 Puntos [22:08] Caracol}Elocuente
1 Pista: *** ** ** **** Valor pregunta : 24893 Puntos
[22:08] Caracol}Elocuente 2 Pista: mar ** ** **** 30 segundos y 24893 Puntos [22:08] Caracol}Elocuente
2 Pista: mar ** ** **** 30 segundos y 24893 Puntos
[22:09] Caracol}Elocuente 3 Pista: mar *e *a *a*a 15 segundos y 24893 Puntos [22:09] Caracol}Elocuente
3 Pista: mar *e *a *a*a 15 segundos y 24893 Puntos
[22:09] Caracol}Elocuente Tiempo! La respuesta es -> mar�e�a�aja <- [22:09] Caracol}Elocuente
Tiempo! La respuesta es -> mar�e�a�aja <-
[22:09] Caracol}Elocuente Please refrain from using Extreme Bad Language [22:09] Caracol}Elocuente
Please refrain from using Extreme Bad Language
[22:09] Caracol}Elocuente Tri.2774 BiologiaɓESINO˿C󭯳nsegllamajgeneralmente,jalvpezjquegmigrajr�01jarribajdesdegelvmarvparajdesovarvendaguajdulce?j?j [22:09] Caracol}Elocuente
Tri.2774 BiologiaɓESINO˿C󭯳nsegllamajgeneralmente,jalvpezjquegmigrajr�01jarribajdesdegelvmarvparajdesovarvendaguajdulce?j?j
[22:09] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 13904 Puntos [22:09] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 13904 Puntos
[22:09] Caracol}Elocuente 2 Pista: ana***** 30 segundos y 13904 Puntos [22:09] Caracol}Elocuente
2 Pista: ana***** 30 segundos y 13904 Puntos
[22:09] Caracol}Elocuente 3 Pista: ana**o*o 15 segundos y 13904 Puntos [22:09] Caracol}Elocuente
3 Pista: ana**o*o 15 segundos y 13904 Puntos
[22:10] Caracol}Elocuente Tiempo! La respuesta es -> anadromo <- [22:10] Caracol}Elocuente
Tiempo! La respuesta es -> anadromo <-
[22:10] Caracol}Elocuente This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente [22:10] Caracol}Elocuente
This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente
[22:10] Caracol}Elocuente Tri.2628 Idiomasɳtephewo˿Castellanor-fgallegor"altavoz"?f?f [22:10] Caracol}Elocuente
Tri.2628 Idiomasɳtephewo˿Castellanor-fgallegor"altavoz"?f?f
[22:10] Caracol}Elocuente 1 Pista: *********** Valor pregunta : 21135 Puntos [22:10] Caracol}Elocuente
1 Pista: *********** Valor pregunta : 21135 Puntos
[22:10] Caracol}Elocuente 2 Pista: alt******** 30 segundos y 21135 Puntos [22:10] Caracol}Elocuente
2 Pista: alt******** 30 segundos y 21135 Puntos
[22:10] Caracol}Elocuente 3 Pista: alto*a*a**e 15 segundos y 21135 Puntos [22:10] Caracol}Elocuente
3 Pista: alto*a*a**e 15 segundos y 21135 Puntos
[22:11] Caracol}Elocuente Tiempo! La respuesta es -> altofalante <- [22:11] Caracol}Elocuente
Tiempo! La respuesta es -> altofalante <-
[22:11] Caracol}Elocuente This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeonBrillante 59328 #14: Grillo-Locuaz 23731 #15: LeCaTwaLk_z 19830 #16: FANTASMAMEXICO 5048 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [22:11] Caracol}Elocuente
This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeonBrillante 59328 #14: Grillo-Locuaz 23731 #15: LeCaTwaLk_z 19830 #16: FANTASMAMEXICO 5048 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[22:11] Caracol}Elocuente Tri.15165 Politicaɭ˿Enzqu郰1kciudadzsespublicaselmdiarioh"DailyiNewsi?k [22:11] Caracol}Elocuente
Tri.15165 Politicaɭ˿Enzqu郰1kciudadzsespublicaselmdiarioh"DailyiNewsi?k
[22:11] Caracol}Elocuente 1 Pista: ***** **** Valor pregunta : 21685 Puntos [22:11] Caracol}Elocuente
1 Pista: ***** **** Valor pregunta : 21685 Puntos
[22:11] Caracol}Elocuente 2 Pista: nue** **** 30 segundos y 21685 Puntos [22:11] Caracol}Elocuente
2 Pista: nue** **** 30 segundos y 21685 Puntos
[22:11] Grillo{Naranja nueva york [22:11] Grillo{Naranja
nueva york
[22:11] Caracol}Elocuente �Enhorabuena Grillo{Naranja!! Has contestado "nueva york" y por ello has ganado �1685�12 puntos [22:11] Caracol}Elocuente
�Enhorabuena Grillo{Naranja!! Has contestado "nueva york" y por ello has ganado �1685�12 puntos
[22:11] Caracol}Elocuente Grillo{Naranja has acertado 7 seguidas!! Puntos HOY: 1023203, SEMANA: 4027652 y MES: 15242809 [22:11] Caracol}Elocuente
Grillo{Naranja has acertado 7 seguidas!! Puntos HOY: 1023203, SEMANA: 4027652 y MES: 15242809
[22:11] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [22:11] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[22:11] Caracol}Elocuente Tri.16454 CineɍARdeJAVA˿CU�dESdELdT͔ULOdORIGINALdDEdLAdPEL̓ULAd"ELdPLANETAdDEdLOSdSIMIOS"?d?d [22:11] Caracol}Elocuente
Tri.16454 CineɍARdeJAVA˿CU�dESdELdT͔ULOdORIGINALdDEdLAdPEL̓ULAd"ELdPLANETAdDEdLOSdSIMIOS"?d?d
[22:11] Caracol}Elocuente 1 Pista: ****** ** *** **** Valor pregunta : 11909 Puntos [22:11] Caracol}Elocuente
1 Pista: ****** ** *** **** Valor pregunta : 11909 Puntos
[22:11] Caracol}Elocuente 2 Pista: pla*** ** *** **** 30 segundos y 11909 Puntos [22:11] Caracol}Elocuente
2 Pista: pla*** ** *** **** 30 segundos y 11909 Puntos
[22:12] Caracol}Elocuente 3 Pista: pla*e* o* **e a*e* 15 segundos y 11909 Puntos [22:12] Caracol}Elocuente
3 Pista: pla*e* o* **e a*e* 15 segundos y 11909 Puntos
[22:12] Caracol}Elocuente Tiempo! La respuesta es -> planet�f�he�pes <- [22:12] Caracol}Elocuente
Tiempo! La respuesta es -> planet�f�he�pes <-
[22:12] Caracol}Elocuente This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: LeonBrillante 59328 [22:12] Caracol}Elocuente
This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: LeonBrillante 59328
[22:12] Caracol}Elocuente Tri.3073 Biologiaɳtephenwo˿Aqqu郰1qordenhdeploszanfibioszpertenecenhloszsaposzyqranas?q?q [22:12] Caracol}Elocuente
Tri.3073 Biologiaɳtephenwo˿Aqqu郰1qordenhdeploszanfibioszpertenecenhloszsaposzyqranas?q?q
[22:12] Caracol}Elocuente 1 Pista: ****** Pregunta de BONUS : 50000 Puntos [22:12] Caracol}Elocuente
1 Pista: ****** Pregunta de BONUS : 50000 Puntos
[22:12] Caracol}Elocuente 2 Pista: anu*** 30 segundos y 50000 Puntos [22:12] Caracol}Elocuente
2 Pista: anu*** 30 segundos y 50000 Puntos
[22:13] Caracol}Elocuente 3 Pista: anu*o* 15 segundos y 50000 Puntos [22:13] Caracol}Elocuente
3 Pista: anu*o* 15 segundos y 50000 Puntos
[22:13] Caracol}Elocuente Tiempo! La respuesta es -> anuros <- [22:13] Caracol}Elocuente
Tiempo! La respuesta es -> anuros <-
[22:13] Caracol}Elocuente R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206 [22:13] Caracol}Elocuente
R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206
[22:13] Caracol}Elocuente Tri.8511 Personajesɳica˿BORISvPASTERNAK(1890-1960)FUEvUN...v?v [22:13] Caracol}Elocuente
Tri.8511 Personajesɳica˿BORISvPASTERNAK(1890-1960)FUEvUN...v?v
[22:13] Caracol}Elocuente 1 Pista: ******** Valor pregunta : 22042 Puntos [22:13] Caracol}Elocuente
1 Pista: ******** Valor pregunta : 22042 Puntos
[22:13] Caracol}Elocuente 2 Pista: esc***** 30 segundos y 22042 Puntos [22:13] Caracol}Elocuente
2 Pista: esc***** 30 segundos y 22042 Puntos
[22:13] Grillo{Naranja escultor [22:13] Grillo{Naranja
escultor
[22:14] Grillo{Naranja escritor [22:14] Grillo{Naranja
escritor
[22:14] Caracol}Elocuente �Suma y sigue Grillo{Naranja!! La respuesta: "escritor" incrementa tu marcador en �2042�12 puntos [22:14] Caracol}Elocuente
�Suma y sigue Grillo{Naranja!! La respuesta: "escritor" incrementa tu marcador en �2042�12 puntos
[22:14] Caracol}Elocuente Grillo{Naranja has acertado 8 seguidas!! Puntos HOY: 1045245, SEMANA: 4049694 y MES: 15264851 [22:14] Caracol}Elocuente
Grillo{Naranja has acertado 8 seguidas!! Puntos HOY: 1045245, SEMANA: 4049694 y MES: 15264851
[22:14] Caracol}Elocuente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [22:14] Caracol}Elocuente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[22:14] Caracol}Elocuente Tri.1991 Personajesɪoam˿C󭯃01vmuri󃰱eYuriaGagarin?e?e [22:14] Caracol}Elocuente
Tri.1991 Personajesɪoam˿C󭯃01vmuri󃰱eYuriaGagarin?e?e
[22:14] Caracol}Elocuente 1 Pista: ********* ** ***** Pregunta de BONUS : 200000 Puntos [22:14] Caracol}Elocuente
1 Pista: ********* ** ***** Pregunta de BONUS : 200000 Puntos
[22:14] Caracol}Elocuente 2 Pista: acc****** ** ***** 30 segundos y 200000 Puntos [22:14] Caracol}Elocuente
2 Pista: acc****** ** ***** 30 segundos y 200000 Puntos
[22:14] Grillo{Naranja accidente de coche [22:14] Grillo{Naranja
accidente de coche
[22:14] Caracol}Elocuente 3 Pista: acci*e**e *e a*io* 15 segundos y 200000 Puntos [22:14] Caracol}Elocuente
3 Pista: acci*e**e *e a*io* 15 segundos y 200000 Puntos
[22:14] Grillo{Naranja accidente de avion [22:14] Grillo{Naranja
accidente de avion
[22:14] Caracol}Elocuente �Muy bien Grillo{Naranja!! Acertaste "accidente de avion" en tan s󬯠�7.218 segundos y por eso has ganado: �00000�12 puntos [22:14] Caracol}Elocuente
�Muy bien Grillo{Naranja!! Acertaste "accidente de avion" en tan s󬯠�7.218 segundos y por eso has ganado: �00000�12 puntos
[22:14] Caracol}Elocuente Grillo{Naranja has acertado 9 seguidas!! Puntos HOY: 1245245, SEMANA: 4249694 y MES: 15464851 [22:14] Caracol}Elocuente
Grillo{Naranja has acertado 9 seguidas!! Puntos HOY: 1245245, SEMANA: 4249694 y MES: 15464851
[22:14] Anguila{Agil .kiss Grillo{Naranja [22:14] Anguila{Agil
.kiss Grillo{Naranja
[22:14] Anguila{Agil ACTION Grillo{Naranja muassssssssssssssssssssss sssssssssssssssssssssssssssssssssssssssssssss sssssssssssssssssssssssssssssssssssssssssssssssssssssss ssssssssssssssssssssssssssssssssssssssss. [22:14] Anguila{Agil
ACTION Grillo{Naranja muassssssssssssssssssssss sssssssssssssssssssssssssssssssssssssssssssss sssssssssssssssssssssssssssssssssssssssssssssssssssssss ssssssssssssssssssssssssssssssssssssssss.
[22:14] Caracol}Elocuente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [22:14] Caracol}Elocuente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[22:14] Caracol}Elocuente Tri.1236 Informaticaɘove˿Facilidadoqueopermiteoaveriguariinformaci󮃰1zbᳩcawsobreousuariosjdeoInternetsobUnix.s?s [22:14] Caracol}Elocuente
Tri.1236 Informaticaɘove˿Facilidadoqueopermiteoaveriguariinformaci󮃰1zbᳩcawsobreousuariosjdeoInternetsobUnix.s?s
[22:14] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 23606 Puntos [22:14] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 23606 Puntos
[22:15] Caracol}Elocuente 2 Pista: Fin*** 30 segundos y 23606 Puntos [22:15] Caracol}Elocuente
2 Pista: Fin*** 30 segundos y 23606 Puntos
[22:15] Anguila{Agil .mua JvencitaMexicanaSecretaria [22:15] Anguila{Agil
.mua JvencitaMexicanaSecretaria
[22:15] Anguila{Agil ACTION JvencitaMexicanaSecretaria mmmmmmmmmmmmmmmmmmmmmmmmmmmmm uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk ssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss [22:15] Anguila{Agil
ACTION JvencitaMexicanaSecretaria mmmmmmmmmmmmmmmmmmmmmmmmmmmmm uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk ssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss
[22:15] Caracol}Elocuente 3 Pista: Fin*e* 15 segundos y 23606 Puntos [22:15] Caracol}Elocuente
3 Pista: Fin*e* 15 segundos y 23606 Puntos
[22:15] Caracol}Elocuente Tiempo! La respuesta es -> Finger <- [22:15] Caracol}Elocuente
Tiempo! La respuesta es -> Finger <-
[22:15] Caracol}Elocuente R᮫ing SEMANA: - #1: Grillo{Naranja 4249694 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1250891 #5: siva- 692906 #6: Caiman_Enorme 685511 #7: Ketzy 610145 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481 [22:15] Caracol}Elocuente
R᮫ing SEMANA: - #1: Grillo{Naranja 4249694 #2: Gladiadora_del_Caribe 2168105 #3: Paulus 2130123 #4: Jirafa\Letal 1250891 #5: siva- 692906 #6: Caiman_Enorme 685511 #7: Ketzy 610145 #8: Danielitto 397196 #9: Cosmo 285557 #10: hombre_bcn_48 264481
[22:15] Caracol}Elocuente Tri.13098 LiteraturaɔeLaRaNhA˿Autorades"larfuentesdeslaredad"c?c [22:15] Caracol}Elocuente
Tri.13098 LiteraturaɔeLaRaNhA˿Autorades"larfuentesdeslaredad"c?c
[22:15] Caracol}Elocuente 1 Pista: **** ***** **** Valor pregunta : 17215 Puntos [22:15] Caracol}Elocuente
1 Pista: **** ***** **** Valor pregunta : 17215 Puntos
[22:16] Caracol}Elocuente 2 Pista: lui* ***** **** 30 segundos y 17215 Puntos [22:16] Caracol}Elocuente
2 Pista: lui* ***** **** 30 segundos y 17215 Puntos
[22:16] Caracol}Elocuente 3 Pista: lui* *a*eo *ia* 15 segundos y 17215 Puntos [22:16] Caracol}Elocuente
3 Pista: lui* *a*eo *ia* 15 segundos y 17215 Puntos
[22:16] Caracol}Elocuente Tiempo! La respuesta es -> luis�ateo�iaz <- [22:16] Caracol}Elocuente
Tiempo! La respuesta es -> luis�ateo�iaz <-
[22:16] Caracol}Elocuente We feature over 50,000 Q&A ! [22:16] Caracol}Elocuente
We feature over 50,000 Q&A !
[22:16] Caracol}Elocuente Tri.13084 Musicaɴjmm.com˿Compositorhcontemporᮥozespa񯬃01lautorhdeqlalobralparalcintalmagn鴩cal"We"i(1970)."i?i [22:16] Caracol}Elocuente
Tri.13084 Musicaɴjmm.com˿Compositorhcontemporᮥozespa񯬃01lautorhdeqlalobralparalcintalmagn鴩cal"We"i(1970)."i?i
[22:16] Caracol}Elocuente 1 Pista: **** ** ***** Valor pregunta : 20364 Puntos [22:16] Caracol}Elocuente
1 Pista: **** ** ***** Valor pregunta : 20364 Puntos
[22:17] Caracol}Elocuente 2 Pista: lui* ** ***** 30 segundos y 20364 Puntos [22:17] Caracol}Elocuente
2 Pista: lui* ** ***** 30 segundos y 20364 Puntos
[22:17] Caracol}Elocuente 3 Pista: lui* *e *a**o 15 segundos y 20364 Puntos [22:17] Caracol}Elocuente
3 Pista: lui* *e *a**o 15 segundos y 20364 Puntos
[22:17] Caracol}Elocuente Tiempo! La respuesta es -> luis�e�ablo <- [22:17] Caracol}Elocuente
Tiempo! La respuesta es -> luis�e�ablo <-
[22:17] Caracol}Elocuente R᮫ing de HOY: - #1: Grillo{Naranja 1245245 #2: Jirafa\Letal 997140 #3: Gladiadora_del_Caribe 686734 #4: Caiman_Enorme 685511 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: LeonBrillante 59328 #9: Ketzy 38872 #10: Grillo-Locuaz 23731 [22:17] Caracol}Elocuente
R᮫ing de HOY: - #1: Grillo{Naranja 1245245 #2: Jirafa\Letal 997140 #3: Gladiadora_del_Caribe 686734 #4: Caiman_Enorme 685511 #5: Danielitto 347196 #6: Paulus 317541 #7: Cosmo 285557 #8: LeonBrillante 59328 #9: Ketzy 38872 #10: Grillo-Locuaz 23731
[22:17] Caracol}Elocuente Tri.8710 Medicina-SaludɈdosO˿COMObSEbLLAMAbLAbINFLAMACIONbDEbLAbMUCOSAbDEbLAbBOCAb?b [22:17] Caracol}Elocuente
Tri.8710 Medicina-SaludɈdosO˿COMObSEbLLAMAbLAbINFLAMACIONbDEbLAbMUCOSAbDEbLAbBOCAb?b
[22:17] Caracol}Elocuente 1 Pista: *********** Valor pregunta : 9508 Puntos [22:17] Caracol}Elocuente
1 Pista: *********** Valor pregunta : 9508 Puntos
[22:18] Caracol}Elocuente 2 Pista: est******** 30 segundos y 9508 Puntos [22:18] Caracol}Elocuente
2 Pista: est******** 30 segundos y 9508 Puntos
[22:18] Caracol}Elocuente 3 Pista: esto*a*i*i* 15 segundos y 9508 Puntos [22:18] Caracol}Elocuente
3 Pista: esto*a*i*i* 15 segundos y 9508 Puntos
[22:18] Caracol}Elocuente Tiempo! La respuesta es -> estomatitis <- [22:18] Caracol}Elocuente
Tiempo! La respuesta es -> estomatitis <-
[22:18] Caracol}Elocuente Tri.17971 GeografiaɍARdeJAVA˿CU�sESsLAsSEGUNDAsCIUDADsM�sPOPULOSAsDEsRUSIA,sCONs4.200.000sHABITANTES?s?s [22:18] Caracol}Elocuente
Tri.17971 GeografiaɍARdeJAVA˿CU�sESsLAsSEGUNDAsCIUDADsM�sPOPULOSAsDEsRUSIA,sCONs4.200.000sHABITANTES?s?s
[22:18] Caracol}Elocuente 1 Pista: *** *********** Valor pregunta : 23107 Puntos [22:18] Caracol}Elocuente
1 Pista: *** *********** Valor pregunta : 23107 Puntos
[22:18] Caracol}Elocuente 2 Pista: san *********** 30 segundos y 23107 Puntos [22:18] Caracol}Elocuente
2 Pista: san *********** 30 segundos y 23107 Puntos
[22:19] Caracol}Elocuente 3 Pista: san *e*e***u**o 15 segundos y 23107 Puntos [22:19] Caracol}Elocuente
3 Pista: san *e*e***u**o 15 segundos y 23107 Puntos
[22:19] Caracol}Elocuente Tiempo! La respuesta es -> san�etersburgo <- [22:19] Caracol}Elocuente
Tiempo! La respuesta es -> san�etersburgo <-
[22:19] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [22:19] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[22:19] Caracol}Elocuente Tri.20617 Cotilleo-TVɨupper˿DEfQUIENfHACEfSABRINAfLLOYDfENfSALTOfALfINFINITO?f?f [22:19] Caracol}Elocuente
Tri.20617 Cotilleo-TVɨupper˿DEfQUIENfHACEfSABRINAfLLOYDfENfSALTOfALfINFINITO?f?f
[22:19] Caracol}Elocuente 1 Pista: **** ****** Valor pregunta : 16485 Puntos [22:19] Caracol}Elocuente
1 Pista: **** ****** Valor pregunta : 16485 Puntos
[22:19] Caracol}Elocuente 2 Pista: wad* ****** 30 segundos y 16485 Puntos [22:19] Caracol}Elocuente
2 Pista: wad* ****** 30 segundos y 16485 Puntos
[22:20] Caracol}Elocuente 3 Pista: wade *e**e* 15 segundos y 16485 Puntos [22:20] Caracol}Elocuente
3 Pista: wade *e**e* 15 segundos y 16485 Puntos
[22:20] Caracol}Elocuente Tiempo! La respuesta es -> wade�elles <- [22:20] Caracol}Elocuente
Tiempo! La respuesta es -> wade�elles <-
[22:20] Caracol}Elocuente R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414 [22:20] Caracol}Elocuente
R᮫ing �ltimo MES: #1: Grillo{Naranja 34421347 #2: Gladiadora_del_Caribe 31036246 #3: siva- 6310538 #4: Cosmo 4209438 #5: DjR 3116414
[22:20] Caracol}Elocuente Tri.9006 Politicaɭ˿C󭯃01fseullamaaelxpresidenteudeuBrasilx(1999)c?c [22:20] Caracol}Elocuente
Tri.9006 Politicaɭ˿C󭯃01fseullamaaelxpresidenteudeuBrasilx(1999)c?c
[22:20] Caracol}Elocuente 1 Pista: ******** ******* Valor pregunta : 18771 Puntos [22:20] Caracol}Elocuente
1 Pista: ******** ******* Valor pregunta : 18771 Puntos
[22:20] Caracol}Elocuente 2 Pista: fer***** ******* 30 segundos y 18771 Puntos [22:20] Caracol}Elocuente
2 Pista: fer***** ******* 30 segundos y 18771 Puntos
[22:21] Caracol}Elocuente 3 Pista: fer*a**o *a**o*o 15 segundos y 18771 Puntos [22:21] Caracol}Elocuente
3 Pista: fer*a**o *a**o*o 15 segundos y 18771 Puntos
[22:21] CaballitoDeMar-Respetable ¦ Emitiendo ( Anguila{Agil ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [22:21] CaballitoDeMar-Respetable
¦ Emitiendo ( Anguila{Agil ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[22:21] Caracol}Elocuente Tiempo! La respuesta es -> fernando�ardoso <- [22:21] Caracol}Elocuente
Tiempo! La respuesta es -> fernando�ardoso <-
[22:21] Caracol}Elocuente If you think a Q&A is wrong, please call an OP [22:21] Caracol}Elocuente
If you think a Q&A is wrong, please call an OP
[22:21] Caracol}Elocuente Tri.11487 CineɃHESARE˿"Entreblaswpiernas"jestჰ1jbasadowenplawnovelawdelhcoguionistawygcoproductorjdeblaswanterioreswpel�laswdebManuelhG󭥺jPereira,jsebtratawde...j?j [22:21] Caracol}Elocuente
Tri.11487 CineɃHESARE˿"Entreblaswpiernas"jestჰ1jbasadowenplawnovelawdelhcoguionistawygcoproductorjdeblaswanterioreswpel�laswdebManuelhG󭥺jPereira,jsebtratawde...j?j
[22:21] Caracol}Elocuente 1 Pista: ******* ********* Valor pregunta : 19645 Puntos [22:21] Caracol}Elocuente
1 Pista: ******* ********* Valor pregunta : 19645 Puntos
[22:21] Caracol}Elocuente 2 Pista: joa**** ********* 30 segundos y 19645 Puntos [22:21] Caracol}Elocuente
2 Pista: joa**** ********* 30 segundos y 19645 Puntos
[22:21] Caracol}Elocuente 3 Pista: joa*ui* o*i***e** 15 segundos y 19645 Puntos [22:21] Caracol}Elocuente
3 Pista: joa*ui* o*i***e** 15 segundos y 19645 Puntos
[22:22] Caracol}Elocuente Tiempo! La respuesta es -> joaquin�ristrell <- [22:22] Caracol}Elocuente
Tiempo! La respuesta es -> joaquin�ristrell <-
[22:22] Caracol}Elocuente R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087 [22:22] Caracol}Elocuente
R᮫ing por D́: - Domingo: Grillo{Naranja 1700122 Lunes: Paulus 1755803 Martes: Grillo{Naranja 758897 Miercoles: Gladiadora_del_Caribe 548216 Jueves: Grillo{Naranja 1332216 Viernes: Grillo{Naranja 1220830 Sᢡdo: Grillo{Naranja 1387087
[22:22] Caracol}Elocuente Tri.13537 DeporteɔeLaRaNhA˿GanadorbdelzMundialzdeu250qccbdeumotociclismof2002q?q [22:22] Caracol}Elocuente
Tri.13537 DeporteɔeLaRaNhA˿GanadorbdelzMundialzdeu250qccbdeumotociclismof2002q?q
[22:22] Caracol}Elocuente 1 Pista: ***** ******** Valor pregunta : 7906 Puntos [22:22] Caracol}Elocuente
1 Pista: ***** ******** Valor pregunta : 7906 Puntos
[22:22] Caracol}Elocuente 2 Pista: mar** ******** 30 segundos y 7906 Puntos [22:22] Caracol}Elocuente
2 Pista: mar** ******** 30 segundos y 7906 Puntos
[22:22] Caracol}Elocuente 3 Pista: mar*o *e*a***i 15 segundos y 7906 Puntos [22:22] Caracol}Elocuente
3 Pista: mar*o *e*a***i 15 segundos y 7906 Puntos
[22:23] Caracol}Elocuente Tiempo! La respuesta es -> marco�elandri <- [22:23] Caracol}Elocuente
Tiempo! La respuesta es -> marco�elandri <-
[22:23] Caracol}Elocuente For The Competitive Edge type !pingme [22:23] Caracol}Elocuente
For The Competitive Edge type !pingme
[22:23] Caracol}Elocuente Tri.1440 Fisica-QuimicaɐEDROC˿COMOkSEkLLAMAkELkFUNDADORkDEkLAkMECANICAkCUANTICAk?k?k [22:23] Caracol}Elocuente
Tri.1440 Fisica-QuimicaɐEDROC˿COMOkSEkLLAMAkELkFUNDADORkDEkLAkMECANICAkCUANTICAk?k?k
[22:23] Caracol}Elocuente 1 Pista: *** ****** Valor pregunta : 5301 Puntos [22:23] Caracol}Elocuente
1 Pista: *** ****** Valor pregunta : 5301 Puntos
[22:23] Caracol}Elocuente 2 Pista: MAX ****** 30 segundos y 5301 Puntos [22:23] Caracol}Elocuente
2 Pista: MAX ****** 30 segundos y 5301 Puntos
[22:23] Caracol}Elocuente 3 Pista: MAX **A*** 15 segundos y 5301 Puntos [22:23] Caracol}Elocuente
3 Pista: MAX **A*** 15 segundos y 5301 Puntos
[22:24] Caracol}Elocuente Tiempo! La respuesta es -> MAX�LANCK <- [22:24] Caracol}Elocuente
Tiempo! La respuesta es -> MAX�LANCK <-
[22:24] Caracol}Elocuente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [22:24] Caracol}Elocuente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[22:24] Caracol}Elocuente Tri.6205 Arteɤassler˿C󭯃01usebllamafeltefectoudebaplicaraunasupiezasudebmaderafcontrafotras,hdebmanerafquebsusufibrasuest鮃01ccruzadas?h?h [22:24] Caracol}Elocuente
Tri.6205 Arteɤassler˿C󭯃01usebllamafeltefectoudebaplicaraunasupiezasudebmaderafcontrafotras,hdebmanerafquebsusufibrasuest鮃01ccruzadas?h?h
[22:24] Caracol}Elocuente 1 Pista: ********** Valor pregunta : 14750 Puntos [22:24] Caracol}Elocuente
1 Pista: ********** Valor pregunta : 14750 Puntos
[22:24] Caracol}Elocuente 2 Pista: con******* 30 segundos y 14750 Puntos [22:24] Caracol}Elocuente
2 Pista: con******* 30 segundos y 14750 Puntos
[22:24] Caracol}Elocuente 3 Pista: con**a*ea* 15 segundos y 14750 Puntos [22:24] Caracol}Elocuente
3 Pista: con**a*ea* 15 segundos y 14750 Puntos
[22:24] Caracol}Elocuente Tiempo! La respuesta es -> contrapear <- [22:24] Caracol}Elocuente
Tiempo! La respuesta es -> contrapear <-
[22:25] Caracol}Elocuente R᮫ing MES: - #1: Grillo{Naranja 15464851 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2369018 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 685511 [22:25] Caracol}Elocuente
R᮫ing MES: - #1: Grillo{Naranja 15464851 #2: Gladiadora_del_Caribe 9371596 #3: Paulus 2951165 #4: hombre_bcn_48 2846647 #5: siva- 2397196 #6: Jirafa\Letal 2369018 #7: Danielitto 1543578 #8: Ketzy 883747 #9: Ositapolar 715818 #10: Caiman_Enorme 685511
[22:25] Caracol}Elocuente Tri.19023 Geografiaɓebosin˿Enmelgestuariotdeequ郰1er�01tseeencuentraselgllamadotMarsdeelasPaja?e?e [22:25] Caracol}Elocuente
Tri.19023 Geografiaɓebosin˿Enmelgestuariotdeequ郰1er�01tseeencuentraselgllamadotMarsdeelasPaja?e?e
[22:25] Caracol}Elocuente 1 Pista: **** Valor pregunta : 14843 Puntos [22:25] Caracol}Elocuente
1 Pista: **** Valor pregunta : 14843 Puntos
[22:25] Caracol}Elocuente 2 Pista: taj* 30 segundos y 14843 Puntos [22:25] Caracol}Elocuente
2 Pista: taj* 30 segundos y 14843 Puntos
[22:25] Caracol}Elocuente 3 Pista: tajo 15 segundos y 14843 Puntos [22:25] Caracol}Elocuente
3 Pista: tajo 15 segundos y 14843 Puntos
[22:25] Caracol}Elocuente Tiempo! La respuesta es -> tajo <- [22:25] Caracol}Elocuente
Tiempo! La respuesta es -> tajo <-
[22:26] Caracol}Elocuente Please refrain from using Extreme Bad Language [22:26] Caracol}Elocuente
Please refrain from using Extreme Bad Language
[22:26] Caracol}Elocuente Tri.9217 Geografiaɂatval˿COMOwSEwLLAMAwLAwPROFUNDIDADwMAXIMAwDELwMEDITERRANEOw(5.212wMETROS)w?w [22:26] Caracol}Elocuente
Tri.9217 Geografiaɂatval˿COMOwSEwLLAMAwLAwPROFUNDIDADwMAXIMAwDELwMEDITERRANEOw(5.212wMETROS)w?w
[22:26] Caracol}Elocuente 1 Pista: **** ** ******* Valor pregunta : 22431 Puntos [22:26] Caracol}Elocuente
1 Pista: **** ** ******* Valor pregunta : 22431 Puntos
[22:26] Caracol}Elocuente 2 Pista: fos* ** ******* 30 segundos y 22431 Puntos [22:26] Caracol}Elocuente
2 Pista: fos* ** ******* 30 segundos y 22431 Puntos
[22:26] Caracol}Elocuente 3 Pista: fosa *e *a*a*a* 15 segundos y 22431 Puntos [22:26] Caracol}Elocuente
3 Pista: fosa *e *a*a*a* 15 segundos y 22431 Puntos
[22:26] Caracol}Elocuente Tiempo! La respuesta es -> fosa�e�atapan <- [22:26] Caracol}Elocuente
Tiempo! La respuesta es -> fosa�e�atapan <-
[22:26] Caracol}Elocuente This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente [22:26] Caracol}Elocuente
This is #Mexico, I am your host Caracol}Elocuente, running Caracol}Elocuente
[22:26] Caracol}Elocuente Tri.12648 IdiomasɎAPINE˿ELABORAuLOSuDICCIONARIOSu?u [22:26] Caracol}Elocuente
Tri.12648 IdiomasɎAPINE˿ELABORAuLOSuDICCIONARIOSu?u
[22:26] Caracol}Elocuente 1 Pista: *********** Valor pregunta : 12153 Puntos [22:26] Caracol}Elocuente
1 Pista: *********** Valor pregunta : 12153 Puntos
[22:27] Caracol}Elocuente 2 Pista: lex******** 30 segundos y 12153 Puntos [22:27] Caracol}Elocuente
2 Pista: lex******** 30 segundos y 12153 Puntos
[22:27] Caracol}Elocuente 3 Pista: lexi*o**a*o 15 segundos y 12153 Puntos [22:27] Caracol}Elocuente
3 Pista: lexi*o**a*o 15 segundos y 12153 Puntos
[22:27] Caracol}Elocuente Tiempo! La respuesta es -> lexicografo <- [22:27] Caracol}Elocuente
Tiempo! La respuesta es -> lexicografo <-
[22:27] Caracol}Elocuente This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeonBrillante 59328 #14: Grillo-Locuaz 23731 #15: LeCaTwaLk_z 19830 #16: FANTASMAMEXICO 5048 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [22:27] Caracol}Elocuente
This WEEKS Top 11-20: - #11: Moog 180382 #12: wilby 171689 #13: LeonBrillante 59328 #14: Grillo-Locuaz 23731 #15: LeCaTwaLk_z 19830 #16: FANTASMAMEXICO 5048 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[22:27] Caracol}Elocuente Tri.16564 Literaturaɲaziel9˿Comolllamamosbaolaofiguraoliterariaoquepempleaorepetidamenteplasbconjuncionesbparaodarhfuerzaoaolaoexpresionydeplosbconceptos?b?b [22:27] Caracol}Elocuente
Tri.16564 Literaturaɲaziel9˿Comolllamamosbaolaofiguraoliterariaoquepempleaorepetidamenteplasbconjuncionesbparaodarhfuerzaoaolaoexpresionydeplosbconceptos?b?b
[22:27] Caracol}Elocuente 1 Pista: ************ Valor pregunta : 6740 Puntos [22:27] Caracol}Elocuente
1 Pista: ************ Valor pregunta : 6740 Puntos
[22:28] Caracol}Elocuente 2 Pista: pol********* 30 segundos y 6740 Puntos [22:28] Caracol}Elocuente
2 Pista: pol********* 30 segundos y 6740 Puntos
[22:28] Caracol}Elocuente 3 Pista: poli*i**e*o* 15 segundos y 6740 Puntos [22:28] Caracol}Elocuente
3 Pista: poli*i**e*o* 15 segundos y 6740 Puntos
[22:28] Caracol}Elocuente Tiempo! La respuesta es -> polisindeton <- [22:28] Caracol}Elocuente
Tiempo! La respuesta es -> polisindeton <-
[22:28] Caracol}Elocuente Please remember this is a FREE service, Please do not complain [22:28] Caracol}Elocuente
Please remember this is a FREE service, Please do not complain
[22:28] Caracol}Elocuente Tri.4629 Arteɓsurfer˿Catedralpdee1221,lunoedeelosvmejoresvejemplosvdeearquitecturaoGoticao?l [22:28] Caracol}Elocuente
Tri.4629 Arteɓsurfer˿Catedralpdee1221,lunoedeelosvmejoresvejemplosvdeearquitecturaoGoticao?l
[22:28] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 14373 Puntos [22:28] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 14373 Puntos
[22:29] Caracol}Elocuente 2 Pista: bur*** 30 segundos y 14373 Puntos [22:29] Caracol}Elocuente
2 Pista: bur*** 30 segundos y 14373 Puntos
[22:29] Caracol}Elocuente 3 Pista: bur*o* 15 segundos y 14373 Puntos [22:29] Caracol}Elocuente
3 Pista: bur*o* 15 segundos y 14373 Puntos
[22:29] Caracol}Elocuente Tiempo! La respuesta es -> burgos <- [22:29] Caracol}Elocuente
Tiempo! La respuesta es -> burgos <-
[22:29] Caracol}Elocuente This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: LeonBrillante 59328 [22:29] Caracol}Elocuente
This MONTHS Top 11-20: - #11: wilby 597825 #12: Cosmo 285557 #13: Karen 285487 #14: Gladiadora_del_Caribe95 276694 #15: Alii 264411 #16: KaZuMa_KiRyU 257930 #17: Nyffa 217376 #18: Moog 180382 #19: lindisita1 83421 #20: LeonBrillante 59328
[22:29] Caracol}Elocuente Tri.8163 Literaturaɴierra-media˔olkien:xCompleta:xSietesparaqlosrse񯲥srenanosr?x [22:29] Caracol}Elocuente
Tri.8163 Literaturaɴierra-media˔olkien:xCompleta:xSietesparaqlosrse񯲥srenanosr?x
[22:29] Caracol}Elocuente 1 Pista: ** ***** ** ****** Valor pregunta : 20737 Puntos [22:29] Caracol}Elocuente
1 Pista: ** ***** ** ****** Valor pregunta : 20737 Puntos
[22:29] Caracol}Elocuente 2 Pista: en�**** ** ****** 30 segundos y 20737 Puntos [22:29] Caracol}Elocuente
2 Pista: en�**** ** ****** 30 segundos y 20737 Puntos
[22:30] Caracol}Elocuente 3 Pista: en�a*a* *e *ie**a 15 segundos y 20737 Puntos [22:30] Caracol}Elocuente
3 Pista: en�a*a* *e *ie**a 15 segundos y 20737 Puntos
[22:30] Caracol}Elocuente Tiempo! La respuesta es -> en�asas�e�iedra <- [22:30] Caracol}Elocuente
Tiempo! La respuesta es -> en�asas�e�iedra <-
[22:30] Caracol}Elocuente R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206 [22:30] Caracol}Elocuente
R᮫ing �ltima SEMANA: #1: Grillo{Naranja 8723502 #2: Gladiadora_del_Caribe 5147723 #3: hombre_bcn_48 1698206
[22:30] Caracol}Elocuente Tri.5964 Medicina-SaludɍARdeJAVA˄OLORcESPASMӄICOcINTENSOcENcLAcESPALDAcQUEcIRRADIAcHACIEcELcABDOMENcYcLAcVEJIGAcURINARIAcEcINDICAcMUCHAScVECEScLAcEXISTENCIAcDEcUNcC�CULOcRENAL,cUNcTUMORcRENAL,cUNcCӌICOcBILIAR,cPEROcTAMBIɎcPUEDEcINDICARcUNcLUMBAGO,cUN [22:30] Caracol}Elocuente
Tri.5964 Medicina-SaludɍARdeJAVA˄OLORcESPASMӄICOcINTENSOcENcLAcESPALDAcQUEcIRRADIAcHACIEcELcABDOMENcYcLAcVEJIGAcURINARIAcEcINDICAcMUCHAScVECEScLAcEXISTENCIAcDEcUNcC�CULOcRENAL,cUNcTUMORcRENAL,cUNcCӌICOcBILIAR,cPEROcTAMBIɎcPUEDEcINDICARcUNcLUMBAGO,cUN
[22:30] Caracol}Elocuente 1 Pista: ****** Valor pregunta : 19464 Puntos [22:30] Caracol}Elocuente
1 Pista: ****** Valor pregunta : 19464 Puntos
[22:30] Caracol}Elocuente 2 Pista: col*** 30 segundos y 19464 Puntos [22:30] Caracol}Elocuente
2 Pista: col*** 30 segundos y 19464 Puntos
[22:31] Caracol}Elocuente 3 Pista: coli*o 15 segundos y 19464 Puntos [22:31] Caracol}Elocuente
3 Pista: coli*o 15 segundos y 19464 Puntos
[22:31] Caracol}Elocuente Tiempo! La respuesta es -> colico <- [22:31] Caracol}Elocuente
Tiempo! La respuesta es -> colico <-
[22:31] Caracol}Elocuente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [22:31] Caracol}Elocuente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[22:31] Caracol}Elocuente Tri.5609 CineɌopes_˿Cualperalelpplatojpredilectojdelpmonstruojdeo'LoswGoonies'o?o [22:31] Caracol}Elocuente
Tri.5609 CineɌopes_˿Cualperalelpplatojpredilectojdelpmonstruojdeo'LoswGoonies'o?o
[22:31] Caracol}Elocuente 1 Pista: ********* Valor pregunta : 21689 Puntos [22:31] Caracol}Elocuente
1 Pista: ********* Valor pregunta : 21689 Puntos
[22:31] Caracol}Elocuente 2 Pista: cho****** 30 segundos y 21689 Puntos [22:31] Caracol}Elocuente
2 Pista: cho****** 30 segundos y 21689 Puntos
[22:32] Caracol}Elocuente 3 Pista: cho*o*a*e 15 segundos y 21689 Puntos [22:32] Caracol}Elocuente
3 Pista: cho*o*a*e 15 segundos y 21689 Puntos
[22:32] Caracol}Elocuente Tiempo! La respuesta es -> chocolate <- [22:32] Caracol}Elocuente
Tiempo! La respuesta es -> chocolate <-
[22:32] Caracol}Elocuente Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar [22:32] Caracol}Elocuente
Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar
| Compartir en: