Historia de #mexico 07/03/2026 03:06 1 visitas

Reportar Volver Historia anterior Historia siguiente
Hour Alias Mensaje Mensaje
[03:06] Mosca{ConInquietud !jugar [03:06] Mosca{ConInquietud
!jugar
[03:06] HipopotamoConPrisa EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!! [03:06] HipopotamoConPrisa
EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!!
[03:07] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [03:07] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[03:07] HipopotamoConPrisa Tri.12733 InformaticaɌucky_LuK˿DEBIANvESvUNAvDISTRIBUCIONvDELvSISTEMAvOPERATIVOv?v [03:07] HipopotamoConPrisa
Tri.12733 InformaticaɌucky_LuK˿DEBIANvESvUNAvDISTRIBUCIONvDELvSISTEMAvOPERATIVOv?v
[03:07] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 18786 Puntos [03:07] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 18786 Puntos
[03:07] HipopotamoConPrisa 2 Pista: lin** 30 segundos y 18786 Puntos [03:07] HipopotamoConPrisa
2 Pista: lin** 30 segundos y 18786 Puntos
[03:07] HipopotamoConPrisa 3 Pista: linu* 15 segundos y 18786 Puntos [03:07] HipopotamoConPrisa
3 Pista: linu* 15 segundos y 18786 Puntos
[03:07] HipopotamoConPrisa Tiempo! La respuesta es -> linux <- [03:07] HipopotamoConPrisa
Tiempo! La respuesta es -> linux <-
[03:07] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:07] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:07] HipopotamoConPrisa Tri.14322 Miscelaneaɓebosin˿(Religi󮩌otdtuvoidosthijos,jqueynacieronqdelmincestoiconqsustdosthijas.j߃󭯃01iseyllamabanqlostsusodichosthijostqueytuvoiLot?j?j [03:07] HipopotamoConPrisa
Tri.14322 Miscelaneaɓebosin˿(Religi󮩌otdtuvoidosthijos,jqueynacieronqdelmincestoiconqsustdosthijas.j߃󭯃01iseyllamabanqlostsusodichosthijostqueytuvoiLot?j?j
[03:07] HipopotamoConPrisa 1 Pista: **** * *** **** Valor pregunta : 7804 Puntos [03:07] HipopotamoConPrisa
1 Pista: **** * *** **** Valor pregunta : 7804 Puntos
[03:08] HipopotamoConPrisa 2 Pista: moa* * *** **** 30 segundos y 7804 Puntos [03:08] HipopotamoConPrisa
2 Pista: moa* * *** **** 30 segundos y 7804 Puntos
[03:08] HipopotamoConPrisa 3 Pista: moa* * *e* a**i 15 segundos y 7804 Puntos [03:08] HipopotamoConPrisa
3 Pista: moa* * *e* a**i 15 segundos y 7804 Puntos
[03:08] HipopotamoConPrisa Tiempo! La respuesta es -> moab��en�mmi <- [03:08] HipopotamoConPrisa
Tiempo! La respuesta es -> moab��en�mmi <-
[03:08] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:08] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:08] HipopotamoConPrisa Tri.6380 MitologiaɆrigotora˿HermanonderYocasta?x?x [03:08] HipopotamoConPrisa
Tri.6380 MitologiaɆrigotora˿HermanonderYocasta?x?x
[03:08] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 10864 Puntos [03:08] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 10864 Puntos
[03:09] HipopotamoConPrisa 2 Pista: cre**** 30 segundos y 10864 Puntos [03:09] HipopotamoConPrisa
2 Pista: cre**** 30 segundos y 10864 Puntos
[03:09] HipopotamoConPrisa 3 Pista: creo**e 15 segundos y 10864 Puntos [03:09] HipopotamoConPrisa
3 Pista: creo**e 15 segundos y 10864 Puntos
[03:09] HipopotamoConPrisa Tiempo! La respuesta es -> creonte <- [03:09] HipopotamoConPrisa
Tiempo! La respuesta es -> creonte <-
[03:09] HipopotamoConPrisa R᮫ing SEMANA: - #1: Mosca{ConInquietud 12247445 #2: Hipopotamo\Especial 11756114 #3: Lince{Torpe 4962118 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [03:09] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Mosca{ConInquietud 12247445 #2: Hipopotamo\Especial 11756114 #3: Lince{Torpe 4962118 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[03:09] HipopotamoConPrisa Tri.2493 Politicaɡnghara˿Cuᬃ01jfuehlalmḩmalgraduaci󮃰1fmilitarequehconsigui󃰱oFelipehGonzᬥzodurantehsuxserviciozmilitare?o [03:09] HipopotamoConPrisa
Tri.2493 Politicaɡnghara˿Cuᬃ01jfuehlalmḩmalgraduaci󮃰1fmilitarequehconsigui󃰱oFelipehGonzᬥzodurantehsuxserviciozmilitare?o
[03:09] HipopotamoConPrisa 1 Pista: ******* Pregunta de BONUS : 50000 Puntos [03:09] HipopotamoConPrisa
1 Pista: ******* Pregunta de BONUS : 50000 Puntos
[03:10] HipopotamoConPrisa 2 Pista: alf**** 30 segundos y 50000 Puntos [03:10] HipopotamoConPrisa
2 Pista: alf**** 30 segundos y 50000 Puntos
[03:10] HipopotamoConPrisa 3 Pista: alfe*e* 15 segundos y 50000 Puntos [03:10] HipopotamoConPrisa
3 Pista: alfe*e* 15 segundos y 50000 Puntos
[03:10] HipopotamoConPrisa Tiempo! La respuesta es -> alferez <- [03:10] HipopotamoConPrisa
Tiempo! La respuesta es -> alferez <-
[03:10] HipopotamoConPrisa We feature over 50,000 Q&A ! [03:10] HipopotamoConPrisa
We feature over 50,000 Q&A !
[03:10] HipopotamoConPrisa Tri.97 Fisica-Quimicaɨupper˿CUANTOSrOHMIOSrTENDRArUNArRESISTENCIArDErCOLORrMARRONrNEGROrNARANJA?r?r [03:10] HipopotamoConPrisa
Tri.97 Fisica-Quimicaɨupper˿CUANTOSrOHMIOSrTENDRArUNArRESISTENCIArDErCOLORrMARRONrNEGROrNARANJA?r?r
[03:10] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 5132 Puntos [03:10] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 5132 Puntos
[03:10] HipopotamoConPrisa 2 Pista: 100** 30 segundos y 5132 Puntos [03:10] HipopotamoConPrisa
2 Pista: 100** 30 segundos y 5132 Puntos
[03:11] HipopotamoConPrisa 3 Pista: 100** 15 segundos y 5132 Puntos [03:11] HipopotamoConPrisa
3 Pista: 100** 15 segundos y 5132 Puntos
[03:11] HipopotamoConPrisa Tiempo! La respuesta es -> 10000 <- [03:11] HipopotamoConPrisa
Tiempo! La respuesta es -> 10000 <-
[03:11] HipopotamoConPrisa Tri.18429 Geografiaɳhasha˿CU�fesilasislasM�fgrandeqdellmarcmediterrᮥo?f?f [03:11] HipopotamoConPrisa
Tri.18429 Geografiaɳhasha˿CU�fesilasislasM�fgrandeqdellmarcmediterrᮥo?f?f
[03:11] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 14311 Puntos [03:11] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 14311 Puntos
[03:11] HipopotamoConPrisa 2 Pista: sic**** 30 segundos y 14311 Puntos [03:11] HipopotamoConPrisa
2 Pista: sic**** 30 segundos y 14311 Puntos
[03:12] HipopotamoConPrisa 3 Pista: sici*ia 15 segundos y 14311 Puntos [03:12] HipopotamoConPrisa
3 Pista: sici*ia 15 segundos y 14311 Puntos
[03:12] HipopotamoConPrisa Tiempo! La respuesta es -> sicilia <- [03:12] HipopotamoConPrisa
Tiempo! La respuesta es -> sicilia <-
[03:12] HipopotamoConPrisa Tri.19722 BiologiaɎEVIVA˿CuᬅSiSONiLASiDOSiALDOTETROSASiEXISTENTES?i?i [03:12] HipopotamoConPrisa
Tri.19722 BiologiaɎEVIVA˿CuᬅSiSONiLASiDOSiALDOTETROSASiEXISTENTES?i?i
[03:12] HipopotamoConPrisa 1 Pista: ****** * ******** Valor pregunta : 16867 Puntos [03:12] HipopotamoConPrisa
1 Pista: ****** * ******** Valor pregunta : 16867 Puntos
[03:12] HipopotamoConPrisa 2 Pista: tre*** * ******** 30 segundos y 16867 Puntos [03:12] HipopotamoConPrisa
2 Pista: tre*** * ******** 30 segundos y 16867 Puntos
[03:13] HipopotamoConPrisa 3 Pista: treo*a * e*i**o*a 15 segundos y 16867 Puntos [03:13] HipopotamoConPrisa
3 Pista: treo*a * e*i**o*a 15 segundos y 16867 Puntos
[03:13] HipopotamoConPrisa Tiempo! La respuesta es -> treosa��ritrosa <- [03:13] HipopotamoConPrisa
Tiempo! La respuesta es -> treosa��ritrosa <-
[03:13] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [03:13] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[03:13] HipopotamoConPrisa Tri.9347 LiteraturaɔeLaRaNhA˿Autorndef"mortaleyjrosa"b?b [03:13] HipopotamoConPrisa
Tri.9347 LiteraturaɔeLaRaNhA˿Autorndef"mortaleyjrosa"b?b
[03:13] HipopotamoConPrisa 1 Pista: ********* ****** Valor pregunta : 10036 Puntos [03:13] HipopotamoConPrisa
1 Pista: ********* ****** Valor pregunta : 10036 Puntos
[03:13] HipopotamoConPrisa 2 Pista: fra****** ****** 30 segundos y 10036 Puntos [03:13] HipopotamoConPrisa
2 Pista: fra****** ****** 30 segundos y 10036 Puntos
[03:14] HipopotamoConPrisa 3 Pista: fra**i**o u***a* 15 segundos y 10036 Puntos [03:14] HipopotamoConPrisa
3 Pista: fra**i**o u***a* 15 segundos y 10036 Puntos
[03:14] HipopotamoConPrisa Tiempo! La respuesta es -> francisco�mbral <- [03:14] HipopotamoConPrisa
Tiempo! La respuesta es -> francisco�mbral <-
[03:14] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [03:14] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[03:14] HipopotamoConPrisa Tri.4900 Geografiaɳorgo˿LASbESCLUSASbDEbMIRAFLORESbLASbENCONTRAMOSbENbEL:b?b [03:14] HipopotamoConPrisa
Tri.4900 Geografiaɳorgo˿LASbESCLUSASbDEbMIRAFLORESbLASbENCONTRAMOSbENbEL:b?b
[03:14] HipopotamoConPrisa 1 Pista: ***** ** ****** Pregunta de BONUS : 100000 Puntos [03:14] HipopotamoConPrisa
1 Pista: ***** ** ****** Pregunta de BONUS : 100000 Puntos
[03:14] HipopotamoConPrisa 2 Pista: can** ** ****** 30 segundos y 100000 Puntos [03:14] HipopotamoConPrisa
2 Pista: can** ** ****** 30 segundos y 100000 Puntos
[03:14] HipopotamoConPrisa 3 Pista: cana* *e *a*a*a 15 segundos y 100000 Puntos [03:14] HipopotamoConPrisa
3 Pista: cana* *e *a*a*a 15 segundos y 100000 Puntos
[03:14] Hipopotamo\Especial canal de panama [03:14] Hipopotamo\Especial
canal de panama
[03:14] HipopotamoConPrisa �Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "canal de panama" era la respuesta? Venga, �00000�12 puntos suben a tu marcador [03:14] HipopotamoConPrisa
�Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "canal de panama" era la respuesta? Venga, �00000�12 puntos suben a tu marcador
[03:14] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 100000, SEMANA: 11856114 y MES: 11856114 [03:14] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 100000, SEMANA: 11856114 y MES: 11856114
[03:15] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [03:15] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[03:15] HipopotamoConPrisa Tri.2016 IdiomasɁigua˿ENIGMAvOvADIVINANZAvQUEvENTRETIENEvYvDIVIERTEv?v [03:15] HipopotamoConPrisa
Tri.2016 IdiomasɁigua˿ENIGMAvOvADIVINANZAvQUEvENTRETIENEvYvDIVIERTEv?v
[03:15] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 8466 Puntos [03:15] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 8466 Puntos
[03:15] HipopotamoConPrisa 2 Pista: ace***** 30 segundos y 8466 Puntos [03:15] HipopotamoConPrisa
2 Pista: ace***** 30 segundos y 8466 Puntos
[03:15] Hipopotamo\Especial acertijo [03:15] Hipopotamo\Especial
acertijo
[03:15] HipopotamoConPrisa �Muy bien Hipopotamo\Especial!! Acertaste "acertijo" en tan s󬯠�6.015 segundos y por eso has ganado: �466�12 puntos [03:15] HipopotamoConPrisa
�Muy bien Hipopotamo\Especial!! Acertaste "acertijo" en tan s󬯠�6.015 segundos y por eso has ganado: �466�12 puntos
[03:15] HipopotamoConPrisa Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 108466, SEMANA: 11864580 y MES: 11864580 [03:15] HipopotamoConPrisa
Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 108466, SEMANA: 11864580 y MES: 11864580
[03:15] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [03:15] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[03:15] HipopotamoConPrisa Tri.19098 MitologiaɄivah˿GRECIA:LUGARnSUBTERRaNEOnQUEnSEnENCONTRABAnDEBAJOnDEnHADESn?n [03:15] HipopotamoConPrisa
Tri.19098 MitologiaɄivah˿GRECIA:LUGARnSUBTERRaNEOnQUEnSEnENCONTRABAnDEBAJOnDEnHADESn?n
[03:15] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 15974 Puntos [03:15] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 15974 Puntos
[03:15] HipopotamoConPrisa 2 Pista: tar**** 30 segundos y 15974 Puntos [03:15] HipopotamoConPrisa
2 Pista: tar**** 30 segundos y 15974 Puntos
[03:16] HipopotamoConPrisa 3 Pista: tar*a*o 15 segundos y 15974 Puntos [03:16] HipopotamoConPrisa
3 Pista: tar*a*o 15 segundos y 15974 Puntos
[03:16] HipopotamoConPrisa Tiempo! La respuesta es -> tartaro <- [03:16] HipopotamoConPrisa
Tiempo! La respuesta es -> tartaro <-
[03:16] HipopotamoConPrisa For The Competitive Edge type !pingme [03:16] HipopotamoConPrisa
For The Competitive Edge type !pingme
[03:16] HipopotamoConPrisa Tri.20293 Deporteɭartuniki˿DeCADAiENiLAiQUEiALiMADRIDiSEiLEiCONCEDEiELiTiTULOiDEiREALi?i [03:16] HipopotamoConPrisa
Tri.20293 Deporteɭartuniki˿DeCADAiENiLAiQUEiALiMADRIDiSEiLEiCONCEDEiELiTiTULOiDEiREALi?i
[03:16] HipopotamoConPrisa 1 Pista: ****** Valor pregunta : 24436 Puntos [03:16] HipopotamoConPrisa
1 Pista: ****** Valor pregunta : 24436 Puntos
[03:16] HipopotamoConPrisa 2 Pista: vei*** 30 segundos y 24436 Puntos [03:16] HipopotamoConPrisa
2 Pista: vei*** 30 segundos y 24436 Puntos
[03:17] Hipopotamo\Especial veinte [03:17] Hipopotamo\Especial
veinte
[03:17] HipopotamoConPrisa �Increible!! Hipopotamo\Especial contest󺠃04"veinte" en �9.062 segundos, y ha ganado �4436�12 puntos [03:17] HipopotamoConPrisa
�Increible!! Hipopotamo\Especial contest󺠃04"veinte" en �9.062 segundos, y ha ganado �4436�12 puntos
[03:17] HipopotamoConPrisa Hipopotamo\Especial has acertado 3 seguidas!! Puntos HOY: 132902, SEMANA: 11889016 y MES: 11889016 [03:17] HipopotamoConPrisa
Hipopotamo\Especial has acertado 3 seguidas!! Puntos HOY: 132902, SEMANA: 11889016 y MES: 11889016
[03:17] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:17] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:17] HipopotamoConPrisa Tri.14323 Miscelaneaɐsico666ˣonjuntocdeqmueblesddequnalcasal?r [03:17] HipopotamoConPrisa
Tri.14323 Miscelaneaɐsico666ˣonjuntocdeqmueblesddequnalcasal?r
[03:17] HipopotamoConPrisa 1 Pista: ********** Valor pregunta : 15375 Puntos [03:17] HipopotamoConPrisa
1 Pista: ********** Valor pregunta : 15375 Puntos
[03:17] HipopotamoConPrisa 2 Pista: mob******* 30 segundos y 15375 Puntos [03:17] HipopotamoConPrisa
2 Pista: mob******* 30 segundos y 15375 Puntos
[03:17] Hipopotamo\Especial mobiliario [03:17] Hipopotamo\Especial
mobiliario
[03:17] HipopotamoConPrisa �As�e hace Hipopotamo\Especial!! Contestaste "mobiliario" en �1.75 segundos y sumas �5375�12 puntos [03:17] HipopotamoConPrisa
�As�e hace Hipopotamo\Especial!! Contestaste "mobiliario" en �1.75 segundos y sumas �5375�12 puntos
[03:17] HipopotamoConPrisa Hipopotamo\Especial has acertado 4 seguidas!! Puntos HOY: 148277, SEMANA: 11904391 y MES: 11904391 [03:17] HipopotamoConPrisa
Hipopotamo\Especial has acertado 4 seguidas!! Puntos HOY: 148277, SEMANA: 11904391 y MES: 11904391
[03:17] HipopotamoConPrisa R᮫ing MES: - #1: Mosca{ConInquietud 12247445 #2: Hipopotamo\Especial 11889016 #3: Lince{Torpe 4962118 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [03:17] HipopotamoConPrisa
R᮫ing MES: - #1: Mosca{ConInquietud 12247445 #2: Hipopotamo\Especial 11889016 #3: Lince{Torpe 4962118 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[03:17] HipopotamoConPrisa Tri.13950 EconomiaɊarreando˿Enrqu郰1dmercadorseknegocianrlasmLetrasmdelkTesoro,dcertificadosmdekdep󳩴os,dpagar鳃01mdekempresa,dpagar鳃01mbancarios,dt�losmhipotecariosmykbonosmbancarios?d?d [03:17] HipopotamoConPrisa
Tri.13950 EconomiaɊarreando˿Enrqu郰1dmercadorseknegocianrlasmLetrasmdelkTesoro,dcertificadosmdekdep󳩴os,dpagar鳃01mdekempresa,dpagar鳃01mbancarios,dt�losmhipotecariosmykbonosmbancarios?d?d
[03:17] HipopotamoConPrisa 1 Pista: ******* ********* Valor pregunta : 8025 Puntos [03:17] HipopotamoConPrisa
1 Pista: ******* ********* Valor pregunta : 8025 Puntos
[03:18] HipopotamoConPrisa 2 Pista: mer**** ********* 30 segundos y 8025 Puntos [03:18] HipopotamoConPrisa
2 Pista: mer**** ********* 30 segundos y 8025 Puntos
[03:18] HipopotamoConPrisa 3 Pista: mer*a*o *o*e*a*io 15 segundos y 8025 Puntos [03:18] HipopotamoConPrisa
3 Pista: mer*a*o *o*e*a*io 15 segundos y 8025 Puntos
[03:18] Hipopotamo\Especial mercado monetario [03:18] Hipopotamo\Especial
mercado monetario
[03:18] HipopotamoConPrisa �Eso es Hipopotamo\Especial!! Dijiste: "mercado monetario" y ello te ha valido: �025�12 puntos [03:18] HipopotamoConPrisa
�Eso es Hipopotamo\Especial!! Dijiste: "mercado monetario" y ello te ha valido: �025�12 puntos
[03:18] HipopotamoConPrisa Hipopotamo\Especial has acertado 5 seguidas!! Puntos HOY: 156302, SEMANA: 11912416 y MES: 11912416 [03:18] HipopotamoConPrisa
Hipopotamo\Especial has acertado 5 seguidas!! Puntos HOY: 156302, SEMANA: 11912416 y MES: 11912416
[03:18] HipopotamoConPrisa Please refrain from using Extreme Bad Language [03:18] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[03:18] HipopotamoConPrisa Tri.309 Informaticaɴjmm.com˿Acvereesoshcerebritos:cElen�merozbinarioz11000001csexexpresapencnumeraci󮃰1cdecimalecomo....c?c [03:18] HipopotamoConPrisa
Tri.309 Informaticaɴjmm.com˿Acvereesoshcerebritos:cElen�merozbinarioz11000001csexexpresapencnumeraci󮃰1cdecimalecomo....c?c
[03:18] HipopotamoConPrisa 1 Pista: *** Valor pregunta : 21395 Puntos [03:18] HipopotamoConPrisa
1 Pista: *** Valor pregunta : 21395 Puntos
[03:18] HipopotamoConPrisa 2 Pista: 193 30 segundos y 21395 Puntos [03:18] HipopotamoConPrisa
2 Pista: 193 30 segundos y 21395 Puntos
[03:18] HipopotamoConPrisa �Bien Hipopotamo\Especial!! Tu respuesta: "193" es correcta y ganas �1395�12 puntos [03:18] HipopotamoConPrisa
�Bien Hipopotamo\Especial!! Tu respuesta: "193" es correcta y ganas �1395�12 puntos
[03:18] HipopotamoConPrisa Hipopotamo\Especial has acertado 6 seguidas!! Puntos HOY: 177697, SEMANA: 11933811 y MES: 11933811 [03:18] HipopotamoConPrisa
Hipopotamo\Especial has acertado 6 seguidas!! Puntos HOY: 177697, SEMANA: 11933811 y MES: 11933811
[03:18] Hipopotamo\Especial 193 [03:18] Hipopotamo\Especial
193
[03:19] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [03:19] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[03:19] HipopotamoConPrisa Tri.1181 Literaturaɬusie˿Enp1914qpublic󃰱qelhlibroiquevlevhizoic鬥brev:Tarzᮃ01pdevlosrmonosr?q [03:19] HipopotamoConPrisa
Tri.1181 Literaturaɬusie˿Enp1914qpublic󃰱qelhlibroiquevlevhizoic鬥brev:Tarzᮃ01pdevlosrmonosr?q
[03:19] HipopotamoConPrisa 1 Pista: ***** **** ********* Pregunta de BONUS : 100000 Puntos [03:19] HipopotamoConPrisa
1 Pista: ***** **** ********* Pregunta de BONUS : 100000 Puntos
[03:19] HipopotamoConPrisa 2 Pista: Edg** **** ********* 30 segundos y 100000 Puntos [03:19] HipopotamoConPrisa
2 Pista: Edg** **** ********* 30 segundos y 100000 Puntos
[03:19] HipopotamoConPrisa 3 Pista: Edga* *i*e *u**ou*** 15 segundos y 100000 Puntos [03:19] HipopotamoConPrisa
3 Pista: Edga* *i*e *u**ou*** 15 segundos y 100000 Puntos
[03:19] HipopotamoConPrisa Tiempo! La respuesta es -> Edgar�ice�urroughs <- [03:19] HipopotamoConPrisa
Tiempo! La respuesta es -> Edgar�ice�urroughs <-
[03:20] HipopotamoConPrisa This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [03:20] HipopotamoConPrisa
This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[03:20] HipopotamoConPrisa Tri.13160 Biologiaɳherif˿Cuᬃ01yeskelynombrekcient�copdelylincekeuropeo?j?j [03:20] HipopotamoConPrisa
Tri.13160 Biologiaɳherif˿Cuᬃ01yeskelynombrekcient�copdelylincekeuropeo?j?j
[03:20] HipopotamoConPrisa 1 Pista: **** **** Valor pregunta : 8114 Puntos [03:20] HipopotamoConPrisa
1 Pista: **** **** Valor pregunta : 8114 Puntos
[03:20] HipopotamoConPrisa 2 Pista: lyn* **** 30 segundos y 8114 Puntos [03:20] HipopotamoConPrisa
2 Pista: lyn* **** 30 segundos y 8114 Puntos
[03:20] Hipopotamo\Especial lynx lynx [03:20] Hipopotamo\Especial
lynx lynx
[03:20] HipopotamoConPrisa �Absolutamente correcto Hipopotamo\Especial!! Acertaste "lynx lynx" en �6.89 segundos y ganas �114�12 puntos [03:20] HipopotamoConPrisa
�Absolutamente correcto Hipopotamo\Especial!! Acertaste "lynx lynx" en �6.89 segundos y ganas �114�12 puntos
[03:20] HipopotamoConPrisa Hipopotamo\Especial has acertado 7 seguidas!! Puntos HOY: 185811, SEMANA: 11941925 y MES: 11941925 [03:20] HipopotamoConPrisa
Hipopotamo\Especial has acertado 7 seguidas!! Puntos HOY: 185811, SEMANA: 11941925 y MES: 11941925
[03:20] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [03:20] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[03:20] HipopotamoConPrisa Tri.3355 Politicaɭ˿Derechoequemconcedenklosspa�ssaqlossrefugiadosspol�cossdemotrosspa�ss?q [03:20] HipopotamoConPrisa
Tri.3355 Politicaɭ˿Derechoequemconcedenklosspa�ssaqlossrefugiadosspol�cossdemotrosspa�ss?q
[03:20] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 23811 Puntos [03:20] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 23811 Puntos
[03:20] HipopotamoConPrisa 2 Pista: asi** 30 segundos y 23811 Puntos [03:20] HipopotamoConPrisa
2 Pista: asi** 30 segundos y 23811 Puntos
[03:20] HipopotamoConPrisa �e nota que sabes mucho de esto Hipopotamo\Especial! Tu respuesta "asilo" es correcta y ganas �3811�12 puntos [03:20] HipopotamoConPrisa
�e nota que sabes mucho de esto Hipopotamo\Especial! Tu respuesta "asilo" es correcta y ganas �3811�12 puntos
[03:20] HipopotamoConPrisa Hipopotamo\Especial has acertado 8 seguidas!! Puntos HOY: 209622, SEMANA: 11965736 y MES: 11965736 [03:20] HipopotamoConPrisa
Hipopotamo\Especial has acertado 8 seguidas!! Puntos HOY: 209622, SEMANA: 11965736 y MES: 11965736
[03:20] Hipopotamo\Especial asilo [03:20] Hipopotamo\Especial
asilo
[03:21] HipopotamoConPrisa This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [03:21] HipopotamoConPrisa
This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[03:21] HipopotamoConPrisa Tri.5180 Deporteɲaziel9˿BALONCESTO:ENvQUEvEQUIPOvESTABAvENv2003/04vELvJUGADORvSYDNEYvJOHNSONv?v [03:21] HipopotamoConPrisa
Tri.5180 Deporteɲaziel9˿BALONCESTO:ENvQUEvEQUIPOvESTABAvENv2003/04vELvJUGADORvSYDNEYvJOHNSONv?v
[03:21] HipopotamoConPrisa 1 Pista: ********** ****** Valor pregunta : 6375 Puntos [03:21] HipopotamoConPrisa
1 Pista: ********** ****** Valor pregunta : 6375 Puntos
[03:21] HipopotamoConPrisa 2 Pista: cas******* ****** 30 segundos y 6375 Puntos [03:21] HipopotamoConPrisa
2 Pista: cas******* ****** 30 segundos y 6375 Puntos
[03:21] HipopotamoConPrisa 3 Pista: casa*e*o** *i*o*a 15 segundos y 6375 Puntos [03:21] HipopotamoConPrisa
3 Pista: casa*e*o** *i*o*a 15 segundos y 6375 Puntos
[03:21] Hipopotamo\Especial casademont girona [03:21] Hipopotamo\Especial
casademont girona
[03:21] HipopotamoConPrisa �Increible!! Hipopotamo\Especial contest󺠃04"casademont girona" en �0.578 segundos, y ha ganado �375�12 puntos [03:21] HipopotamoConPrisa
�Increible!! Hipopotamo\Especial contest󺠃04"casademont girona" en �0.578 segundos, y ha ganado �375�12 puntos
[03:21] HipopotamoConPrisa Hipopotamo\Especial has acertado 9 seguidas!! Puntos HOY: 215997, SEMANA: 11972111 y MES: 11972111 [03:21] HipopotamoConPrisa
Hipopotamo\Especial has acertado 9 seguidas!! Puntos HOY: 215997, SEMANA: 11972111 y MES: 11972111
[03:21] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [03:21] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[03:21] HipopotamoConPrisa Tri.16633 Eros-SexɁrzobispo˿Comolseollamafalwarteodeofilmarrcuerposddesnudos,mybactosdsexualesd?m [03:21] HipopotamoConPrisa
Tri.16633 Eros-SexɁrzobispo˿Comolseollamafalwarteodeofilmarrcuerposddesnudos,mybactosdsexualesd?m
[03:21] HipopotamoConPrisa 1 Pista: *********** Valor pregunta : 12442 Puntos [03:21] HipopotamoConPrisa
1 Pista: *********** Valor pregunta : 12442 Puntos
[03:22] HipopotamoConPrisa 2 Pista: por******** 30 segundos y 12442 Puntos [03:22] HipopotamoConPrisa
2 Pista: por******** 30 segundos y 12442 Puntos
[03:22] HipopotamoConPrisa 3 Pista: por*o**a*ia 15 segundos y 12442 Puntos [03:22] HipopotamoConPrisa
3 Pista: por*o**a*ia 15 segundos y 12442 Puntos
[03:22] HipopotamoConPrisa �Eso es Hipopotamo\Especial!! Dijiste: "pornografia" y ello te ha valido: �2442�12 puntos [03:22] HipopotamoConPrisa
�Eso es Hipopotamo\Especial!! Dijiste: "pornografia" y ello te ha valido: �2442�12 puntos
[03:22] HipopotamoConPrisa Hipopotamo\Especial has acertado 10 seguidas!! Puntos HOY: 228439, SEMANA: 11984553 y MES: 11984553 [03:22] HipopotamoConPrisa
Hipopotamo\Especial has acertado 10 seguidas!! Puntos HOY: 228439, SEMANA: 11984553 y MES: 11984553
[03:22] HipopotamoConPrisa Bonus especial de 50000 Puntos para Hipopotamo\Especial por acertar 10 seguidas!!! [03:22] HipopotamoConPrisa
Bonus especial de 50000 Puntos para Hipopotamo\Especial por acertar 10 seguidas!!!
[03:22] Hipopotamo\Especial pornografia [03:22] Hipopotamo\Especial
pornografia
[03:22] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:22] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:22] HipopotamoConPrisa Tri.3393 PoliticaɊAVEA˿02/11/99:ENwQUEwCOMUNIDADwESTALLANwDOSwBOMBASwPORwPARTEwDEwLAwETAwANTEwLAwVISITAwDELwPRINCIPEwFELIPEw?w [03:22] HipopotamoConPrisa
Tri.3393 PoliticaɊAVEA˿02/11/99:ENwQUEwCOMUNIDADwESTALLANwDOSwBOMBASwPORwPARTEwDEwLAwETAwANTEwLAwVISITAwDELwPRINCIPEwFELIPEw?w
[03:22] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 9656 Puntos [03:22] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 9656 Puntos
[03:23] HipopotamoConPrisa 2 Pista: ast***** 30 segundos y 9656 Puntos [03:23] HipopotamoConPrisa
2 Pista: ast***** 30 segundos y 9656 Puntos
[03:23] HipopotamoConPrisa �Absolutamente correcto Hipopotamo\Especial!! Acertaste "asturias" en �9.812 segundos y ganas �656�12 puntos [03:23] HipopotamoConPrisa
�Absolutamente correcto Hipopotamo\Especial!! Acertaste "asturias" en �9.812 segundos y ganas �656�12 puntos
[03:23] HipopotamoConPrisa Hipopotamo\Especial has acertado 11 seguidas!! Puntos HOY: 288095, SEMANA: 12044209 y MES: 12044209 [03:23] HipopotamoConPrisa
Hipopotamo\Especial has acertado 11 seguidas!! Puntos HOY: 288095, SEMANA: 12044209 y MES: 12044209
[03:23] Hipopotamo\Especial asturias [03:23] Hipopotamo\Especial
asturias
[03:23] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:23] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:23] HipopotamoConPrisa Tri.8937 Cineɥrboni˿DEkENTREkLASkPAREJASkDEkMARCELLOkMASTROIANNIkENkLAkVIDAkREALkSEkENCUENTRANkLASkACTRICESkCATHERINEkDENEUVEkY...k?k [03:23] HipopotamoConPrisa
Tri.8937 Cineɥrboni˿DEkENTREkLASkPAREJASkDEkMARCELLOkMASTROIANNIkENkLAkVIDAkREALkSEkENCUENTRANkLASkACTRICESkCATHERINEkDENEUVEkY...k?k
[03:23] HipopotamoConPrisa 1 Pista: **** ******* Valor pregunta : 16755 Puntos [03:23] HipopotamoConPrisa
1 Pista: **** ******* Valor pregunta : 16755 Puntos
[03:23] HipopotamoConPrisa 2 Pista: fay* ******* 30 segundos y 16755 Puntos [03:23] HipopotamoConPrisa
2 Pista: fay* ******* 30 segundos y 16755 Puntos
[03:23] HipopotamoConPrisa 3 Pista: faye *u*a*a* 15 segundos y 16755 Puntos [03:23] HipopotamoConPrisa
3 Pista: faye *u*a*a* 15 segundos y 16755 Puntos
[03:24] Gata_Elocuente DJ "elvigilante" abre peticiones [03:24] Gata_Elocuente
DJ "elvigilante" abre peticiones
[03:24] HipopotamoConPrisa Tiempo! La respuesta es -> faye�unaway <- [03:24] HipopotamoConPrisa
Tiempo! La respuesta es -> faye�unaway <-
[03:24] HipopotamoConPrisa R᮫ing SEMANA: - #1: Mosca{ConInquietud 12247445 #2: Hipopotamo\Especial 12044209 #3: Lince{Torpe 4962118 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [03:24] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Mosca{ConInquietud 12247445 #2: Hipopotamo\Especial 12044209 #3: Lince{Torpe 4962118 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[03:24] HipopotamoConPrisa Tri.15410 Cineɓebosin˿Cu᮴osvOscarbconsigui󃰱i"Ben-Hur"ienu1959i?i [03:24] HipopotamoConPrisa
Tri.15410 Cineɓebosin˿Cu᮴osvOscarbconsigui󃰱i"Ben-Hur"ienu1959i?i
[03:24] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 19320 Puntos [03:24] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 19320 Puntos
[03:24] Hipopotamo\Especial tres [03:24] Hipopotamo\Especial
tres
[03:24] Hipopotamo\Especial seis [03:24] Hipopotamo\Especial
seis
[03:24] HipopotamoConPrisa 2 Pista: onc* 30 segundos y 19320 Puntos [03:24] HipopotamoConPrisa
2 Pista: onc* 30 segundos y 19320 Puntos
[03:24] Hipopotamo\Especial once [03:24] Hipopotamo\Especial
once
[03:24] HipopotamoConPrisa �As�e hace Hipopotamo\Especial!! Contestaste "once" en �8.25 segundos y sumas �9320�12 puntos [03:24] HipopotamoConPrisa
�As�e hace Hipopotamo\Especial!! Contestaste "once" en �8.25 segundos y sumas �9320�12 puntos
[03:24] HipopotamoConPrisa Hipopotamo\Especial has acertado 12 seguidas!! Puntos HOY: 307415, SEMANA: 12063529 y MES: 12063529 [03:24] HipopotamoConPrisa
Hipopotamo\Especial has acertado 12 seguidas!! Puntos HOY: 307415, SEMANA: 12063529 y MES: 12063529
[03:24] HipopotamoConPrisa We feature over 50,000 Q&A ! [03:24] HipopotamoConPrisa
We feature over 50,000 Q&A !
[03:24] HipopotamoConPrisa Tri.5973 Idiomasɳtephewo˿Castellanoy-sgallegoy"testiculos"?s?s [03:24] HipopotamoConPrisa
Tri.5973 Idiomasɳtephewo˿Castellanoy-sgallegoy"testiculos"?s?s
[03:24] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 11629 Puntos [03:24] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 11629 Puntos
[03:24] HipopotamoConPrisa 2 Pista: col**** 30 segundos y 11629 Puntos [03:24] HipopotamoConPrisa
2 Pista: col**** 30 segundos y 11629 Puntos
[03:25] HipopotamoConPrisa 3 Pista: col*o** 15 segundos y 11629 Puntos [03:25] HipopotamoConPrisa
3 Pista: col*o** 15 segundos y 11629 Puntos
[03:25] HipopotamoConPrisa Tiempo! La respuesta es -> collons <- [03:25] HipopotamoConPrisa
Tiempo! La respuesta es -> collons <-
[03:25] HipopotamoConPrisa Tri.15629 Deporteɳherif˿(Baloncesto)iߑuefjugadornesxelehandadotmayornnumerotdefasistenciasxengtodanlanhistoriandeflanliganACB?i(updatedr2000)i?i [03:25] HipopotamoConPrisa
Tri.15629 Deporteɳherif˿(Baloncesto)iߑuefjugadornesxelehandadotmayornnumerotdefasistenciasxengtodanlanhistoriandeflanliganACB?i(updatedr2000)i?i
[03:25] HipopotamoConPrisa 1 Pista: ***** **** Valor pregunta : 5679 Puntos [03:25] HipopotamoConPrisa
1 Pista: ***** **** Valor pregunta : 5679 Puntos
[03:25] HipopotamoConPrisa 2 Pista: pab** **** 30 segundos y 5679 Puntos [03:25] HipopotamoConPrisa
2 Pista: pab** **** 30 segundos y 5679 Puntos
[03:26] Hipopotamo\Especial pablo laso [03:26] Hipopotamo\Especial
pablo laso
[03:26] HipopotamoConPrisa �Muy bien Hipopotamo\Especial!! Acertaste "pablo laso" en tan s󬯠�5.156 segundos y por eso has ganado: �679�12 puntos [03:26] HipopotamoConPrisa
�Muy bien Hipopotamo\Especial!! Acertaste "pablo laso" en tan s󬯠�5.156 segundos y por eso has ganado: �679�12 puntos
[03:26] HipopotamoConPrisa Hipopotamo\Especial has acertado 13 seguidas!! Puntos HOY: 313094, SEMANA: 12069208 y MES: 12069208 [03:26] HipopotamoConPrisa
Hipopotamo\Especial has acertado 13 seguidas!! Puntos HOY: 313094, SEMANA: 12069208 y MES: 12069208
[03:26] HipopotamoConPrisa Tri.11275 Gastronomiaɍonteso˿Desquespaisaesaoriginariomeltronb?h [03:26] HipopotamoConPrisa
Tri.11275 Gastronomiaɍonteso˿Desquespaisaesaoriginariomeltronb?h
[03:26] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 19989 Puntos [03:26] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 19989 Puntos
[03:26] HipopotamoConPrisa 2 Pista: jam**** 30 segundos y 19989 Puntos [03:26] HipopotamoConPrisa
2 Pista: jam**** 30 segundos y 19989 Puntos
[03:26] Hipopotamo\Especial jamaica [03:26] Hipopotamo\Especial
jamaica
[03:26] HipopotamoConPrisa �Absolutamente correcto Hipopotamo\Especial!! Acertaste "jamaica" en �2.328 segundos y ganas �9989�12 puntos [03:26] HipopotamoConPrisa
�Absolutamente correcto Hipopotamo\Especial!! Acertaste "jamaica" en �2.328 segundos y ganas �9989�12 puntos
[03:26] HipopotamoConPrisa Hipopotamo\Especial has acertado 14 seguidas!! Puntos HOY: 333083, SEMANA: 12089197 y MES: 12089197 [03:26] HipopotamoConPrisa
Hipopotamo\Especial has acertado 14 seguidas!! Puntos HOY: 333083, SEMANA: 12089197 y MES: 12089197
[03:26] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [03:26] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[03:26] HipopotamoConPrisa Tri.15034 CancionesɃocoman˿Depquientesmlaicanciont"Bolillon"m?m [03:26] HipopotamoConPrisa
Tri.15034 CancionesɃocoman˿Depquientesmlaicanciont"Bolillon"m?m
[03:26] HipopotamoConPrisa 1 Pista: ** ** ***** *** ***** ******** Valor pregunta : 22269 Puntos [03:26] HipopotamoConPrisa
1 Pista: ** ** ***** *** ***** ******** Valor pregunta : 22269 Puntos
[03:26] HipopotamoConPrisa 2 Pista: no�* ***** *** ***** ******** 30 segundos y 22269 Puntos [03:26] HipopotamoConPrisa
2 Pista: no�* ***** *** ***** ******** 30 segundos y 22269 Puntos
[03:27] HipopotamoConPrisa 3 Pista: no�e *i*e* *ue **e*o **a***a* 15 segundos y 22269 Puntos [03:27] HipopotamoConPrisa
3 Pista: no�e *i*e* *ue **e*o **a***a* 15 segundos y 22269 Puntos
[03:27] Hipopotamo\Especial no me pises que llevo chanclas [03:27] Hipopotamo\Especial
no me pises que llevo chanclas
[03:27] HipopotamoConPrisa �Ol頃04Hipopotamo\Especial!! Has contestado: "no me pises que llevo chanclas" en �6.875 segundos y sumas �2269�12 puntos a tu marcador. �Sigue as� [03:27] HipopotamoConPrisa
�Ol頃04Hipopotamo\Especial!! Has contestado: "no me pises que llevo chanclas" en �6.875 segundos y sumas �2269�12 puntos a tu marcador. �Sigue as�
[03:27] HipopotamoConPrisa Hipopotamo\Especial has acertado 15 seguidas!! Puntos HOY: 355352, SEMANA: 12111466 y MES: 12111466 [03:27] HipopotamoConPrisa
Hipopotamo\Especial has acertado 15 seguidas!! Puntos HOY: 355352, SEMANA: 12111466 y MES: 12111466
[03:27] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [03:27] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[03:27] HipopotamoConPrisa Tri.20504 Idiomasɔruchi˿Comocsewdicewvinocenbitalianoc?q [03:27] HipopotamoConPrisa
Tri.20504 Idiomasɔruchi˿Comocsewdicewvinocenbitalianoc?q
[03:27] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 12416 Puntos [03:27] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 12416 Puntos
[03:27] HipopotamoConPrisa 2 Pista: vin* 30 segundos y 12416 Puntos [03:27] HipopotamoConPrisa
2 Pista: vin* 30 segundos y 12416 Puntos
[03:27] Hipopotamo\Especial vino [03:27] Hipopotamo\Especial
vino
[03:27] HipopotamoConPrisa �emuestra lo que sabes Hipopotamo\Especial! Has respondido "vino" correctamente y eso te da: �2416�12 puntos [03:27] HipopotamoConPrisa
�emuestra lo que sabes Hipopotamo\Especial! Has respondido "vino" correctamente y eso te da: �2416�12 puntos
[03:27] HipopotamoConPrisa Hipopotamo\Especial has acertado 16 seguidas!! Puntos HOY: 367768, SEMANA: 12123882 y MES: 12123882 [03:27] HipopotamoConPrisa
Hipopotamo\Especial has acertado 16 seguidas!! Puntos HOY: 367768, SEMANA: 12123882 y MES: 12123882
[03:28] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [03:28] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[03:28] HipopotamoConPrisa Tri.11958 ArteɖaKaMiLKa˿Afqueltreswfaraoneswestanodedicadaswlaswtreswgrandeswpir᭩deswdelGizehqenoEgiptov?f [03:28] HipopotamoConPrisa
Tri.11958 ArteɖaKaMiLKa˿Afqueltreswfaraoneswestanodedicadaswlaswtreswgrandeswpir᭩deswdelGizehqenoEgiptov?f
[03:28] HipopotamoConPrisa 1 Pista: ***** ****** * ********* Valor pregunta : 11120 Puntos [03:28] HipopotamoConPrisa
1 Pista: ***** ****** * ********* Valor pregunta : 11120 Puntos
[03:28] HipopotamoConPrisa 2 Pista: keo** ****** * ********* 30 segundos y 11120 Puntos [03:28] HipopotamoConPrisa
2 Pista: keo** ****** * ********* 30 segundos y 11120 Puntos
[03:28] HipopotamoConPrisa 3 Pista: keo** *e**e* * *i*e*i*o* 15 segundos y 11120 Puntos [03:28] HipopotamoConPrisa
3 Pista: keo** *e**e* * *i*e*i*o* 15 segundos y 11120 Puntos
[03:28] HipopotamoConPrisa Tiempo! La respuesta es -> keops�efren��icerinos <- [03:28] HipopotamoConPrisa
Tiempo! La respuesta es -> keops�efren��icerinos <-
[03:28] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [03:28] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[03:28] HipopotamoConPrisa Tri.18625 Cancionesɰamo˿Debquiencestlaccancionc"Infidelityr(onlyryou)"l?l [03:28] HipopotamoConPrisa
Tri.18625 Cancionesɰamo˿Debquiencestlaccancionc"Infidelityr(onlyryou)"l?l
[03:28] HipopotamoConPrisa 1 Pista: ***** ******* Valor pregunta : 19666 Puntos [03:28] HipopotamoConPrisa
1 Pista: ***** ******* Valor pregunta : 19666 Puntos
[03:29] HipopotamoConPrisa 2 Pista: sku** ******* 30 segundos y 19666 Puntos [03:29] HipopotamoConPrisa
2 Pista: sku** ******* 30 segundos y 19666 Puntos
[03:29] HipopotamoConPrisa 3 Pista: sku** a*a**ie 15 segundos y 19666 Puntos [03:29] HipopotamoConPrisa
3 Pista: sku** a*a**ie 15 segundos y 19666 Puntos
[03:29] HipopotamoConPrisa Tiempo! La respuesta es -> skunk�nansie <- [03:29] HipopotamoConPrisa
Tiempo! La respuesta es -> skunk�nansie <-
[03:29] HipopotamoConPrisa For The Competitive Edge type !pingme [03:29] HipopotamoConPrisa
For The Competitive Edge type !pingme
[03:29] HipopotamoConPrisa Tri.15140 Historiaɂuzzati˿COMOhSEhLLAMABAhNUEVAhYORKhCUANDOhERAhPROTECTORADOhHOLANDESh?h [03:29] HipopotamoConPrisa
Tri.15140 Historiaɂuzzati˿COMOhSEhLLAMABAhNUEVAhYORKhCUANDOhERAhPROTECTORADOhHOLANDESh?h
[03:29] HipopotamoConPrisa 1 Pista: ***** ********* Valor pregunta : 17997 Puntos [03:29] HipopotamoConPrisa
1 Pista: ***** ********* Valor pregunta : 17997 Puntos
[03:30] HipopotamoConPrisa 2 Pista: nue** ********* 30 segundos y 17997 Puntos [03:30] HipopotamoConPrisa
2 Pista: nue** ********* 30 segundos y 17997 Puntos
[03:30] Mosca{ConInquietud nueva amsterdam [03:30] Mosca{ConInquietud
nueva amsterdam
[03:30] HipopotamoConPrisa �Mosca{ConInquietud acert󡡠La respuesta era: "nueva amsterdam" y contest󠥮 �7.578 segundos. Se lleva: �7997�12 puntos [03:30] HipopotamoConPrisa
�Mosca{ConInquietud acert󡡠La respuesta era: "nueva amsterdam" y contest󠥮 �7.578 segundos. Se lleva: �7997�12 puntos
[03:30] HipopotamoConPrisa Mosca{ConInquietud has acertado 1 seguidas!! Puntos HOY: 408727, SEMANA: 12265442 y MES: 12265442 [03:30] HipopotamoConPrisa
Mosca{ConInquietud has acertado 1 seguidas!! Puntos HOY: 408727, SEMANA: 12265442 y MES: 12265442
[03:30] Mosca{ConInquietud jijijji [03:30] Mosca{ConInquietud
jijijji
[03:30] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:30] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:30] HipopotamoConPrisa Tri.3927 Cancionesɖonk˿Devquienoesblovelyyrytaf?f [03:30] HipopotamoConPrisa
Tri.3927 Cancionesɖonk˿Devquienoesblovelyyrytaf?f
[03:30] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 16795 Puntos [03:30] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 16795 Puntos
[03:30] HipopotamoConPrisa 2 Pista: bea**** 30 segundos y 16795 Puntos [03:30] HipopotamoConPrisa
2 Pista: bea**** 30 segundos y 16795 Puntos
[03:30] Hipopotamo\Especial beatles [03:30] Hipopotamo\Especial
beatles
[03:30] HipopotamoConPrisa �Ol頃04Hipopotamo\Especial!! Has contestado: "beatles" en �0.485 segundos y sumas �6795�12 puntos a tu marcador. �Sigue as� [03:30] HipopotamoConPrisa
�Ol頃04Hipopotamo\Especial!! Has contestado: "beatles" en �0.485 segundos y sumas �6795�12 puntos a tu marcador. �Sigue as�
[03:30] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 384563, SEMANA: 12140677 y MES: 12140677 [03:30] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 384563, SEMANA: 12140677 y MES: 12140677
[03:30] HipopotamoConPrisa R᮫ing MES: - #1: Mosca{ConInquietud 12265442 #2: Hipopotamo\Especial 12123882 #3: Lince{Torpe 4962118 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [03:30] HipopotamoConPrisa
R᮫ing MES: - #1: Mosca{ConInquietud 12265442 #2: Hipopotamo\Especial 12123882 #3: Lince{Torpe 4962118 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[03:30] HipopotamoConPrisa Tri.4622 Gastronomiaɐsico666˲egi󮃰1cvin�latfrancesatporxexcelenciat?m [03:30] HipopotamoConPrisa
Tri.4622 Gastronomiaɐsico666˲egi󮃰1cvin�latfrancesatporxexcelenciat?m
[03:30] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 21471 Puntos [03:30] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 21471 Puntos
[03:31] HipopotamoConPrisa 2 Pista: bur**** 30 segundos y 21471 Puntos [03:31] HipopotamoConPrisa
2 Pista: bur**** 30 segundos y 21471 Puntos
[03:31] Mosca{ConInquietud burdeos [03:31] Mosca{ConInquietud
burdeos
[03:31] HipopotamoConPrisa �Absolutamente correcto Mosca{ConInquietud!! Acertaste "burdeos" en �6.329 segundos y ganas �1471�12 puntos [03:31] HipopotamoConPrisa
�Absolutamente correcto Mosca{ConInquietud!! Acertaste "burdeos" en �6.329 segundos y ganas �1471�12 puntos
[03:31] HipopotamoConPrisa Mosca{ConInquietud has acertado 1 seguidas!! Puntos HOY: 430198, SEMANA: 12286913 y MES: 12286913 [03:31] HipopotamoConPrisa
Mosca{ConInquietud has acertado 1 seguidas!! Puntos HOY: 430198, SEMANA: 12286913 y MES: 12286913
[03:31] Mosca{ConInquietud jiijji [03:31] Mosca{ConInquietud
jiijji
[03:31] HipopotamoConPrisa Please refrain from using Extreme Bad Language [03:31] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[03:31] HipopotamoConPrisa Tri.2244 Politicaɭ˿Deseokdeuunypa�01odeumarginarseudeulosohechosoexterioresoyzvivirsporssikmismokdentrokdeususofronteraso?p [03:31] HipopotamoConPrisa
Tri.2244 Politicaɭ˿Deseokdeuunypa�01odeumarginarseudeulosohechosoexterioresoyzvivirsporssikmismokdentrokdeususofronteraso?p
[03:31] HipopotamoConPrisa 1 Pista: ************* Pregunta de BONUS : 200000 Puntos [03:31] HipopotamoConPrisa
1 Pista: ************* Pregunta de BONUS : 200000 Puntos
[03:31] HipopotamoConPrisa 2 Pista: ais********** 30 segundos y 200000 Puntos [03:31] HipopotamoConPrisa
2 Pista: ais********** 30 segundos y 200000 Puntos
[03:31] Mosca{ConInquietud aislacionismo [03:31] Mosca{ConInquietud
aislacionismo
[03:31] HipopotamoConPrisa �Bien Mosca{ConInquietud!! Tu respuesta: "aislacionismo" es correcta y ganas �00000�12 puntos [03:31] HipopotamoConPrisa
�Bien Mosca{ConInquietud!! Tu respuesta: "aislacionismo" es correcta y ganas �00000�12 puntos
[03:31] HipopotamoConPrisa Mosca{ConInquietud has acertado 2 seguidas!! Puntos HOY: 630198, SEMANA: 12486913 y MES: 12486913 [03:31] HipopotamoConPrisa
Mosca{ConInquietud has acertado 2 seguidas!! Puntos HOY: 630198, SEMANA: 12486913 y MES: 12486913
[03:31] Mosca{ConInquietud jijijij [03:31] Mosca{ConInquietud
jijijij
[03:31] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [03:31] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[03:31] HipopotamoConPrisa Tri.18235 MiscelaneaɔeLaRaNhA˿Eloignorante,galociegoxes...g?g [03:31] HipopotamoConPrisa
Tri.18235 MiscelaneaɔeLaRaNhA˿Eloignorante,galociegoxes...g?g
[03:31] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 11736 Puntos [03:31] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 11736 Puntos
[03:31] Mosca{ConInquietud hola fosforita [03:31] Mosca{ConInquietud
hola fosforita
[03:31] Mosca{ConInquietud jajaja [03:31] Mosca{ConInquietud
jajaja
[03:32] HipopotamoConPrisa 2 Pista: sem****** 30 segundos y 11736 Puntos [03:32] HipopotamoConPrisa
2 Pista: sem****** 30 segundos y 11736 Puntos
[03:32] HipopotamoConPrisa 3 Pista: seme*a**e 15 segundos y 11736 Puntos [03:32] HipopotamoConPrisa
3 Pista: seme*a**e 15 segundos y 11736 Puntos
[03:32] HipopotamoConPrisa Tiempo! La respuesta es -> semejante <- [03:32] HipopotamoConPrisa
Tiempo! La respuesta es -> semejante <-
[03:32] HipopotamoConPrisa This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [03:32] HipopotamoConPrisa
This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[03:32] HipopotamoConPrisa Tri.5409 Fisica-QuimicaɟTanis˿Cuᬃ01neszelnpotencialndecunselectrodoudechidrogenouenscondicionesznormalesz?r [03:32] HipopotamoConPrisa
Tri.5409 Fisica-QuimicaɟTanis˿Cuᬃ01neszelnpotencialndecunselectrodoudechidrogenouenscondicionesznormalesz?r
[03:32] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 13025 Puntos [03:32] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 13025 Puntos
[03:32] HipopotamoConPrisa 2 Pista: cer* 30 segundos y 13025 Puntos [03:32] HipopotamoConPrisa
2 Pista: cer* 30 segundos y 13025 Puntos
[03:33] Hipopotamo\Especial cero [03:33] Hipopotamo\Especial
cero
[03:33] HipopotamoConPrisa �Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "cero" era la respuesta? Venga, �3025�12 puntos suben a tu marcador [03:33] HipopotamoConPrisa
�Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "cero" era la respuesta? Venga, �3025�12 puntos suben a tu marcador
[03:33] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 397588, SEMANA: 12153702 y MES: 12153702 [03:33] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 397588, SEMANA: 12153702 y MES: 12153702
[03:33] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [03:33] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[03:33] HipopotamoConPrisa Tri.2483 Cienciaɬusie˿Ingenierooruso.Estudi󃰱ylasxondasxelectromagn鴩cas,yinvent󃰱ylapantenapradioel飴ricapykconstruy󃰱yeloprimerzreceptorz:Dy?y [03:33] HipopotamoConPrisa
Tri.2483 Cienciaɬusie˿Ingenierooruso.Estudi󃰱ylasxondasxelectromagn鴩cas,yinvent󃰱ylapantenapradioel飴ricapykconstruy󃰱yeloprimerzreceptorz:Dy?y
[03:33] HipopotamoConPrisa 1 Pista: ******** *********** ***** Valor pregunta : 5716 Puntos [03:33] HipopotamoConPrisa
1 Pista: ******** *********** ***** Valor pregunta : 5716 Puntos
[03:33] HipopotamoConPrisa 2 Pista: ale***** *********** ***** 30 segundos y 5716 Puntos [03:33] HipopotamoConPrisa
2 Pista: ale***** *********** ***** 30 segundos y 5716 Puntos
[03:33] HipopotamoConPrisa 3 Pista: ale*a*** **e*a*o*i** *o*o* 15 segundos y 5716 Puntos [03:33] HipopotamoConPrisa
3 Pista: ale*a*** **e*a*o*i** *o*o* 15 segundos y 5716 Puntos
[03:33] HipopotamoConPrisa Tiempo! La respuesta es -> alexandr�tepanovich�opov <- [03:33] HipopotamoConPrisa
Tiempo! La respuesta es -> alexandr�tepanovich�opov <-
[03:34] Hipopotamo\Especial [Oso_Insufrible] buenas noxes! [03:34] Hipopotamo\Especial
[Oso_Insufrible] buenas noxes!
[03:34] HipopotamoConPrisa This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [03:34] HipopotamoConPrisa
This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[03:34] HipopotamoConPrisa Tri.15254 Miscelaneaɓebosin˿Eltquezpubliquenzsobreztimnuncagpodr᳃01pleerlo?o?o [03:34] HipopotamoConPrisa
Tri.15254 Miscelaneaɓebosin˿Eltquezpubliquenzsobreztimnuncagpodr᳃01pleerlo?o?o
[03:34] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 12275 Puntos [03:34] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 12275 Puntos
[03:34] Hipopotamo\Especial !radio [03:34] Hipopotamo\Especial
!radio
[03:34] Gata_Elocuente 📻 [Radio Luna de Miel] | 🎧 DJ: elvigilante | 🎶 Un Poco de Musica | 🌍 Puerto Rico | 📩 Peticiones: ABIERTAS | 🌐 www.radiolunademiel.com [03:34] Gata_Elocuente
📻 [Radio Luna de Miel] | 🎧 DJ: elvigilante | 🎶 Un Poco de Musica | 🌍 Puerto Rico | 📩 Peticiones: ABIERTAS | 🌐 www.radiolunademiel.com
[03:34] HipopotamoConPrisa 2 Pista: obi****** 30 segundos y 12275 Puntos [03:34] HipopotamoConPrisa
2 Pista: obi****** 30 segundos y 12275 Puntos
[03:34] Oso_Insufrible buenas noches, Hipopotamo\Especial [03:34] Oso_Insufrible
buenas noches, Hipopotamo\Especial
[03:34] Hipopotamo\Especial ;) [03:34] Hipopotamo\Especial
;)
[03:34] HipopotamoConPrisa 3 Pista: obi*ua*io 15 segundos y 12275 Puntos [03:34] HipopotamoConPrisa
3 Pista: obi*ua*io 15 segundos y 12275 Puntos
[03:34] HipopotamoConPrisa Tiempo! La respuesta es -> obituario <- [03:34] HipopotamoConPrisa
Tiempo! La respuesta es -> obituario <-
[03:35] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [03:35] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[03:35] HipopotamoConPrisa Tri.12025 Musicaɐsico666˩nstrumentodtradicinalwdeiGambiabqueitienei21ccuerdasxydesxunabmezlabdeilaudsydarpab?c [03:35] HipopotamoConPrisa
Tri.12025 Musicaɐsico666˩nstrumentodtradicinalwdeiGambiabqueitienei21ccuerdasxydesxunabmezlabdeilaudsydarpab?c
[03:35] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 24947 Puntos [03:35] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 24947 Puntos
[03:35] HipopotamoConPrisa 2 Pista: kor* 30 segundos y 24947 Puntos [03:35] HipopotamoConPrisa
2 Pista: kor* 30 segundos y 24947 Puntos
[03:35] HipopotamoConPrisa 3 Pista: kora 15 segundos y 24947 Puntos [03:35] HipopotamoConPrisa
3 Pista: kora 15 segundos y 24947 Puntos
[03:35] HipopotamoConPrisa �Ol頃04Hipopotamo\Especial!! Has contestado: "kora" en �4.782 segundos y sumas �4947�12 puntos a tu marcador. �Sigue as� [03:35] HipopotamoConPrisa
�Ol頃04Hipopotamo\Especial!! Has contestado: "kora" en �4.782 segundos y sumas �4947�12 puntos a tu marcador. �Sigue as�
[03:35] HipopotamoConPrisa Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 422535, SEMANA: 12178649 y MES: 12178649 [03:35] HipopotamoConPrisa
Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 422535, SEMANA: 12178649 y MES: 12178649
[03:35] Hipopotamo\Especial kora [03:35] Hipopotamo\Especial
kora
[03:35] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:35] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:35] HipopotamoConPrisa Tri.16788 Personajesɓebosin˿Frases-NIETZSCHE:a"Unmhombreqpareceqtenernm᳃01lcarᣴerncuandoesigueqsuatemperamentoem᳃01lqueqcuandoesigueqsusl..."?a?a [03:35] HipopotamoConPrisa
Tri.16788 Personajesɓebosin˿Frases-NIETZSCHE:a"Unmhombreqpareceqtenernm᳃01lcarᣴerncuandoesigueqsuatemperamentoem᳃01lqueqcuandoesigueqsusl..."?a?a
[03:35] HipopotamoConPrisa 1 Pista: ********** Valor pregunta : 10028 Puntos [03:35] HipopotamoConPrisa
1 Pista: ********** Valor pregunta : 10028 Puntos
[03:36] HipopotamoConPrisa 2 Pista: pri******* 30 segundos y 10028 Puntos [03:36] HipopotamoConPrisa
2 Pista: pri******* 30 segundos y 10028 Puntos
[03:36] HipopotamoConPrisa 3 Pista: pri**i*io* 15 segundos y 10028 Puntos [03:36] HipopotamoConPrisa
3 Pista: pri**i*io* 15 segundos y 10028 Puntos
[03:36] HipopotamoConPrisa Tiempo! La respuesta es -> principios <- [03:36] HipopotamoConPrisa
Tiempo! La respuesta es -> principios <-
[03:36] Hipopotamo\Especial principios [03:36] Hipopotamo\Especial
principios
[03:36] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:36] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:36] HipopotamoConPrisa Tri.253 Biologiaɪcrazy_Sp˿Enaequeaa񯳃01oseapublicomlaeobraeprimaedeaDarwinvElworigenvdealasoespeciesoporhmediomdealaeseleccionvnaturalw?z [03:36] HipopotamoConPrisa
Tri.253 Biologiaɪcrazy_Sp˿Enaequeaa񯳃01oseapublicomlaeobraeprimaedeaDarwinvElworigenvdealasoespeciesoporhmediomdealaeseleccionvnaturalw?z
[03:36] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 19611 Puntos [03:36] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 19611 Puntos
[03:36] HipopotamoConPrisa 2 Pista: 185* 30 segundos y 19611 Puntos [03:36] HipopotamoConPrisa
2 Pista: 185* 30 segundos y 19611 Puntos
[03:37] HipopotamoConPrisa 3 Pista: 185* 15 segundos y 19611 Puntos [03:37] HipopotamoConPrisa
3 Pista: 185* 15 segundos y 19611 Puntos
[03:37] Lince{Torpe 1850 [03:37] Lince{Torpe
1850
[03:37] HipopotamoConPrisa Tiempo! La respuesta es -> 1859 <- [03:37] HipopotamoConPrisa
Tiempo! La respuesta es -> 1859 <-
[03:37] HipopotamoConPrisa R᮫ing SEMANA: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12178649 #3: Lince{Torpe 4962118 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [03:37] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12178649 #3: Lince{Torpe 4962118 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[03:37] HipopotamoConPrisa Tri.6991 CienciaɞIrati˿LafescalafRitcherusembasafenqlastondastdemchoquemllamadastondastde...e?e [03:37] HipopotamoConPrisa
Tri.6991 CienciaɞIrati˿LafescalafRitcherusembasafenqlastondastdemchoquemllamadastondastde...e?e
[03:37] HipopotamoConPrisa 1 Pista: ************* ******** * ******* Valor pregunta : 21663 Puntos [03:37] HipopotamoConPrisa
1 Pista: ************* ******** * ******* Valor pregunta : 21663 Puntos
[03:37] HipopotamoConPrisa 2 Pista: des********** ******** * ******* 30 segundos y 21663 Puntos [03:37] HipopotamoConPrisa
2 Pista: des********** ******** * ******* 30 segundos y 21663 Puntos
[03:38] HipopotamoConPrisa 3 Pista: des*i*a*ie**o *o**i*u* * **e*io* 15 segundos y 21663 Puntos [03:38] HipopotamoConPrisa
3 Pista: des*i*a*ie**o *o**i*u* * **e*io* 15 segundos y 21663 Puntos
[03:38] HipopotamoConPrisa Tiempo! La respuesta es -> deslizamiento�ongitud��resion <- [03:38] HipopotamoConPrisa
Tiempo! La respuesta es -> deslizamiento�ongitud��resion <-
[03:38] HipopotamoConPrisa We feature over 50,000 Q&A ! [03:38] HipopotamoConPrisa
We feature over 50,000 Q&A !
[03:38] HipopotamoConPrisa Tri.478 Cienciaɳtephenwo˿Cuantosnmillonesndeepasajerosntransportafalha񯃰1zelhmetrozdeemoscue(n�merosnredondos)?w?w [03:38] HipopotamoConPrisa
Tri.478 Cienciaɳtephenwo˿Cuantosnmillonesndeepasajerosntransportafalha񯃰1zelhmetrozdeemoscue(n�merosnredondos)?w?w
[03:38] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 10525 Puntos [03:38] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 10525 Puntos
[03:38] HipopotamoConPrisa 2 Pista: 200* 30 segundos y 10525 Puntos [03:38] HipopotamoConPrisa
2 Pista: 200* 30 segundos y 10525 Puntos
[03:38] Hipopotamo\Especial 2000 [03:38] Hipopotamo\Especial
2000
[03:38] HipopotamoConPrisa �Hipopotamo\Especial acert󡡠La respuesta era: "2000" y contest󠥮 �8.969 segundos. Se lleva: �0525�12 puntos [03:38] HipopotamoConPrisa
�Hipopotamo\Especial acert󡡠La respuesta era: "2000" y contest󠥮 �8.969 segundos. Se lleva: �0525�12 puntos
[03:38] HipopotamoConPrisa Hipopotamo\Especial has acertado 3 seguidas!! Puntos HOY: 433060, SEMANA: 12189174 y MES: 12189174 [03:38] HipopotamoConPrisa
Hipopotamo\Especial has acertado 3 seguidas!! Puntos HOY: 433060, SEMANA: 12189174 y MES: 12189174
[03:39] HipopotamoConPrisa Tri.8807 Cotilleo-TVɓESINO˿(ThekSimpsons)f߃omoesekllamaslascallekdondekvivenwlosssimpsonss?f [03:39] HipopotamoConPrisa
Tri.8807 Cotilleo-TVɓESINO˿(ThekSimpsons)f߃omoesekllamaslascallekdondekvivenwlosssimpsonss?f
[03:39] HipopotamoConPrisa 1 Pista: ********* ******* Pregunta de BONUS : 200000 Puntos [03:39] HipopotamoConPrisa
1 Pista: ********* ******* Pregunta de BONUS : 200000 Puntos
[03:39] HipopotamoConPrisa 2 Pista: eve****** ******* 30 segundos y 200000 Puntos [03:39] HipopotamoConPrisa
2 Pista: eve****** ******* 30 segundos y 200000 Puntos
[03:39] HipopotamoConPrisa 3 Pista: eve***ee* *e**a*e 15 segundos y 200000 Puntos [03:39] HipopotamoConPrisa
3 Pista: eve***ee* *e**a*e 15 segundos y 200000 Puntos
[03:39] Lince{Torpe evergreen terraxce [03:39] Lince{Torpe
evergreen terraxce
[03:39] HipopotamoConPrisa Tiempo! La respuesta es -> evergreen�errace <- [03:39] HipopotamoConPrisa
Tiempo! La respuesta es -> evergreen�errace <-
[03:40] HipopotamoConPrisa Tri.18673 CienciaɍARdeJAVA˿CӍOcLLAMAMOScAcLAcESTRELLAcLUMINOSAcCENTROcDEcNUESTROcSISTEMAcPLANETARIO?c?c [03:40] HipopotamoConPrisa
Tri.18673 CienciaɍARdeJAVA˿CӍOcLLAMAMOScAcLAcESTRELLAcLUMINOSAcCENTROcDEcNUESTROcSISTEMAcPLANETARIO?c?c
[03:40] HipopotamoConPrisa 1 Pista: *** Valor pregunta : 21041 Puntos [03:40] HipopotamoConPrisa
1 Pista: *** Valor pregunta : 21041 Puntos
[03:40] Hipopotamo\Especial sol [03:40] Hipopotamo\Especial
sol
[03:40] HipopotamoConPrisa �Muy bien Hipopotamo\Especial!! Acertaste "sol" en tan s󬯠�0.704 segundos y por eso has ganado: �1041�12 puntos [03:40] HipopotamoConPrisa
�Muy bien Hipopotamo\Especial!! Acertaste "sol" en tan s󬯠�0.704 segundos y por eso has ganado: �1041�12 puntos
[03:40] HipopotamoConPrisa Hipopotamo\Especial has acertado 4 seguidas!! Puntos HOY: 454101, SEMANA: 12210215 y MES: 12210215 [03:40] HipopotamoConPrisa
Hipopotamo\Especial has acertado 4 seguidas!! Puntos HOY: 454101, SEMANA: 12210215 y MES: 12210215
[03:40] Lince{Torpe eeosa [03:40] Lince{Torpe
eeosa
[03:40] Lince{Torpe oss [03:40] Lince{Torpe
oss
[03:40] Lince{Torpe osa [03:40] Lince{Torpe
osa
[03:40] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [03:40] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[03:40] HipopotamoConPrisa Tri.12122 Arteɍonteso˿Islacdondexestჰ1xNotrexDamexdexParisp?x [03:40] HipopotamoConPrisa
Tri.12122 Arteɍonteso˿Islacdondexestჰ1xNotrexDamexdexParisp?x
[03:40] HipopotamoConPrisa 1 Pista: ** **** Valor pregunta : 6224 Puntos [03:40] HipopotamoConPrisa
1 Pista: ** **** Valor pregunta : 6224 Puntos
[03:40] Lince{Torpe sol [03:40] Lince{Torpe
sol
[03:40] HipopotamoConPrisa 2 Pista: la�*** 30 segundos y 6224 Puntos [03:40] HipopotamoConPrisa
2 Pista: la�*** 30 segundos y 6224 Puntos
[03:40] Mosca{ConInquietud la cit e [03:40] Mosca{ConInquietud
la cit e
[03:40] HipopotamoConPrisa 3 Pista: la�i*e 15 segundos y 6224 Puntos [03:40] HipopotamoConPrisa
3 Pista: la�i*e 15 segundos y 6224 Puntos
[03:40] Lince{Torpe la cite [03:40] Lince{Torpe
la cite
[03:40] HipopotamoConPrisa �Bien Lince{Torpe!! Tu respuesta: "la cite" es correcta y ganas �224�12 puntos [03:40] HipopotamoConPrisa
�Bien Lince{Torpe!! Tu respuesta: "la cite" es correcta y ganas �224�12 puntos
[03:40] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:40] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:40] HipopotamoConPrisa Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 6224, SEMANA: 4968342 y MES: 4968342 [03:40] HipopotamoConPrisa
Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 6224, SEMANA: 4968342 y MES: 4968342
[03:41] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [03:41] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[03:41] HipopotamoConPrisa Tri.4425 Cotilleo-TVɃarPEnTer˿(LosuSimpson)pApellidoldersolteraoderMarger?p [03:41] HipopotamoConPrisa
Tri.4425 Cotilleo-TVɃarPEnTer˿(LosuSimpson)pApellidoldersolteraoderMarger?p
[03:41] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 21495 Puntos [03:41] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 21495 Puntos
[03:41] HipopotamoConPrisa 2 Pista: bou**** 30 segundos y 21495 Puntos [03:41] HipopotamoConPrisa
2 Pista: bou**** 30 segundos y 21495 Puntos
[03:41] HipopotamoConPrisa �Increible!! Lince{Torpe contest󺠃04"bouvier" en �6.25 segundos, y ha ganado �1495�12 puntos [03:41] HipopotamoConPrisa
�Increible!! Lince{Torpe contest󺠃04"bouvier" en �6.25 segundos, y ha ganado �1495�12 puntos
[03:41] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:41] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:41] HipopotamoConPrisa Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 27719, SEMANA: 4989837 y MES: 4989837 [03:41] HipopotamoConPrisa
Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 27719, SEMANA: 4989837 y MES: 4989837
[03:41] Lince{Torpe bouvier [03:41] Lince{Torpe
bouvier
[03:41] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [03:41] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[03:41] HipopotamoConPrisa Tri.14655 MusicaɃort˿C󭯃01cseillam󃰱telaproyectocmusicalaconjuntocdeiCarlospJeankyhlahactriztNajwahNimrib?t [03:41] HipopotamoConPrisa
Tri.14655 MusicaɃort˿C󭯃01cseillam󃰱telaproyectocmusicalaconjuntocdeiCarlospJeankyhlahactriztNajwahNimrib?t
[03:41] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 21473 Puntos [03:41] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 21473 Puntos
[03:41] HipopotamoConPrisa 2 Pista: naj****** 30 segundos y 21473 Puntos [03:41] HipopotamoConPrisa
2 Pista: naj****** 30 segundos y 21473 Puntos
[03:42] HipopotamoConPrisa 3 Pista: naj*a*ea* 15 segundos y 21473 Puntos [03:42] HipopotamoConPrisa
3 Pista: naj*a*ea* 15 segundos y 21473 Puntos
[03:42] HipopotamoConPrisa Tiempo! La respuesta es -> najwajean <- [03:42] HipopotamoConPrisa
Tiempo! La respuesta es -> najwajean <-
[03:42] Lince{Torpe najwanjean [03:42] Lince{Torpe
najwanjean
[03:42] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [03:42] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[03:42] HipopotamoConPrisa Tri.20188 Geografiaɓebosin˿Enfqu郰1yregi󮃰1frumanaosezencuentraoelkr�01zOlt?y?y [03:42] HipopotamoConPrisa
Tri.20188 Geografiaɓebosin˿Enfqu郰1yregi󮃰1frumanaosezencuentraoelkr�01zOlt?y?y
[03:42] HipopotamoConPrisa 1 Pista: ******** Pregunta de BONUS : 100000 Puntos [03:42] HipopotamoConPrisa
1 Pista: ******** Pregunta de BONUS : 100000 Puntos
[03:42] HipopotamoConPrisa 2 Pista: val***** 30 segundos y 100000 Puntos [03:42] HipopotamoConPrisa
2 Pista: val***** 30 segundos y 100000 Puntos
[03:42] Lince{Torpe valaquia [03:42] Lince{Torpe
valaquia
[03:42] HipopotamoConPrisa �Muy bien Lince{Torpe!! Acertaste "valaquia" en tan s󬯠�6.828 segundos y por eso has ganado: �00000�12 puntos [03:42] HipopotamoConPrisa
�Muy bien Lince{Torpe!! Acertaste "valaquia" en tan s󬯠�6.828 segundos y por eso has ganado: �00000�12 puntos
[03:42] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:42] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:42] HipopotamoConPrisa Lince{Torpe has acertado 3 seguidas!! Puntos HOY: 127719, SEMANA: 5089837 y MES: 5089837 [03:42] HipopotamoConPrisa
Lince{Torpe has acertado 3 seguidas!! Puntos HOY: 127719, SEMANA: 5089837 y MES: 5089837
[03:43] HipopotamoConPrisa For The Competitive Edge type !pingme [03:43] HipopotamoConPrisa
For The Competitive Edge type !pingme
[03:43] HipopotamoConPrisa Tri.12544 Miscelaneaɓebosin˿C󭯃01dsecllamanmlasyfrasesydeclosyescudos?j?j [03:43] HipopotamoConPrisa
Tri.12544 Miscelaneaɓebosin˿C󭯃01dsecllamanmlasyfrasesydeclosyescudos?j?j
[03:43] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 19635 Puntos [03:43] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 19635 Puntos
[03:43] HipopotamoConPrisa 2 Pista: lem** 30 segundos y 19635 Puntos [03:43] HipopotamoConPrisa
2 Pista: lem** 30 segundos y 19635 Puntos
[03:43] Lince{Torpe lema [03:43] Lince{Torpe
lema
[03:43] Lince{Torpe lemas [03:43] Lince{Torpe
lemas
[03:43] HipopotamoConPrisa �Lince{Torpe acert󡡠La respuesta era: "lemas" y contest󠥮 �0.875 segundos. Se lleva: �9635�12 puntos [03:43] HipopotamoConPrisa
�Lince{Torpe acert󡡠La respuesta era: "lemas" y contest󠥮 �0.875 segundos. Se lleva: �9635�12 puntos
[03:43] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:43] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:43] HipopotamoConPrisa Lince{Torpe has acertado 4 seguidas!! Puntos HOY: 147354, SEMANA: 5109472 y MES: 5109472 [03:43] HipopotamoConPrisa
Lince{Torpe has acertado 4 seguidas!! Puntos HOY: 147354, SEMANA: 5109472 y MES: 5109472
[03:43] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:43] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:43] HipopotamoConPrisa Tri.20049 Deporteɍachakao˿CUANTASmLIGASmHAmGANADOmELmOBILIC(Aяm2000)m?m [03:43] HipopotamoConPrisa
Tri.20049 Deporteɍachakao˿CUANTASmLIGASmHAmGANADOmELmOBILIC(Aяm2000)m?m
[03:43] HipopotamoConPrisa 1 Pista: *** Pregunta de BONUS : 25000 Puntos [03:43] HipopotamoConPrisa
1 Pista: *** Pregunta de BONUS : 25000 Puntos
[03:43] Hipopotamo\Especial dos [03:43] Hipopotamo\Especial
dos
[03:43] Hipopotamo\Especial una [03:43] Hipopotamo\Especial
una
[03:43] HipopotamoConPrisa �Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "una" era la respuesta? Venga, �5000�12 puntos suben a tu marcador [03:43] HipopotamoConPrisa
�Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "una" era la respuesta? Venga, �5000�12 puntos suben a tu marcador
[03:43] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 479101, SEMANA: 12235215 y MES: 12235215 [03:43] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 479101, SEMANA: 12235215 y MES: 12235215
[03:43] HipopotamoConPrisa R᮫ing MES: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12210215 #3: Lince{Torpe 5109472 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [03:43] HipopotamoConPrisa
R᮫ing MES: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12210215 #3: Lince{Torpe 5109472 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[03:43] HipopotamoConPrisa Tri.19765 Politicaɭ˿EnrlabpropuestabdelqCongresovdeolose4emiembrosealqTribunalqConstitucional,e鳴oseseoeligenrporfmayor�01bde...e?e [03:43] HipopotamoConPrisa
Tri.19765 Politicaɭ˿EnrlabpropuestabdelqCongresovdeolose4emiembrosealqTribunalqConstitucional,e鳴oseseoeligenrporfmayor�01bde...e?e
[03:43] HipopotamoConPrisa 1 Pista: **** ******* Valor pregunta : 23262 Puntos [03:43] HipopotamoConPrisa
1 Pista: **** ******* Valor pregunta : 23262 Puntos
[03:44] HipopotamoConPrisa 2 Pista: tre* ******* 30 segundos y 23262 Puntos [03:44] HipopotamoConPrisa
2 Pista: tre* ******* 30 segundos y 23262 Puntos
[03:44] HipopotamoConPrisa 3 Pista: tre* *ui**o* 15 segundos y 23262 Puntos [03:44] HipopotamoConPrisa
3 Pista: tre* *ui**o* 15 segundos y 23262 Puntos
[03:44] HipopotamoConPrisa �e nota que sabes mucho de esto Lince{Torpe! Tu respuesta "tres quintos" es correcta y ganas �3262�12 puntos [03:44] HipopotamoConPrisa
�e nota que sabes mucho de esto Lince{Torpe! Tu respuesta "tres quintos" es correcta y ganas �3262�12 puntos
[03:44] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:44] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:44] HipopotamoConPrisa Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 170616, SEMANA: 5132734 y MES: 5132734 [03:44] HipopotamoConPrisa
Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 170616, SEMANA: 5132734 y MES: 5132734
[03:44] Lince{Torpe tres quintos [03:44] Lince{Torpe
tres quintos
[03:44] HipopotamoConPrisa Please refrain from using Extreme Bad Language [03:44] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[03:44] HipopotamoConPrisa Tri.8753 Economiaɦlipp_er˿Deyqueypaiseeselavmonedavllamadav"birr"?l?l [03:44] HipopotamoConPrisa
Tri.8753 Economiaɦlipp_er˿Deyqueypaiseeselavmonedavllamadav"birr"?l?l
[03:44] HipopotamoConPrisa 1 Pista: ******* Pregunta de BONUS : 50000 Puntos [03:44] HipopotamoConPrisa
1 Pista: ******* Pregunta de BONUS : 50000 Puntos
[03:44] HipopotamoConPrisa 2 Pista: eti**** 30 segundos y 50000 Puntos [03:44] HipopotamoConPrisa
2 Pista: eti**** 30 segundos y 50000 Puntos
[03:44] HipopotamoConPrisa �emuestra lo que sabes Hipopotamo\Especial! Has respondido "etiopia" correctamente y eso te da: �0000�12 puntos [03:44] HipopotamoConPrisa
�emuestra lo que sabes Hipopotamo\Especial! Has respondido "etiopia" correctamente y eso te da: �0000�12 puntos
[03:44] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 529101, SEMANA: 12285215 y MES: 12285215 [03:44] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 529101, SEMANA: 12285215 y MES: 12285215
[03:44] Hipopotamo\Especial etiopia [03:44] Hipopotamo\Especial
etiopia
[03:45] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [03:45] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[03:45] HipopotamoConPrisa Tri.12922 Cotilleo-TVɡnghara˿Enaqu郰1rseriegdegTVrhac�01jdegcamionerokSanchokGraciaj?r [03:45] HipopotamoConPrisa
Tri.12922 Cotilleo-TVɡnghara˿Enaqu郰1rseriegdegTVrhac�01jdegcamionerokSanchokGraciaj?r
[03:45] HipopotamoConPrisa 1 Pista: *** ********** Valor pregunta : 19890 Puntos [03:45] HipopotamoConPrisa
1 Pista: *** ********** Valor pregunta : 19890 Puntos
[03:45] HipopotamoConPrisa 2 Pista: los ********** 30 segundos y 19890 Puntos [03:45] HipopotamoConPrisa
2 Pista: los ********** 30 segundos y 19890 Puntos
[03:45] Lince{Torpe los camioneros [03:45] Lince{Torpe
los camioneros
[03:45] HipopotamoConPrisa �Suma y sigue Lince{Torpe!! La respuesta: "los camioneros" incrementa tu marcador en �9890�12 puntos [03:45] HipopotamoConPrisa
�Suma y sigue Lince{Torpe!! La respuesta: "los camioneros" incrementa tu marcador en �9890�12 puntos
[03:45] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:45] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:45] HipopotamoConPrisa Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 190506, SEMANA: 5152624 y MES: 5152624 [03:45] HipopotamoConPrisa
Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 190506, SEMANA: 5152624 y MES: 5152624
[03:45] HipopotamoConPrisa This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [03:45] HipopotamoConPrisa
This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[03:45] HipopotamoConPrisa Tri.13060 Cotilleo-TVɍercator˿COMOfSEfLLAMAfLAfACTRIZfQUEfINTERPRETAfAfLINGfENfLAfSERIEfALLYfMCBEAL?f?f [03:45] HipopotamoConPrisa
Tri.13060 Cotilleo-TVɍercator˿COMOfSEfLLAMAfLAfACTRIZfQUEfINTERPRETAfAfLINGfENfLAfSERIEfALLYfMCBEAL?f?f
[03:45] HipopotamoConPrisa 1 Pista: **** *** Valor pregunta : 21712 Puntos [03:45] HipopotamoConPrisa
1 Pista: **** *** Valor pregunta : 21712 Puntos
[03:45] HipopotamoConPrisa 2 Pista: luc* *** 30 segundos y 21712 Puntos [03:45] HipopotamoConPrisa
2 Pista: luc* *** 30 segundos y 21712 Puntos
[03:46] Lince{Torpe andrea elson [03:46] Lince{Torpe
andrea elson
[03:46] HipopotamoConPrisa 3 Pista: luc* *iu 15 segundos y 21712 Puntos [03:46] HipopotamoConPrisa
3 Pista: luc* *iu 15 segundos y 21712 Puntos
[03:46] HipopotamoConPrisa Tiempo! La respuesta es -> lucy�iu <- [03:46] HipopotamoConPrisa
Tiempo! La respuesta es -> lucy�iu <-
[03:46] Hipopotamo\Especial !radio [03:46] Hipopotamo\Especial
!radio
[03:46] Gata_Elocuente 📻 [Radio Luna de Miel] | 🎧 DJ: elvigilante | 🎶 Un Poco de Musica | 🌍 Puerto Rico | 📩 Peticiones: ABIERTAS | 🌐 www.radiolunademiel.com [03:46] Gata_Elocuente
📻 [Radio Luna de Miel] | 🎧 DJ: elvigilante | 🎶 Un Poco de Musica | 🌍 Puerto Rico | 📩 Peticiones: ABIERTAS | 🌐 www.radiolunademiel.com
[03:46] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [03:46] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[03:46] HipopotamoConPrisa Tri.7160 InformaticaɌucky_LuK˿AuQUEuSEuREFIEREuLAuDuDEuADSLu?u [03:46] HipopotamoConPrisa
Tri.7160 InformaticaɌucky_LuK˿AuQUEuSEuREFIEREuLAuDuDEuADSLu?u
[03:46] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 17815 Puntos [03:46] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 17815 Puntos
[03:46] HipopotamoConPrisa 2 Pista: dig**** 30 segundos y 17815 Puntos [03:46] HipopotamoConPrisa
2 Pista: dig**** 30 segundos y 17815 Puntos
[03:46] Hipopotamo\Especial digital [03:46] Hipopotamo\Especial
digital
[03:46] HipopotamoConPrisa �Ol頃04Hipopotamo\Especial!! Has contestado: "digital" en �6.031 segundos y sumas �7815�12 puntos a tu marcador. �Sigue as� [03:46] HipopotamoConPrisa
�Ol頃04Hipopotamo\Especial!! Has contestado: "digital" en �6.031 segundos y sumas �7815�12 puntos a tu marcador. �Sigue as�
[03:46] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 546916, SEMANA: 12303030 y MES: 12303030 [03:46] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 546916, SEMANA: 12303030 y MES: 12303030
[03:47] HipopotamoConPrisa This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [03:47] HipopotamoConPrisa
This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[03:47] HipopotamoConPrisa Tri.515 Deporteɣarlovigo˿F.CvBarcelona-FechaxdezinauguraciongdelyCampwNouw?v [03:47] HipopotamoConPrisa
Tri.515 Deporteɣarlovigo˿F.CvBarcelona-FechaxdezinauguraciongdelyCampwNouw?v
[03:47] HipopotamoConPrisa 1 Pista: ** ********** **** Valor pregunta : 16625 Puntos [03:47] HipopotamoConPrisa
1 Pista: ** ********** **** Valor pregunta : 16625 Puntos
[03:47] HipopotamoConPrisa 2 Pista: 24�********* **** 30 segundos y 16625 Puntos [03:47] HipopotamoConPrisa
2 Pista: 24�********* **** 30 segundos y 16625 Puntos
[03:47] Lince{Torpe 24 de septiembre de 1957 [03:47] Lince{Torpe
24 de septiembre de 1957
[03:47] HipopotamoConPrisa 3 Pista: 24�e**ie***e **** 15 segundos y 16625 Puntos [03:47] HipopotamoConPrisa
3 Pista: 24�e**ie***e **** 15 segundos y 16625 Puntos
[03:47] HipopotamoConPrisa Tiempo! La respuesta es -> 24�eptiembre�957 <- [03:47] HipopotamoConPrisa
Tiempo! La respuesta es -> 24�eptiembre�957 <-
[03:47] Lince{Torpe 24 septiembre de 1954 [03:47] Lince{Torpe
24 septiembre de 1954
[03:48] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [03:48] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[03:48] HipopotamoConPrisa Tri.2679 Medicina-Saludɲaziel9˿COMOhSEhLLAMAhELhMIEDOhALhPOLVOh?h [03:48] HipopotamoConPrisa
Tri.2679 Medicina-Saludɲaziel9˿COMOhSEhLLAMAhELhMIEDOhALhPOLVOh?h
[03:48] HipopotamoConPrisa 1 Pista: *********** Valor pregunta : 23831 Puntos [03:48] HipopotamoConPrisa
1 Pista: *********** Valor pregunta : 23831 Puntos
[03:48] HipopotamoConPrisa 2 Pista: ama******** 30 segundos y 23831 Puntos [03:48] HipopotamoConPrisa
2 Pista: ama******** 30 segundos y 23831 Puntos
[03:48] Lince{Torpe amatofobia [03:48] Lince{Torpe
amatofobia
[03:48] HipopotamoConPrisa 3 Pista: ama**o*o*ia 15 segundos y 23831 Puntos [03:48] HipopotamoConPrisa
3 Pista: ama**o*o*ia 15 segundos y 23831 Puntos
[03:48] Lince{Torpe amatofobia [03:48] Lince{Torpe
amatofobia
[03:48] HipopotamoConPrisa Tiempo! La respuesta es -> amathofobia <- [03:48] HipopotamoConPrisa
Tiempo! La respuesta es -> amathofobia <-
[03:48] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:48] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:48] HipopotamoConPrisa Tri.9089 Personajesɴamzarian˿AlcaldelNuevatYorkxentrel1934lya1945,ldelcqueltomatsubnombrelunogdellosoaeropuertosodelestatciudadw?l [03:48] HipopotamoConPrisa
Tri.9089 Personajesɴamzarian˿AlcaldelNuevatYorkxentrel1934lya1945,ldelcqueltomatsubnombrelunogdellosoaeropuertosodelestatciudadw?l
[03:48] HipopotamoConPrisa 1 Pista: ******** ** ******* Valor pregunta : 15299 Puntos [03:48] HipopotamoConPrisa
1 Pista: ******** ** ******* Valor pregunta : 15299 Puntos
[03:49] HipopotamoConPrisa 2 Pista: fio***** ** ******* 30 segundos y 15299 Puntos [03:49] HipopotamoConPrisa
2 Pista: fio***** ** ******* 30 segundos y 15299 Puntos
[03:49] HipopotamoConPrisa 3 Pista: fio*e**o *a *ua**ia 15 segundos y 15299 Puntos [03:49] HipopotamoConPrisa
3 Pista: fio*e**o *a *ua**ia 15 segundos y 15299 Puntos
[03:49] HipopotamoConPrisa Tiempo! La respuesta es -> fiorello�a�uardia <- [03:49] HipopotamoConPrisa
Tiempo! La respuesta es -> fiorello�a�uardia <-
[03:49] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:49] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:49] HipopotamoConPrisa Tri.8473 MitologiaɍARdeJAVA˿AyQUɃ01yMITOLOǴyPERTENECENyLOSyDIOSESyMENORES:yBALDO,yTYRyYyBRAGI?y?y [03:49] HipopotamoConPrisa
Tri.8473 MitologiaɍARdeJAVA˿AyQUɃ01yMITOLOǴyPERTENECENyLOSyDIOSESyMENORES:yBALDO,yTYRyYyBRAGI?y?y
[03:49] HipopotamoConPrisa 1 Pista: *********** Pregunta de BONUS : 25000 Puntos [03:49] HipopotamoConPrisa
1 Pista: *********** Pregunta de BONUS : 25000 Puntos
[03:50] HipopotamoConPrisa 2 Pista: esc******** 30 segundos y 25000 Puntos [03:50] HipopotamoConPrisa
2 Pista: esc******** 30 segundos y 25000 Puntos
[03:50] HipopotamoConPrisa �Bien Lince{Torpe!! Tu respuesta: "escandinava" es correcta y ganas �5000�12 puntos [03:50] HipopotamoConPrisa
�Bien Lince{Torpe!! Tu respuesta: "escandinava" es correcta y ganas �5000�12 puntos
[03:50] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:50] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:50] HipopotamoConPrisa Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 215506, SEMANA: 5177624 y MES: 5177624 [03:50] HipopotamoConPrisa
Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 215506, SEMANA: 5177624 y MES: 5177624
[03:50] Lince{Torpe escandinava [03:50] Lince{Torpe
escandinava
[03:50] HipopotamoConPrisa R᮫ing SEMANA: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12303030 #3: Lince{Torpe 5177624 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [03:50] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12303030 #3: Lince{Torpe 5177624 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[03:50] HipopotamoConPrisa Tri.17293 Cienciaɴjmm.com˅lectr󮩣a:bDispositivojelectromecᮩcojenzelpquepunzelectroimᮃ01zcontroladojconzpeque񡳃01gpotenciasgabrepojcierragcontactosgquepcontrolanzpotenciasgmayores.b?b [03:50] HipopotamoConPrisa
Tri.17293 Cienciaɴjmm.com˅lectr󮩣a:bDispositivojelectromecᮩcojenzelpquepunzelectroimᮃ01zcontroladojconzpeque񡳃01gpotenciasgabrepojcierragcontactosgquepcontrolanzpotenciasgmayores.b?b
[03:50] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 19428 Puntos [03:50] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 19428 Puntos
[03:50] HipopotamoConPrisa 2 Pista: rel* 30 segundos y 19428 Puntos [03:50] HipopotamoConPrisa
2 Pista: rel* 30 segundos y 19428 Puntos
[03:50] HipopotamoConPrisa �Increible!! Lince{Torpe contest󺠃04"rele" en �1.531 segundos, y ha ganado �9428�12 puntos [03:50] HipopotamoConPrisa
�Increible!! Lince{Torpe contest󺠃04"rele" en �1.531 segundos, y ha ganado �9428�12 puntos
[03:50] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:50] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:50] HipopotamoConPrisa Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 234934, SEMANA: 5197052 y MES: 5197052 [03:50] HipopotamoConPrisa
Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 234934, SEMANA: 5197052 y MES: 5197052
[03:50] Lince{Torpe rele [03:50] Lince{Torpe
rele
[03:51] HipopotamoConPrisa We feature over 50,000 Q&A ! [03:51] HipopotamoConPrisa
We feature over 50,000 Q&A !
[03:51] HipopotamoConPrisa Tri.20728 InformaticaɉRC-Domain˿Instrumentaltdenadministracionldenwindowsb?k [03:51] HipopotamoConPrisa
Tri.20728 InformaticaɉRC-Domain˿Instrumentaltdenadministracionldenwindowsb?k
[03:51] HipopotamoConPrisa 1 Pista: *** Valor pregunta : 10825 Puntos [03:51] HipopotamoConPrisa
1 Pista: *** Valor pregunta : 10825 Puntos
[03:51] HipopotamoConPrisa 2 Pista: wmi 30 segundos y 10825 Puntos [03:51] HipopotamoConPrisa
2 Pista: wmi 30 segundos y 10825 Puntos
[03:51] Hipopotamo\Especial wmi [03:51] Hipopotamo\Especial
wmi
[03:51] HipopotamoConPrisa �Bingo!! Hipopotamo\Especial dio la respuesta: "wmi" en �8.062 segundos e incrementa sus ganancias con �0825�12 puntos [03:51] HipopotamoConPrisa
�Bingo!! Hipopotamo\Especial dio la respuesta: "wmi" en �8.062 segundos e incrementa sus ganancias con �0825�12 puntos
[03:51] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 557741, SEMANA: 12313855 y MES: 12313855 [03:51] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 557741, SEMANA: 12313855 y MES: 12313855
[03:51] Lince{Torpe wimi [03:51] Lince{Torpe
wimi
[03:51] HipopotamoConPrisa Tri.20408 CienciaɞIrati˿Laberupci󮃰1gviolentabquegproduceggrandesicantidadesidegceniczasiyenubesimuyeextensasiesidegtipoe?a [03:51] HipopotamoConPrisa
Tri.20408 CienciaɞIrati˿Laberupci󮃰1gviolentabquegproduceggrandesicantidadesidegceniczasiyenubesimuyeextensasiesidegtipoe?a
[03:51] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 22745 Puntos [03:51] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 22745 Puntos
[03:51] HipopotamoConPrisa 2 Pista: ves****** 30 segundos y 22745 Puntos [03:51] HipopotamoConPrisa
2 Pista: ves****** 30 segundos y 22745 Puntos
[03:52] HipopotamoConPrisa 3 Pista: vesu*ia*a 15 segundos y 22745 Puntos [03:52] HipopotamoConPrisa
3 Pista: vesu*ia*a 15 segundos y 22745 Puntos
[03:52] HipopotamoConPrisa Tiempo! La respuesta es -> vesubiana <- [03:52] HipopotamoConPrisa
Tiempo! La respuesta es -> vesubiana <-
[03:52] HipopotamoConPrisa Tri.1302 Idiomasɐax˿ComousemdicemlalletralHeencelralfabetoufoneticou(ingles)e?e [03:52] HipopotamoConPrisa
Tri.1302 Idiomasɐax˿ComousemdicemlalletralHeencelralfabetoufoneticou(ingles)e?e
[03:52] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 8629 Puntos [03:52] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 8629 Puntos
[03:52] HipopotamoConPrisa 2 Pista: Hot** 30 segundos y 8629 Puntos [03:52] HipopotamoConPrisa
2 Pista: Hot** 30 segundos y 8629 Puntos
[03:52] Lince{Torpe eich [03:52] Lince{Torpe
eich
[03:52] HipopotamoConPrisa �Hipopotamo\Especial acert󡡠La respuesta era: "hotel" y contest󠥮 �6.985 segundos. Se lleva: �629�12 puntos [03:52] HipopotamoConPrisa
�Hipopotamo\Especial acert󡡠La respuesta era: "hotel" y contest󠥮 �6.985 segundos. Se lleva: �629�12 puntos
[03:52] HipopotamoConPrisa Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 566370, SEMANA: 12322484 y MES: 12322484 [03:52] HipopotamoConPrisa
Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 566370, SEMANA: 12322484 y MES: 12322484
[03:52] Hipopotamo\Especial hotel [03:52] Hipopotamo\Especial
hotel
[03:53] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [03:53] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[03:53] HipopotamoConPrisa Tri.7531 Idiomasɦlipp_er˿Comoesexdicex"tres"lenwaleman?l?l [03:53] HipopotamoConPrisa
Tri.7531 Idiomasɦlipp_er˿Comoesexdicex"tres"lenwaleman?l?l
[03:53] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 18608 Puntos [03:53] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 18608 Puntos
[03:53] Lince{Torpe drei [03:53] Lince{Torpe
drei
[03:53] HipopotamoConPrisa �Increible!! Lince{Torpe contest󺠃04"drei" en �4.828 segundos, y ha ganado �8608�12 puntos [03:53] HipopotamoConPrisa
�Increible!! Lince{Torpe contest󺠃04"drei" en �4.828 segundos, y ha ganado �8608�12 puntos
[03:53] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:53] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:53] HipopotamoConPrisa Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 253542, SEMANA: 5215660 y MES: 5215660 [03:53] HipopotamoConPrisa
Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 253542, SEMANA: 5215660 y MES: 5215660
[03:53] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [03:53] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[03:53] HipopotamoConPrisa Tri.1686 HistoriaɊAVEA˿22-ENERO-1905:bENbQUEbCIUDADbRUSAbDEbPORbENTONCES,bMUERENb500bOBREROSbDEbUNAbMANIFESTACIONbDEb30.000b?b [03:53] HipopotamoConPrisa
Tri.1686 HistoriaɊAVEA˿22-ENERO-1905:bENbQUEbCIUDADbRUSAbDEbPORbENTONCES,bMUERENb500bOBREROSbDEbUNAbMANIFESTACIONbDEb30.000b?b
[03:53] HipopotamoConPrisa 1 Pista: *** *********** Pregunta de BONUS : 200000 Puntos [03:53] HipopotamoConPrisa
1 Pista: *** *********** Pregunta de BONUS : 200000 Puntos
[03:53] HipopotamoConPrisa 2 Pista: SAN *********** 30 segundos y 200000 Puntos [03:53] HipopotamoConPrisa
2 Pista: SAN *********** 30 segundos y 200000 Puntos
[03:54] HipopotamoConPrisa 3 Pista: SAN *E*E***U**O 15 segundos y 200000 Puntos [03:54] HipopotamoConPrisa
3 Pista: SAN *E*E***U**O 15 segundos y 200000 Puntos
[03:54] Lince{Torpe san petesemburgo [03:54] Lince{Torpe
san petesemburgo
[03:54] HipopotamoConPrisa Tiempo! La respuesta es -> SAN�ETERSBURGO <- [03:54] HipopotamoConPrisa
Tiempo! La respuesta es -> SAN�ETERSBURGO <-
[03:54] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [03:54] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[03:54] HipopotamoConPrisa Tri.12590 Miscelaneaɓebosin˿(Religi󮩅lacardenalaVincenzocGioacchinocPecciofueoungidocenm1878yPapaodeoRoma.y߃onmqu郰1ynombreorein󿃰1y?y [03:54] HipopotamoConPrisa
Tri.12590 Miscelaneaɓebosin˿(Religi󮩅lacardenalaVincenzocGioacchinocPecciofueoungidocenm1878yPapaodeoRoma.y߃onmqu郰1ynombreorein󿃰1y?y
[03:54] HipopotamoConPrisa 1 Pista: **** **** Valor pregunta : 7185 Puntos [03:54] HipopotamoConPrisa
1 Pista: **** **** Valor pregunta : 7185 Puntos
[03:54] HipopotamoConPrisa 2 Pista: leo* **** 30 segundos y 7185 Puntos [03:54] HipopotamoConPrisa
2 Pista: leo* **** 30 segundos y 7185 Puntos
[03:54] HipopotamoConPrisa 3 Pista: leo* *iii 15 segundos y 7185 Puntos [03:54] HipopotamoConPrisa
3 Pista: leo* *iii 15 segundos y 7185 Puntos
[03:55] Hipopotamo\Especial leon xiii [03:55] Hipopotamo\Especial
leon xiii
[03:55] HipopotamoConPrisa �Eso es Hipopotamo\Especial!! Dijiste: "leon xiii" y ello te ha valido: �185�12 puntos [03:55] HipopotamoConPrisa
�Eso es Hipopotamo\Especial!! Dijiste: "leon xiii" y ello te ha valido: �185�12 puntos
[03:55] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 573555, SEMANA: 12329669 y MES: 12329669 [03:55] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 573555, SEMANA: 12329669 y MES: 12329669
[03:55] Lince{Torpe leon XIII [03:55] Lince{Torpe
leon XIII
[03:55] Lince{Torpe leon XVII [03:55] Lince{Torpe
leon XVII
[03:55] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [03:55] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[03:55] HipopotamoConPrisa Tri.11343 Cotilleo-TVɃarPEnTer˿(LosbSimpson-4ʃ01htemporada)hAhqu郰1hparquewtemᴩcobllevakSelmakakBart,hLisakyhMaggiewenjelrepisodiob"Lakelecci󮃰1jdewSelma"h?h [03:55] HipopotamoConPrisa
Tri.11343 Cotilleo-TVɃarPEnTer˿(LosbSimpson-4ʃ01htemporada)hAhqu郰1hparquewtemᴩcobllevakSelmakakBart,hLisakyhMaggiewenjelrepisodiob"Lakelecci󮃰1jdewSelma"h?h
[03:55] HipopotamoConPrisa 1 Pista: ******** **** Valor pregunta : 21742 Puntos [03:55] HipopotamoConPrisa
1 Pista: ******** **** Valor pregunta : 21742 Puntos
[03:55] HipopotamoConPrisa 2 Pista: jar***** **** 30 segundos y 21742 Puntos [03:55] HipopotamoConPrisa
2 Pista: jar***** **** 30 segundos y 21742 Puntos
[03:55] HipopotamoConPrisa 3 Pista: jar*i*e* *u** 15 segundos y 21742 Puntos [03:55] HipopotamoConPrisa
3 Pista: jar*i*e* *u** 15 segundos y 21742 Puntos
[03:55] HipopotamoConPrisa Tiempo! La respuesta es -> jardines�uff <- [03:55] HipopotamoConPrisa
Tiempo! La respuesta es -> jardines�uff <-
[03:56] HipopotamoConPrisa For The Competitive Edge type !pingme [03:56] HipopotamoConPrisa
For The Competitive Edge type !pingme
[03:56] HipopotamoConPrisa Tri.18777 Cienciaɳtephenwo˿C󭯃01ksejllamabamlamprimeramhiladoraminventadamporfJamesbHargreaves?y?y [03:56] HipopotamoConPrisa
Tri.18777 Cienciaɳtephenwo˿C󭯃01ksejllamabamlamprimeramhiladoraminventadamporfJamesbHargreaves?y?y
[03:56] HipopotamoConPrisa 1 Pista: ******** ***** Valor pregunta : 17234 Puntos [03:56] HipopotamoConPrisa
1 Pista: ******** ***** Valor pregunta : 17234 Puntos
[03:56] HipopotamoConPrisa 2 Pista: spi***** ***** 30 segundos y 17234 Puntos [03:56] HipopotamoConPrisa
2 Pista: spi***** ***** 30 segundos y 17234 Puntos
[03:56] HipopotamoConPrisa 3 Pista: spi**i** *e*** 15 segundos y 17234 Puntos [03:56] HipopotamoConPrisa
3 Pista: spi**i** *e*** 15 segundos y 17234 Puntos
[03:56] Lince{Torpe SPINNING JENNY [03:56] Lince{Torpe
SPINNING JENNY
[03:56] HipopotamoConPrisa �e nota que sabes mucho de esto Lince{Torpe! Tu respuesta "SPINNING JENNY" es correcta y ganas �7234�12 puntos [03:56] HipopotamoConPrisa
�e nota que sabes mucho de esto Lince{Torpe! Tu respuesta "SPINNING JENNY" es correcta y ganas �7234�12 puntos
[03:56] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:56] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:56] HipopotamoConPrisa Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 270776, SEMANA: 5232894 y MES: 5232894 [03:56] HipopotamoConPrisa
Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 270776, SEMANA: 5232894 y MES: 5232894
[03:56] Cabra\Naranja Avisando a Lince{Torpe de que no use mayúsculas. [1] [03:56] Cabra\Naranja
Avisando a Lince{Torpe de que no use mayúsculas. [1]
[03:56] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:56] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:56] HipopotamoConPrisa Tri.15434 Economiaɖivi˿Bajoxqueusiglasfseuagrupanylosfprincipalesfpa�sfproductoresfdeupetr󬥯?h?h [03:56] HipopotamoConPrisa
Tri.15434 Economiaɖivi˿Bajoxqueusiglasfseuagrupanylosfprincipalesfpa�sfproductoresfdeupetr󬥯?h?h
[03:56] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 6628 Puntos [03:56] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 6628 Puntos
[03:57] HipopotamoConPrisa 2 Pista: ope* 30 segundos y 6628 Puntos [03:57] HipopotamoConPrisa
2 Pista: ope* 30 segundos y 6628 Puntos
[03:57] Lince{Torpe opop [03:57] Lince{Torpe
opop
[03:57] Hipopotamo\Especial oper [03:57] Hipopotamo\Especial
oper
[03:57] HipopotamoConPrisa 3 Pista: ope* 15 segundos y 6628 Puntos [03:57] HipopotamoConPrisa
3 Pista: ope* 15 segundos y 6628 Puntos
[03:57] HipopotamoConPrisa �Suma y sigue Lince{Torpe!! La respuesta: "opep" incrementa tu marcador en �628�12 puntos [03:57] HipopotamoConPrisa
�Suma y sigue Lince{Torpe!! La respuesta: "opep" incrementa tu marcador en �628�12 puntos
[03:57] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:57] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:57] HipopotamoConPrisa Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 277404, SEMANA: 5239522 y MES: 5239522 [03:57] HipopotamoConPrisa
Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 277404, SEMANA: 5239522 y MES: 5239522
[03:57] Lince{Torpe opep [03:57] Lince{Torpe
opep
[03:57] HipopotamoConPrisa R᮫ing MES: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12329669 #3: Lince{Torpe 5232894 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [03:57] HipopotamoConPrisa
R᮫ing MES: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12329669 #3: Lince{Torpe 5232894 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[03:57] HipopotamoConPrisa Tri.13511 CancionesɃHESARE˿EnbelarecopilatoriomdemMiliki,rquienbcantadconbelaelatemad"Susanita"r?r [03:57] HipopotamoConPrisa
Tri.13511 CancionesɃHESARE˿EnbelarecopilatoriomdemMiliki,rquienbcantadconbelaelatemad"Susanita"r?r
[03:57] HipopotamoConPrisa 1 Pista: ******* ****** Valor pregunta : 6752 Puntos [03:57] HipopotamoConPrisa
1 Pista: ******* ****** Valor pregunta : 6752 Puntos
[03:57] HipopotamoConPrisa 2 Pista: mar**** ****** 30 segundos y 6752 Puntos [03:57] HipopotamoConPrisa
2 Pista: mar**** ****** 30 segundos y 6752 Puntos
[03:58] Lince{Torpe macela orelo [03:58] Lince{Torpe
macela orelo
[03:58] HipopotamoConPrisa 3 Pista: mar*e*a *o*e*o 15 segundos y 6752 Puntos [03:58] HipopotamoConPrisa
3 Pista: mar*e*a *o*e*o 15 segundos y 6752 Puntos
[03:58] Lince{Torpe marcela morelo [03:58] Lince{Torpe
marcela morelo
[03:58] HipopotamoConPrisa �Increible!! Lince{Torpe contest󺠃04"marcela morelo" en �5.422 segundos, y ha ganado �752�12 puntos [03:58] HipopotamoConPrisa
�Increible!! Lince{Torpe contest󺠃04"marcela morelo" en �5.422 segundos, y ha ganado �752�12 puntos
[03:58] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:58] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:58] HipopotamoConPrisa Lince{Torpe has acertado 3 seguidas!! Puntos HOY: 284156, SEMANA: 5246274 y MES: 5246274 [03:58] HipopotamoConPrisa
Lince{Torpe has acertado 3 seguidas!! Puntos HOY: 284156, SEMANA: 5246274 y MES: 5246274
[03:58] HipopotamoConPrisa Please refrain from using Extreme Bad Language [03:58] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[03:58] HipopotamoConPrisa Tri.20097 Personajesɖivian˿Ensqu郰1fpa�01fnaci󃰱felfcosmonautaqYurijGagarin?f?f [03:58] HipopotamoConPrisa
Tri.20097 Personajesɖivian˿Ensqu郰1fpa�01fnaci󃰱felfcosmonautaqYurijGagarin?f?f
[03:58] HipopotamoConPrisa 1 Pista: ***** ********* Valor pregunta : 5401 Puntos [03:58] HipopotamoConPrisa
1 Pista: ***** ********* Valor pregunta : 5401 Puntos
[03:58] HipopotamoConPrisa 2 Pista: uni** ********* 30 segundos y 5401 Puntos [03:58] HipopotamoConPrisa
2 Pista: uni** ********* 30 segundos y 5401 Puntos
[03:58] Lince{Torpe union sovietica [03:58] Lince{Torpe
union sovietica
[03:58] HipopotamoConPrisa �Ol頃04Lince{Torpe!! Has contestado: "union sovietica" en �2.516 segundos y sumas �401�12 puntos a tu marcador. �Sigue as� [03:58] HipopotamoConPrisa
�Ol頃04Lince{Torpe!! Has contestado: "union sovietica" en �2.516 segundos y sumas �401�12 puntos a tu marcador. �Sigue as�
[03:58] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:58] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:58] HipopotamoConPrisa Lince{Torpe has acertado 4 seguidas!! Puntos HOY: 289557, SEMANA: 5251675 y MES: 5251675 [03:58] HipopotamoConPrisa
Lince{Torpe has acertado 4 seguidas!! Puntos HOY: 289557, SEMANA: 5251675 y MES: 5251675
[03:58] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [03:58] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[03:58] HipopotamoConPrisa Tri.7197 Cotilleo-TVɤassler˿Cuᬃ01iespelinombrendelifamosoftr�denestuvofrelacionadofconclasdivasespa񯬡sdenlascanci󮃰1ccultasMarujitasD�?x?x [03:58] HipopotamoConPrisa
Tri.7197 Cotilleo-TVɤassler˿Cuᬃ01iespelinombrendelifamosoftr�denestuvofrelacionadofconclasdivasespa񯬡sdenlascanci󮃰1ccultasMarujitasD�?x?x
[03:58] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 24635 Puntos [03:58] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 24635 Puntos
[03:59] HipopotamoConPrisa 2 Pista: din** 30 segundos y 24635 Puntos [03:59] HipopotamoConPrisa
2 Pista: din** 30 segundos y 24635 Puntos
[03:59] HipopotamoConPrisa 3 Pista: dinio 15 segundos y 24635 Puntos [03:59] HipopotamoConPrisa
3 Pista: dinio 15 segundos y 24635 Puntos
[03:59] HipopotamoConPrisa �e nota que sabes mucho de esto Lince{Torpe! Tu respuesta "dinio" es correcta y ganas �4635�12 puntos [03:59] HipopotamoConPrisa
�e nota que sabes mucho de esto Lince{Torpe! Tu respuesta "dinio" es correcta y ganas �4635�12 puntos
[03:59] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [03:59] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[03:59] HipopotamoConPrisa Lince{Torpe has acertado 5 seguidas!! Puntos HOY: 314192, SEMANA: 5276310 y MES: 5276310 [03:59] HipopotamoConPrisa
Lince{Torpe has acertado 5 seguidas!! Puntos HOY: 314192, SEMANA: 5276310 y MES: 5276310
[03:59] Lince{Torpe dinio [03:59] Lince{Torpe
dinio
[03:59] HipopotamoConPrisa This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [03:59] HipopotamoConPrisa
This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[03:59] HipopotamoConPrisa Tri.9399 IdiomasɃocoman˿LATIN-ESPAяLz߱ueysignificap"concelebro"?z?z [03:59] HipopotamoConPrisa
Tri.9399 IdiomasɃocoman˿LATIN-ESPAяLz߱ueysignificap"concelebro"?z?z
[03:59] HipopotamoConPrisa 1 Pista: ********** Valor pregunta : 20606 Puntos [03:59] HipopotamoConPrisa
1 Pista: ********** Valor pregunta : 20606 Puntos
[03:59] HipopotamoConPrisa 2 Pista: fre******* 30 segundos y 20606 Puntos [03:59] HipopotamoConPrisa
2 Pista: fre******* 30 segundos y 20606 Puntos
[04:00] HipopotamoConPrisa 3 Pista: fre*ue**a* 15 segundos y 20606 Puntos [04:00] HipopotamoConPrisa
3 Pista: fre*ue**a* 15 segundos y 20606 Puntos
[04:00] Hipopotamo\Especial frecuentar [04:00] Hipopotamo\Especial
frecuentar
[04:00] HipopotamoConPrisa �As�e hace Hipopotamo\Especial!! Contestaste "frecuentar" en �1.141 segundos y sumas �0606�12 puntos [04:00] HipopotamoConPrisa
�As�e hace Hipopotamo\Especial!! Contestaste "frecuentar" en �1.141 segundos y sumas �0606�12 puntos
[04:00] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 594161, SEMANA: 12350275 y MES: 12350275 [04:00] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 594161, SEMANA: 12350275 y MES: 12350275
[04:00] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [04:00] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[04:00] HipopotamoConPrisa Tri.20291 Medicina-SaludɄarklest˿Cuantosiaminoacidosiexistenpenpelvcuerpo?r?r [04:00] HipopotamoConPrisa
Tri.20291 Medicina-SaludɄarklest˿Cuantosiaminoacidosiexistenpenpelvcuerpo?r?r
[04:00] HipopotamoConPrisa 1 Pista: ****** Valor pregunta : 6187 Puntos [04:00] HipopotamoConPrisa
1 Pista: ****** Valor pregunta : 6187 Puntos
[04:00] HipopotamoConPrisa 2 Pista: vei*** 30 segundos y 6187 Puntos [04:00] HipopotamoConPrisa
2 Pista: vei*** 30 segundos y 6187 Puntos
[04:00] Lince{Torpe soy aseadora de un colegio y no me averguenzo de ello [04:00] Lince{Torpe
soy aseadora de un colegio y no me averguenzo de ello
[04:00] HipopotamoConPrisa �Increible!! Hipopotamo\Especial contest󺠃04"veinte" en �8.844 segundos, y ha ganado �187�12 puntos [04:00] HipopotamoConPrisa
�Increible!! Hipopotamo\Especial contest󺠃04"veinte" en �8.844 segundos, y ha ganado �187�12 puntos
[04:00] HipopotamoConPrisa Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 600348, SEMANA: 12356462 y MES: 12356462 [04:00] HipopotamoConPrisa
Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 600348, SEMANA: 12356462 y MES: 12356462
[04:00] Hipopotamo\Especial veinte [04:00] Hipopotamo\Especial
veinte
[04:00] HipopotamoConPrisa This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [04:00] HipopotamoConPrisa
This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[04:00] HipopotamoConPrisa Tri.9723 Cotilleo-TVɣarlovigo˿ComocsecllamabanhlosmRopper?b?b [04:00] HipopotamoConPrisa
Tri.9723 Cotilleo-TVɣarlovigo˿ComocsecllamabanhlosmRopper?b?b
[04:00] HipopotamoConPrisa 1 Pista: ****** * ******* Valor pregunta : 23477 Puntos [04:00] HipopotamoConPrisa
1 Pista: ****** * ******* Valor pregunta : 23477 Puntos
[04:01] HipopotamoConPrisa 2 Pista: geo*** * ******* 30 segundos y 23477 Puntos [04:01] HipopotamoConPrisa
2 Pista: geo*** * ******* 30 segundos y 23477 Puntos
[04:01] HipopotamoConPrisa �Bien Lince{Torpe!! Tu respuesta: "george y mildred" es correcta y ganas �3477�12 puntos [04:01] HipopotamoConPrisa
�Bien Lince{Torpe!! Tu respuesta: "george y mildred" es correcta y ganas �3477�12 puntos
[04:01] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:01] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:01] HipopotamoConPrisa Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 337669, SEMANA: 5299787 y MES: 5299787 [04:01] HipopotamoConPrisa
Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 337669, SEMANA: 5299787 y MES: 5299787
[04:01] Lince{Torpe george y mildred [04:01] Lince{Torpe
george y mildred
[04:01] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [04:01] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[04:01] HipopotamoConPrisa Tri.16520 MiscelaneaɔeLaRaNhA˿Confladronesoytgatoso?l [04:01] HipopotamoConPrisa
Tri.16520 MiscelaneaɔeLaRaNhA˿Confladronesoytgatoso?l
[04:01] HipopotamoConPrisa 1 Pista: ***** ****** Valor pregunta : 11118 Puntos [04:01] HipopotamoConPrisa
1 Pista: ***** ****** Valor pregunta : 11118 Puntos
[04:01] HipopotamoConPrisa 2 Pista: poc** ****** 30 segundos y 11118 Puntos [04:01] HipopotamoConPrisa
2 Pista: poc** ****** 30 segundos y 11118 Puntos
[04:01] HipopotamoConPrisa 3 Pista: poco* **a*o* 15 segundos y 11118 Puntos [04:01] HipopotamoConPrisa
3 Pista: poco* **a*o* 15 segundos y 11118 Puntos
[04:01] Lince{Torpe poco trato [04:01] Lince{Torpe
poco trato
[04:02] HipopotamoConPrisa �Suma y sigue Lince{Torpe!! La respuesta: "pocos tratos" incrementa tu marcador en �1118�12 puntos [04:02] HipopotamoConPrisa
�Suma y sigue Lince{Torpe!! La respuesta: "pocos tratos" incrementa tu marcador en �1118�12 puntos
[04:02] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:02] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:02] HipopotamoConPrisa Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 348787, SEMANA: 5310905 y MES: 5310905 [04:02] HipopotamoConPrisa
Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 348787, SEMANA: 5310905 y MES: 5310905
[04:02] Lince{Torpe pocos tratos [04:02] Lince{Torpe
pocos tratos
[04:02] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [04:02] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[04:02] HipopotamoConPrisa Tri.18805 Cineɮinguno˿Cualsesalaspeliculasmasavotadasdelsimdbp(enningl鳩?c?c [04:02] HipopotamoConPrisa
Tri.18805 Cineɮinguno˿Cualsesalaspeliculasmasavotadasdelsimdbp(enningl鳩?c?c
[04:02] HipopotamoConPrisa 1 Pista: **** **** Valor pregunta : 22797 Puntos [04:02] HipopotamoConPrisa
1 Pista: **** **** Valor pregunta : 22797 Puntos
[04:02] HipopotamoConPrisa 2 Pista: sta* **** 30 segundos y 22797 Puntos [04:02] HipopotamoConPrisa
2 Pista: sta* **** 30 segundos y 22797 Puntos
[04:02] HipopotamoConPrisa 3 Pista: sta* *a** 15 segundos y 22797 Puntos [04:02] HipopotamoConPrisa
3 Pista: sta* *a** 15 segundos y 22797 Puntos
[04:02] HipopotamoConPrisa Tiempo! La respuesta es -> star�ars <- [04:02] HipopotamoConPrisa
Tiempo! La respuesta es -> star�ars <-
[04:03] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [04:03] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[04:03] HipopotamoConPrisa Tri.17655 Mitologiaɤon_Vito˿AMAMANTADOSfPORfLAfLOBAfCAPITOLINA,fFUERON...f?f [04:03] HipopotamoConPrisa
Tri.17655 Mitologiaɤon_Vito˿AMAMANTADOSfPORfLAfLOBAfCAPITOLINA,fFUERON...f?f
[04:03] HipopotamoConPrisa 1 Pista: ****** * **** Valor pregunta : 8683 Puntos [04:03] HipopotamoConPrisa
1 Pista: ****** * **** Valor pregunta : 8683 Puntos
[04:03] HipopotamoConPrisa 2 Pista: rom*** * **** 30 segundos y 8683 Puntos [04:03] HipopotamoConPrisa
2 Pista: rom*** * **** 30 segundos y 8683 Puntos
[04:03] HipopotamoConPrisa �Ol頃04Lince{Torpe!! Has contestado: "romulo y remo" en �0.86 segundos y sumas �683�12 puntos a tu marcador. �Sigue as� [04:03] HipopotamoConPrisa
�Ol頃04Lince{Torpe!! Has contestado: "romulo y remo" en �0.86 segundos y sumas �683�12 puntos a tu marcador. �Sigue as�
[04:03] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:03] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:03] HipopotamoConPrisa Lince{Torpe has acertado 3 seguidas!! Puntos HOY: 357470, SEMANA: 5319588 y MES: 5319588 [04:03] HipopotamoConPrisa
Lince{Torpe has acertado 3 seguidas!! Puntos HOY: 357470, SEMANA: 5319588 y MES: 5319588
[04:03] Lince{Torpe romulo y remo [04:03] Lince{Torpe
romulo y remo
[04:03] HipopotamoConPrisa R᮫ing SEMANA: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12356462 #3: Lince{Torpe 5319588 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [04:03] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12356462 #3: Lince{Torpe 5319588 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[04:03] HipopotamoConPrisa Tri.18086 Personajesɳtephenwo˿CualterapeltverdaderolnombretdetSanePablo?t?t [04:03] HipopotamoConPrisa
Tri.18086 Personajesɳtephenwo˿CualterapeltverdaderolnombretdetSanePablo?t?t
[04:03] HipopotamoConPrisa 1 Pista: ***** ** ***** Valor pregunta : 18119 Puntos [04:03] HipopotamoConPrisa
1 Pista: ***** ** ***** Valor pregunta : 18119 Puntos
[04:03] HipopotamoConPrisa 2 Pista: sau** ** ***** 30 segundos y 18119 Puntos [04:03] HipopotamoConPrisa
2 Pista: sau** ** ***** 30 segundos y 18119 Puntos
[04:03] Lince{Torpe saulo de tarso [04:03] Lince{Torpe
saulo de tarso
[04:03] HipopotamoConPrisa �Est᳠que lo tiras Lince{Torpe!! ߃󭯠supiste que "saulo de tarso" era la respuesta? Venga, �8119�12 puntos suben a tu marcador [04:03] HipopotamoConPrisa
�Est᳠que lo tiras Lince{Torpe!! ߃󭯠supiste que "saulo de tarso" era la respuesta? Venga, �8119�12 puntos suben a tu marcador
[04:03] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:03] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:03] HipopotamoConPrisa Lince{Torpe has acertado 4 seguidas!! Puntos HOY: 375589, SEMANA: 5337707 y MES: 5337707 [04:03] HipopotamoConPrisa
Lince{Torpe has acertado 4 seguidas!! Puntos HOY: 375589, SEMANA: 5337707 y MES: 5337707
[04:04] HipopotamoConPrisa We feature over 50,000 Q&A ! [04:04] HipopotamoConPrisa
We feature over 50,000 Q&A !
[04:04] HipopotamoConPrisa Tri.18132 Miscelaneaɮapine˿ELcQUEcBUSCAcUNcAMIGOcSINcDEFECTOSc?c [04:04] HipopotamoConPrisa
Tri.18132 Miscelaneaɮapine˿ELcQUEcBUSCAcUNcAMIGOcSINcDEFECTOSc?c
[04:04] HipopotamoConPrisa 1 Pista: ** ***** *** ****** Valor pregunta : 10429 Puntos [04:04] HipopotamoConPrisa
1 Pista: ** ***** *** ****** Valor pregunta : 10429 Puntos
[04:04] HipopotamoConPrisa 2 Pista: se�**** *** ****** 30 segundos y 10429 Puntos [04:04] HipopotamoConPrisa
2 Pista: se�**** *** ****** 30 segundos y 10429 Puntos
[04:04] HipopotamoConPrisa �Bingo!! Lince{Torpe dio la respuesta: "se queda sin amigos" en �1.172 segundos e incrementa sus ganancias con �0429�12 puntos [04:04] HipopotamoConPrisa
�Bingo!! Lince{Torpe dio la respuesta: "se queda sin amigos" en �1.172 segundos e incrementa sus ganancias con �0429�12 puntos
[04:04] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:04] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:04] HipopotamoConPrisa Lince{Torpe has acertado 5 seguidas!! Puntos HOY: 386018, SEMANA: 5348136 y MES: 5348136 [04:04] HipopotamoConPrisa
Lince{Torpe has acertado 5 seguidas!! Puntos HOY: 386018, SEMANA: 5348136 y MES: 5348136
[04:04] Hipopotamo\Especial se queda sin amigos [04:04] Hipopotamo\Especial
se queda sin amigos
[04:04] Lince{Torpe se queda sin amigos [04:04] Lince{Torpe
se queda sin amigos
[04:04] HipopotamoConPrisa Tri.16617 MiscelaneaɔeLaRaNhA˿Daoeldsartenazoweldquettienetlaosarten...d?d [04:04] HipopotamoConPrisa
Tri.16617 MiscelaneaɔeLaRaNhA˿Daoeldsartenazoweldquettienetlaosarten...d?d
[04:04] HipopotamoConPrisa 1 Pista: *** ** ***** Pregunta de BONUS : 200000 Puntos [04:04] HipopotamoConPrisa
1 Pista: *** ** ***** Pregunta de BONUS : 200000 Puntos
[04:04] Lince{Torpe por el mango [04:04] Lince{Torpe
por el mango
[04:04] HipopotamoConPrisa �Absolutamente correcto Lince{Torpe!! Acertaste "por el mango" en �2.204 segundos y ganas �00000�12 puntos [04:04] HipopotamoConPrisa
�Absolutamente correcto Lince{Torpe!! Acertaste "por el mango" en �2.204 segundos y ganas �00000�12 puntos
[04:04] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:04] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:04] HipopotamoConPrisa Lince{Torpe has acertado 6 seguidas!! Puntos HOY: 586018, SEMANA: 5548136 y MES: 5548136 [04:04] HipopotamoConPrisa
Lince{Torpe has acertado 6 seguidas!! Puntos HOY: 586018, SEMANA: 5548136 y MES: 5548136
[04:05] HipopotamoConPrisa Tri.19079 Fisica-Quimicaɐerikles˿DEsQuelPART̓ULASsSEsSOSPECHAsQUEsPUEDANsSUPERARsLAsVELOCIDADsDEsLAsLUZs?s [04:05] HipopotamoConPrisa
Tri.19079 Fisica-Quimicaɐerikles˿DEsQuelPART̓ULASsSEsSOSPECHAsQUEsPUEDANsSUPERARsLAsVELOCIDADsDEsLAsLUZs?s
[04:05] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 5166 Puntos [04:05] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 5166 Puntos
[04:05] HipopotamoConPrisa 2 Pista: taq****** 30 segundos y 5166 Puntos [04:05] HipopotamoConPrisa
2 Pista: taq****** 30 segundos y 5166 Puntos
[04:05] Lince{Torpe quiones [04:05] Lince{Torpe
quiones
[04:05] HipopotamoConPrisa 3 Pista: taquio*e* 15 segundos y 5166 Puntos [04:05] HipopotamoConPrisa
3 Pista: taquio*e* 15 segundos y 5166 Puntos
[04:05] HipopotamoConPrisa �As�e hace Hipopotamo\Especial!! Contestaste "taquiones" en �2.391 segundos y sumas �166�12 puntos [04:05] HipopotamoConPrisa
�As�e hace Hipopotamo\Especial!! Contestaste "taquiones" en �2.391 segundos y sumas �166�12 puntos
[04:05] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 605514, SEMANA: 12361628 y MES: 12361628 [04:05] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 605514, SEMANA: 12361628 y MES: 12361628
[04:05] Hipopotamo\Especial taquiones [04:05] Hipopotamo\Especial
taquiones
[04:05] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [04:05] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[04:05] HipopotamoConPrisa Tri.18680 Cotilleo-TVɅLCHUPAO˿CUALiESiELiNOMBREiDEiPILAiDEiAMPAROiBAROiENi7iVIDASi(a񯃰1t2005)i?i [04:05] HipopotamoConPrisa
Tri.18680 Cotilleo-TVɅLCHUPAO˿CUALiESiELiNOMBREiDEiPILAiDEiAMPAROiBAROiENi7iVIDASi(a񯃰1t2005)i?i
[04:05] HipopotamoConPrisa 1 Pista: ******* ***** Valor pregunta : 22831 Puntos [04:05] HipopotamoConPrisa
1 Pista: ******* ***** Valor pregunta : 22831 Puntos
[04:06] HipopotamoConPrisa 2 Pista: sol**** ***** 30 segundos y 22831 Puntos [04:06] HipopotamoConPrisa
2 Pista: sol**** ***** 30 segundos y 22831 Puntos
[04:06] Lince{Torpe soledad huete [04:06] Lince{Torpe
soledad huete
[04:06] HipopotamoConPrisa �emuestra lo que sabes Lince{Torpe! Has respondido "soledad huete" correctamente y eso te da: �2831�12 puntos [04:06] HipopotamoConPrisa
�emuestra lo que sabes Lince{Torpe! Has respondido "soledad huete" correctamente y eso te da: �2831�12 puntos
[04:06] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:06] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:06] HipopotamoConPrisa Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 608849, SEMANA: 5570967 y MES: 5570967 [04:06] HipopotamoConPrisa
Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 608849, SEMANA: 5570967 y MES: 5570967
[04:06] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [04:06] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[04:06] HipopotamoConPrisa Tri.4191 IdiomasɁlkaid˿ESPA񏌭INGLES:CHANTAJE?m?m [04:06] HipopotamoConPrisa
Tri.4191 IdiomasɁlkaid˿ESPA񏌭INGLES:CHANTAJE?m?m
[04:06] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 6610 Puntos [04:06] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 6610 Puntos
[04:06] HipopotamoConPrisa 2 Pista: bla****** 30 segundos y 6610 Puntos [04:06] HipopotamoConPrisa
2 Pista: bla****** 30 segundos y 6610 Puntos
[04:06] HipopotamoConPrisa �Increible!! Lince{Torpe contest󺠃04"blackmail" en �9.109 segundos, y ha ganado �610�12 puntos [04:06] HipopotamoConPrisa
�Increible!! Lince{Torpe contest󺠃04"blackmail" en �9.109 segundos, y ha ganado �610�12 puntos
[04:06] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:06] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:06] HipopotamoConPrisa Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 615459, SEMANA: 5577577 y MES: 5577577 [04:06] HipopotamoConPrisa
Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 615459, SEMANA: 5577577 y MES: 5577577
[04:06] Lince{Torpe blackmail [04:06] Lince{Torpe
blackmail
[04:06] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [04:06] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[04:06] HipopotamoConPrisa Tri.8130 Cotilleo-TVɒadian˿AiquientperteneceylayempresayGlobomedia?i?i [04:06] HipopotamoConPrisa
Tri.8130 Cotilleo-TVɒadian˿AiquientperteneceylayempresayGlobomedia?i?i
[04:06] HipopotamoConPrisa 1 Pista: ****** ****** Valor pregunta : 7948 Puntos [04:06] HipopotamoConPrisa
1 Pista: ****** ****** Valor pregunta : 7948 Puntos
[04:06] HipopotamoConPrisa 2 Pista: emi*** ****** 30 segundos y 7948 Puntos [04:06] HipopotamoConPrisa
2 Pista: emi*** ****** 30 segundos y 7948 Puntos
[04:07] Hipopotamo\Especial amilio aragon [04:07] Hipopotamo\Especial
amilio aragon
[04:07] Hipopotamo\Especial emilio aragon [04:07] Hipopotamo\Especial
emilio aragon
[04:07] HipopotamoConPrisa �Eso es Hipopotamo\Especial!! Dijiste: "emilio aragon" y ello te ha valido: �948�12 puntos [04:07] HipopotamoConPrisa
�Eso es Hipopotamo\Especial!! Dijiste: "emilio aragon" y ello te ha valido: �948�12 puntos
[04:07] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 613462, SEMANA: 12369576 y MES: 12369576 [04:07] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 613462, SEMANA: 12369576 y MES: 12369576
[04:07] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [04:07] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[04:07] HipopotamoConPrisa Tri.2090 MitologiaɆrigotora˿Diosauhind�omadreodeotodosglosgseres?o?o [04:07] HipopotamoConPrisa
Tri.2090 MitologiaɆrigotora˿Diosauhind�omadreodeotodosglosgseres?o?o
[04:07] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 10400 Puntos [04:07] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 10400 Puntos
[04:07] HipopotamoConPrisa 2 Pista: adi** 30 segundos y 10400 Puntos [04:07] HipopotamoConPrisa
2 Pista: adi** 30 segundos y 10400 Puntos
[04:07] Lince{Torpe devi [04:07] Lince{Torpe
devi
[04:07] HipopotamoConPrisa 3 Pista: adi*i 15 segundos y 10400 Puntos [04:07] HipopotamoConPrisa
3 Pista: adi*i 15 segundos y 10400 Puntos
[04:08] Hipopotamo\Especial adili [04:08] Hipopotamo\Especial
adili
[04:08] Lince{Torpe sdivid [04:08] Lince{Torpe
sdivid
[04:08] Hipopotamo\Especial adini [04:08] Hipopotamo\Especial
adini
[04:08] HipopotamoConPrisa Tiempo! La respuesta es -> aditi <- [04:08] HipopotamoConPrisa
Tiempo! La respuesta es -> aditi <-
[04:08] HipopotamoConPrisa For The Competitive Edge type !pingme [04:08] HipopotamoConPrisa
For The Competitive Edge type !pingme
[04:08] HipopotamoConPrisa Tri.1947 Eros-SexɞTafira˿Castraci󮃰1ifemeninaa?j [04:08] HipopotamoConPrisa
Tri.1947 Eros-SexɞTafira˿Castraci󮃰1ifemeninaa?j
[04:08] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 18266 Puntos [04:08] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 18266 Puntos
[04:08] Lince{Torpe pomeroy [04:08] Lince{Torpe
pomeroy
[04:08] HipopotamoConPrisa 2 Pista: abl***** 30 segundos y 18266 Puntos [04:08] HipopotamoConPrisa
2 Pista: abl***** 30 segundos y 18266 Puntos
[04:08] Lince{Torpe mutilacion [04:08] Lince{Torpe
mutilacion
[04:08] HipopotamoConPrisa 3 Pista: abla*io* 15 segundos y 18266 Puntos [04:08] HipopotamoConPrisa
3 Pista: abla*io* 15 segundos y 18266 Puntos
[04:08] Lince{Torpe ablacion [04:08] Lince{Torpe
ablacion
[04:08] HipopotamoConPrisa �Est᳠que lo tiras Lince{Torpe!! ߃󭯠supiste que "ablacion" era la respuesta? Venga, �8266�12 puntos suben a tu marcador [04:08] HipopotamoConPrisa
�Est᳠que lo tiras Lince{Torpe!! ߃󭯠supiste que "ablacion" era la respuesta? Venga, �8266�12 puntos suben a tu marcador
[04:08] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:08] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:08] HipopotamoConPrisa Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 633725, SEMANA: 5595843 y MES: 5595843 [04:08] HipopotamoConPrisa
Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 633725, SEMANA: 5595843 y MES: 5595843
[04:09] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [04:09] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[04:09] HipopotamoConPrisa Tri.4741 Geografiaɓebosin˿CuᬥslsonxlaslcuatrohprovinciasldeeCerde񡿃01j?j [04:09] HipopotamoConPrisa
Tri.4741 Geografiaɓebosin˿CuᬥslsonxlaslcuatrohprovinciasldeeCerde񡿃01j?j
[04:09] HipopotamoConPrisa 1 Pista: ******** ***** ******** * ******* Valor pregunta : 15379 Puntos [04:09] HipopotamoConPrisa
1 Pista: ******** ***** ******** * ******* Valor pregunta : 15379 Puntos
[04:09] HipopotamoConPrisa 2 Pista: cag***** ***** ******** * ******* 30 segundos y 15379 Puntos [04:09] HipopotamoConPrisa
2 Pista: cag***** ***** ******** * ******* 30 segundos y 15379 Puntos
[04:09] HipopotamoConPrisa 3 Pista: cag*ia*i *uo*o o*i**a*o * *a**a*i 15 segundos y 15379 Puntos [04:09] HipopotamoConPrisa
3 Pista: cag*ia*i *uo*o o*i**a*o * *a**a*i 15 segundos y 15379 Puntos
[04:09] Hipopotamo\Especial !radio [04:09] Hipopotamo\Especial
!radio
[04:09] Gata_Elocuente 📻 [Radio Luna de Miel] | 🎧 DJ: elvigilante | 🎶 Un Poco de Musica | 🌍 Puerto Rico | 📩 Peticiones: ABIERTAS | 🌐 www.radiolunademiel.com [04:09] Gata_Elocuente
📻 [Radio Luna de Miel] | 🎧 DJ: elvigilante | 🎶 Un Poco de Musica | 🌍 Puerto Rico | 📩 Peticiones: ABIERTAS | 🌐 www.radiolunademiel.com
[04:09] HipopotamoConPrisa Tiempo! La respuesta es -> cagliari�uoro�ristano��assari <- [04:09] HipopotamoConPrisa
Tiempo! La respuesta es -> cagliari�uoro�ristano��assari <-
[04:10] HipopotamoConPrisa R᮫ing MES: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12369576 #3: Lince{Torpe 5595843 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [04:10] HipopotamoConPrisa
R᮫ing MES: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12369576 #3: Lince{Torpe 5595843 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[04:10] HipopotamoConPrisa Tri.12477 Deporteɳein˿Futbol...:comowsehllamaldehnombrehviaud?e?e [04:10] HipopotamoConPrisa
Tri.12477 Deporteɳein˿Futbol...:comowsehllamaldehnombrehviaud?e?e
[04:10] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 20307 Puntos [04:10] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 20307 Puntos
[04:10] HipopotamoConPrisa 2 Pista: lau**** 30 segundos y 20307 Puntos [04:10] HipopotamoConPrisa
2 Pista: lau**** 30 segundos y 20307 Puntos
[04:10] HipopotamoConPrisa 3 Pista: lau*e** 15 segundos y 20307 Puntos [04:10] HipopotamoConPrisa
3 Pista: lau*e** 15 segundos y 20307 Puntos
[04:10] Lince{Torpe laurens [04:10] Lince{Torpe
laurens
[04:10] HipopotamoConPrisa Tiempo! La respuesta es -> laurent <- [04:10] HipopotamoConPrisa
Tiempo! La respuesta es -> laurent <-
[04:10] HipopotamoConPrisa Please refrain from using Extreme Bad Language [04:10] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[04:10] HipopotamoConPrisa Tri.10560 Biologiaɚytox˿Dondemsemencuentrandlosycentrosyrectoresydemlasvidasvegetativasgeneralp?r [04:10] HipopotamoConPrisa
Tri.10560 Biologiaɚytox˿Dondemsemencuentrandlosycentrosyrectoresydemlasvidasvegetativasgeneralp?r
[04:10] HipopotamoConPrisa 1 Pista: ********** Valor pregunta : 21114 Puntos [04:10] HipopotamoConPrisa
1 Pista: ********** Valor pregunta : 21114 Puntos
[04:11] HipopotamoConPrisa 2 Pista: hip******* 30 segundos y 21114 Puntos [04:11] HipopotamoConPrisa
2 Pista: hip******* 30 segundos y 21114 Puntos
[04:11] HipopotamoConPrisa 3 Pista: hipo*a*a*o 15 segundos y 21114 Puntos [04:11] HipopotamoConPrisa
3 Pista: hipo*a*a*o 15 segundos y 21114 Puntos
[04:11] HipopotamoConPrisa �Bingo!! Hipopotamo\Especial dio la respuesta: "hipotalamo" en �7.063 segundos e incrementa sus ganancias con �1114�12 puntos [04:11] HipopotamoConPrisa
�Bingo!! Hipopotamo\Especial dio la respuesta: "hipotalamo" en �7.063 segundos e incrementa sus ganancias con �1114�12 puntos
[04:11] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 634576, SEMANA: 12390690 y MES: 12390690 [04:11] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 634576, SEMANA: 12390690 y MES: 12390690
[04:11] Hipopotamo\Especial hipotalamo [04:11] Hipopotamo\Especial
hipotalamo
[04:11] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [04:11] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[04:11] HipopotamoConPrisa Tri.12756 Fisica-QuimicaɇaNDaLF˿Cuᬃ01hESxELxMaSxLIGEROxDExTODOSxLOSxMETALES?x?x [04:11] HipopotamoConPrisa
Tri.12756 Fisica-QuimicaɇaNDaLF˿Cuᬃ01hESxELxMaSxLIGEROxDExTODOSxLOSxMETALES?x?x
[04:11] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 22736 Puntos [04:11] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 22736 Puntos
[04:11] Lince{Torpe plata [04:11] Lince{Torpe
plata
[04:12] HipopotamoConPrisa 2 Pista: lit** 30 segundos y 22736 Puntos [04:12] HipopotamoConPrisa
2 Pista: lit** 30 segundos y 22736 Puntos
[04:12] HipopotamoConPrisa �Increible!! Lince{Torpe contest󺠃04"litio" en �6.078 segundos, y ha ganado �2736�12 puntos [04:12] HipopotamoConPrisa
�Increible!! Lince{Torpe contest󺠃04"litio" en �6.078 segundos, y ha ganado �2736�12 puntos
[04:12] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:12] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:12] HipopotamoConPrisa Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 656461, SEMANA: 5618579 y MES: 5618579 [04:12] HipopotamoConPrisa
Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 656461, SEMANA: 5618579 y MES: 5618579
[04:12] Lince{Torpe litio [04:12] Lince{Torpe
litio
[04:12] HipopotamoConPrisa This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [04:12] HipopotamoConPrisa
This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[04:12] HipopotamoConPrisa Tri.11096 MusicaɊAVEA˿18hMAYOh1909:QUEhCOMPOSITORhESPAяL,hMUEREhENhFRANCIAh?h [04:12] HipopotamoConPrisa
Tri.11096 MusicaɊAVEA˿18hMAYOh1909:QUEhCOMPOSITORhESPAяL,hMUEREhENhFRANCIAh?h
[04:12] HipopotamoConPrisa 1 Pista: ***** ******* Valor pregunta : 13756 Puntos [04:12] HipopotamoConPrisa
1 Pista: ***** ******* Valor pregunta : 13756 Puntos
[04:12] HipopotamoConPrisa 2 Pista: isa** ******* 30 segundos y 13756 Puntos [04:12] HipopotamoConPrisa
2 Pista: isa** ******* 30 segundos y 13756 Puntos
[04:12] HipopotamoConPrisa �Absolutamente correcto Hipopotamo\Especial!! Acertaste "isaac albeniz" en �3.546 segundos y ganas �3756�12 puntos [04:12] HipopotamoConPrisa
�Absolutamente correcto Hipopotamo\Especial!! Acertaste "isaac albeniz" en �3.546 segundos y ganas �3756�12 puntos
[04:12] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 648332, SEMANA: 12404446 y MES: 12404446 [04:12] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 648332, SEMANA: 12404446 y MES: 12404446
[04:12] Hipopotamo\Especial isaac albeniz [04:12] Hipopotamo\Especial
isaac albeniz
[04:12] Lince{Torpe isaac albeniz [04:12] Lince{Torpe
isaac albeniz
[04:12] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [04:12] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[04:12] HipopotamoConPrisa Tri.10804 Idiomasɐsico666˥spa񯬭ingles:wociox?w [04:12] HipopotamoConPrisa
Tri.10804 Idiomasɐsico666˥spa񯬭ingles:wociox?w
[04:12] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 7930 Puntos [04:12] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 7930 Puntos
[04:13] HipopotamoConPrisa 2 Pista: idl***** 30 segundos y 7930 Puntos [04:13] HipopotamoConPrisa
2 Pista: idl***** 30 segundos y 7930 Puntos
[04:13] Lince{Torpe leisure [04:13] Lince{Torpe
leisure
[04:13] HipopotamoConPrisa 3 Pista: idle*e** 15 segundos y 7930 Puntos [04:13] HipopotamoConPrisa
3 Pista: idle*e** 15 segundos y 7930 Puntos
[04:13] HipopotamoConPrisa Tiempo! La respuesta es -> idleness <- [04:13] HipopotamoConPrisa
Tiempo! La respuesta es -> idleness <-
[04:13] HipopotamoConPrisa This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [04:13] HipopotamoConPrisa
This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[04:13] HipopotamoConPrisa Tri.14209 Musicaɖivian˿C󭯃01vseollamabawMiguelhR�nenxsuqprimeraw鰯ca?n?n [04:13] HipopotamoConPrisa
Tri.14209 Musicaɖivian˿C󭯃01vseollamabawMiguelhR�nenxsuqprimeraw鰯ca?n?n
[04:13] HipopotamoConPrisa 1 Pista: **** **** Pregunta de BONUS : 25000 Puntos [04:13] HipopotamoConPrisa
1 Pista: **** **** Pregunta de BONUS : 25000 Puntos
[04:13] Gata_Elocuente Bienvenido elvigilante ADMIN de Radio Luna de Miel. [04:13] Gata_Elocuente
Bienvenido elvigilante ADMIN de Radio Luna de Miel.
[04:13] HipopotamoConPrisa 2 Pista: mik* **** 30 segundos y 25000 Puntos [04:13] HipopotamoConPrisa
2 Pista: mik* **** 30 segundos y 25000 Puntos
[04:14] Lince{Torpe +mike rios [04:14] Lince{Torpe
+mike rios
[04:14] Lince{Torpe mike rios [04:14] Lince{Torpe
mike rios
[04:14] HipopotamoConPrisa �Bien Lince{Torpe!! Tu respuesta: "mike rios" es correcta y ganas �5000�12 puntos [04:14] HipopotamoConPrisa
�Bien Lince{Torpe!! Tu respuesta: "mike rios" es correcta y ganas �5000�12 puntos
[04:14] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:14] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:14] HipopotamoConPrisa Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 681461, SEMANA: 5643579 y MES: 5643579 [04:14] HipopotamoConPrisa
Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 681461, SEMANA: 5643579 y MES: 5643579
[04:14] Hipopotamo\Especial mike rios [04:14] Hipopotamo\Especial
mike rios
[04:14] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [04:14] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[04:14] HipopotamoConPrisa Tri.13198 Biologiaɳherif˿Cuᬃ01lesmellnombrescient�coddellcangurodgigante?q?q [04:14] HipopotamoConPrisa
Tri.13198 Biologiaɳherif˿Cuᬃ01lesmellnombrescient�coddellcangurodgigante?q?q
[04:14] HipopotamoConPrisa 1 Pista: ******** ********* Valor pregunta : 17630 Puntos [04:14] HipopotamoConPrisa
1 Pista: ******** ********* Valor pregunta : 17630 Puntos
[04:14] HipopotamoConPrisa 2 Pista: mac***** ********* 30 segundos y 17630 Puntos [04:14] HipopotamoConPrisa
2 Pista: mac***** ********* 30 segundos y 17630 Puntos
[04:14] Lince{Torpe macropus giganteus [04:14] Lince{Torpe
macropus giganteus
[04:14] HipopotamoConPrisa �Suma y sigue Lince{Torpe!! La respuesta: "macropus giganteus" incrementa tu marcador en �7630�12 puntos [04:14] HipopotamoConPrisa
�Suma y sigue Lince{Torpe!! La respuesta: "macropus giganteus" incrementa tu marcador en �7630�12 puntos
[04:14] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:14] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:14] HipopotamoConPrisa Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 699091, SEMANA: 5661209 y MES: 5661209 [04:14] HipopotamoConPrisa
Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 699091, SEMANA: 5661209 y MES: 5661209
[04:14] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [04:14] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[04:14] HipopotamoConPrisa Tri.6394 DeporteɃarlovigo˿CualpesoelpdeportepnacionalpdepPakistan?m?m [04:14] HipopotamoConPrisa
Tri.6394 DeporteɃarlovigo˿CualpesoelpdeportepnacionalpdepPakistan?m?m
[04:14] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 17462 Puntos [04:14] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 17462 Puntos
[04:15] HipopotamoConPrisa 2 Pista: cri**** 30 segundos y 17462 Puntos [04:15] HipopotamoConPrisa
2 Pista: cri**** 30 segundos y 17462 Puntos
[04:15] Lince{Torpe hockey [04:15] Lince{Torpe
hockey
[04:15] HipopotamoConPrisa 3 Pista: cri**e* 15 segundos y 17462 Puntos [04:15] HipopotamoConPrisa
3 Pista: cri**e* 15 segundos y 17462 Puntos
[04:15] Hipopotamo\Especial cricker [04:15] Hipopotamo\Especial
cricker
[04:15] HipopotamoConPrisa Tiempo! La respuesta es -> cricket <- [04:15] HipopotamoConPrisa
Tiempo! La respuesta es -> cricket <-
[04:15] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [04:15] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[04:15] HipopotamoConPrisa Tri.4333 Miscelaneaɓebosin˿C󭯃01hseileillamaealccocheideicarreras?a?a [04:15] HipopotamoConPrisa
Tri.4333 Miscelaneaɓebosin˿C󭯃01hseileillamaealccocheideicarreras?a?a
[04:15] HipopotamoConPrisa 1 Pista: ****** Valor pregunta : 18683 Puntos [04:15] HipopotamoConPrisa
1 Pista: ****** Valor pregunta : 18683 Puntos
[04:16] HipopotamoConPrisa 2 Pista: bol*** 30 segundos y 18683 Puntos [04:16] HipopotamoConPrisa
2 Pista: bol*** 30 segundos y 18683 Puntos
[04:16] Hipopotamo\Especial bolido [04:16] Hipopotamo\Especial
bolido
[04:16] HipopotamoConPrisa �Enhorabuena Hipopotamo\Especial!! Has contestado "bolido" y por ello has ganado �8683�12 puntos [04:16] HipopotamoConPrisa
�Enhorabuena Hipopotamo\Especial!! Has contestado "bolido" y por ello has ganado �8683�12 puntos
[04:16] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 667015, SEMANA: 12423129 y MES: 12423129 [04:16] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 667015, SEMANA: 12423129 y MES: 12423129
[04:16] HipopotamoConPrisa R᮫ing SEMANA: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12423129 #3: Lince{Torpe 5661209 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [04:16] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12423129 #3: Lince{Torpe 5661209 #4: Oveja\Suave 1623566 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[04:16] HipopotamoConPrisa Tri.5121 DeporteɈdosO˿DEdQUEdLOCALIDADdSEVILLANAdESdORIGINARIOdELdEX-JUGADORdDELdBARCELONAdDEdBALONCESTOdANDRESdJIMENEZd?d [04:16] HipopotamoConPrisa
Tri.5121 DeporteɈdosO˿DEdQUEdLOCALIDADdSEVILLANAdESdORIGINARIOdELdEX-JUGADORdDELdBARCELONAdDEdBALONCESTOdANDRESdJIMENEZd?d
[04:16] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 19036 Puntos [04:16] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 19036 Puntos
[04:16] HipopotamoConPrisa 2 Pista: car**** 30 segundos y 19036 Puntos [04:16] HipopotamoConPrisa
2 Pista: car**** 30 segundos y 19036 Puntos
[04:16] HipopotamoConPrisa �Bingo!! Hipopotamo\Especial dio la respuesta: "carmona" en �2.891 segundos e incrementa sus ganancias con �9036�12 puntos [04:16] HipopotamoConPrisa
�Bingo!! Hipopotamo\Especial dio la respuesta: "carmona" en �2.891 segundos e incrementa sus ganancias con �9036�12 puntos
[04:16] HipopotamoConPrisa Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 686051, SEMANA: 12442165 y MES: 12442165 [04:16] HipopotamoConPrisa
Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 686051, SEMANA: 12442165 y MES: 12442165
[04:16] Hipopotamo\Especial carmona [04:16] Hipopotamo\Especial
carmona
[04:16] HipopotamoConPrisa We feature over 50,000 Q&A ! [04:16] HipopotamoConPrisa
We feature over 50,000 Q&A !
[04:16] HipopotamoConPrisa Tri.14735 MitologiaɄeannus˿Endbabilonianhijojdeymardukcyppatronddeyloskescribas?a?a [04:16] HipopotamoConPrisa
Tri.14735 MitologiaɄeannus˿Endbabilonianhijojdeymardukcyppatronddeyloskescribas?a?a
[04:16] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 19002 Puntos [04:16] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 19002 Puntos
[04:17] Gata_Elocuente Bienvenido elvigilante ADMIN de Radio Luna de Miel. [04:17] Gata_Elocuente
Bienvenido elvigilante ADMIN de Radio Luna de Miel.
[04:17] HipopotamoConPrisa 2 Pista: neb* 30 segundos y 19002 Puntos [04:17] HipopotamoConPrisa
2 Pista: neb* 30 segundos y 19002 Puntos
[04:17] Lince{Torpe nabu [04:17] Lince{Torpe
nabu
[04:17] Lince{Torpe nabu [04:17] Lince{Torpe
nabu
[04:17] Hipopotamo\Especial nebu [04:17] Hipopotamo\Especial
nebu
[04:17] HipopotamoConPrisa 3 Pista: nebo 15 segundos y 19002 Puntos [04:17] HipopotamoConPrisa
3 Pista: nebo 15 segundos y 19002 Puntos
[04:17] Lince{Torpe nebu [04:17] Lince{Torpe
nebu
[04:17] Lince{Torpe nebo [04:17] Lince{Torpe
nebo
[04:17] HipopotamoConPrisa �As�e hace Lince{Torpe!! Contestaste "nebo" en �7.657 segundos y sumas �9002�12 puntos [04:17] HipopotamoConPrisa
�As�e hace Lince{Torpe!! Contestaste "nebo" en �7.657 segundos y sumas �9002�12 puntos
[04:17] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:17] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:17] HipopotamoConPrisa Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 718093, SEMANA: 5680211 y MES: 5680211 [04:17] HipopotamoConPrisa
Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 718093, SEMANA: 5680211 y MES: 5680211
[04:17] HipopotamoConPrisa Tri.7183 Economiaɦlipp_er˿Deqqueqpaiscesclafmonedafllamadaf"coronafdanesa"?t?t [04:17] HipopotamoConPrisa
Tri.7183 Economiaɦlipp_er˿Deqqueqpaiscesclafmonedafllamadaf"coronafdanesa"?t?t
[04:17] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 14430 Puntos [04:17] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 14430 Puntos
[04:17] Hipopotamo\Especial dinamarca [04:17] Hipopotamo\Especial
dinamarca
[04:17] HipopotamoConPrisa �Absolutamente correcto Hipopotamo\Especial!! Acertaste "dinamarca" en �2.329 segundos y ganas �4430�12 puntos [04:17] HipopotamoConPrisa
�Absolutamente correcto Hipopotamo\Especial!! Acertaste "dinamarca" en �2.329 segundos y ganas �4430�12 puntos
[04:17] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 700481, SEMANA: 12456595 y MES: 12456595 [04:17] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 700481, SEMANA: 12456595 y MES: 12456595
[04:18] Lince{Torpe dinamarca [04:18] Lince{Torpe
dinamarca
[04:18] HipopotamoConPrisa Tri.2581 Gastronomiaɐsico666ˡz�carcdisueltotentaguasylcocidotalafuegothastasqueqtomasconsistenciasdeqjarabeq?v [04:18] HipopotamoConPrisa
Tri.2581 Gastronomiaɐsico666ˡz�carcdisueltotentaguasylcocidotalafuegothastasqueqtomasconsistenciasdeqjarabeq?v
[04:18] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 9392 Puntos [04:18] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 9392 Puntos
[04:18] HipopotamoConPrisa 2 Pista: alm**** 30 segundos y 9392 Puntos [04:18] HipopotamoConPrisa
2 Pista: alm**** 30 segundos y 9392 Puntos
[04:18] HipopotamoConPrisa �Eso es Lince{Torpe!! Dijiste: "almibar" y ello te ha valido: �392�12 puntos [04:18] HipopotamoConPrisa
�Eso es Lince{Torpe!! Dijiste: "almibar" y ello te ha valido: �392�12 puntos
[04:18] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:18] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:18] HipopotamoConPrisa Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 727485, SEMANA: 5689603 y MES: 5689603 [04:18] HipopotamoConPrisa
Lince{Torpe has acertado 1 seguidas!! Puntos HOY: 727485, SEMANA: 5689603 y MES: 5689603
[04:18] Lince{Torpe almibar [04:18] Lince{Torpe
almibar
[04:18] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [04:18] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[04:18] HipopotamoConPrisa Tri.1638 HistoriaɊAVEA˿DEiQUEiSEiLEiACUSOiALiCOMUNISTAiBULGAROiGEORGIiDIMITROViDEiINCENDIARiENiALEMANIAi?i [04:18] HipopotamoConPrisa
Tri.1638 HistoriaɊAVEA˿DEiQUEiSEiLEiACUSOiALiCOMUNISTAiBULGAROiGEORGIiDIMITROViDEiINCENDIARiENiALEMANIAi?i
[04:18] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 19917 Puntos [04:18] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 19917 Puntos
[04:19] HipopotamoConPrisa 2 Pista: REI****** 30 segundos y 19917 Puntos [04:19] HipopotamoConPrisa
2 Pista: REI****** 30 segundos y 19917 Puntos
[04:19] HipopotamoConPrisa 3 Pista: REI****A* 15 segundos y 19917 Puntos [04:19] HipopotamoConPrisa
3 Pista: REI****A* 15 segundos y 19917 Puntos
[04:19] HipopotamoConPrisa Tiempo! La respuesta es -> REICHSTAG <- [04:19] HipopotamoConPrisa
Tiempo! La respuesta es -> REICHSTAG <-
[04:19] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [04:19] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[04:19] HipopotamoConPrisa Tri.15294 Cienciaɴamzarian˿Apartepdeplosyfrentesycᬩdosyyzlosyfrentesyfr�,k߱u郰1kotrosyfrentesyexistenkenkmeteorolog�k?k [04:19] HipopotamoConPrisa
Tri.15294 Cienciaɴamzarian˿Apartepdeplosyfrentesycᬩdosyyzlosyfrentesyfr�,k߱u郰1kotrosyfrentesyexistenkenkmeteorolog�k?k
[04:19] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 16980 Puntos [04:19] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 16980 Puntos
[04:19] HipopotamoConPrisa 2 Pista: ocl***** 30 segundos y 16980 Puntos [04:19] HipopotamoConPrisa
2 Pista: ocl***** 30 segundos y 16980 Puntos
[04:20] Lince{Torpe ocluido [04:20] Lince{Torpe
ocluido
[04:20] HipopotamoConPrisa 3 Pista: oclui*o* 15 segundos y 16980 Puntos [04:20] HipopotamoConPrisa
3 Pista: oclui*o* 15 segundos y 16980 Puntos
[04:20] HipopotamoConPrisa �e nota que sabes mucho de esto Lince{Torpe! Tu respuesta "ocluidos" es correcta y ganas �6980�12 puntos [04:20] HipopotamoConPrisa
�e nota que sabes mucho de esto Lince{Torpe! Tu respuesta "ocluidos" es correcta y ganas �6980�12 puntos
[04:20] HipopotamoConPrisa ACTION awards Lince{Torpe with a +v for having over 15000 points [04:20] HipopotamoConPrisa
ACTION awards Lince{Torpe with a +v for having over 15000 points
[04:20] HipopotamoConPrisa Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 744465, SEMANA: 5706583 y MES: 5706583 [04:20] HipopotamoConPrisa
Lince{Torpe has acertado 2 seguidas!! Puntos HOY: 744465, SEMANA: 5706583 y MES: 5706583
[04:20] Lince{Torpe ocluidos [04:20] Lince{Torpe
ocluidos
[04:20] Hipopotamo\Especial ocluido [04:20] Hipopotamo\Especial
ocluido
[04:20] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [04:20] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[04:20] HipopotamoConPrisa Tri.8885 Eros-Sexɤassler˿Conjuntovdeqcomportamientosuqueqreflejanjlahideahdeqqueqelzhombreqesusuperiorzahlahmujerz(ymnovesuco񡬃01iexiste)i?i [04:20] HipopotamoConPrisa
Tri.8885 Eros-Sexɤassler˿Conjuntovdeqcomportamientosuqueqreflejanjlahideahdeqqueqelzhombreqesusuperiorzahlahmujerz(ymnovesuco񡬃01iexiste)i?i
[04:20] HipopotamoConPrisa 1 Pista: ********** Valor pregunta : 20215 Puntos [04:20] HipopotamoConPrisa
1 Pista: ********** Valor pregunta : 20215 Puntos
[04:20] Lince{Torpe hasta mañana  que la pasen bien [04:20] Lince{Torpe
hasta mañana  que la pasen bien
[04:20] HipopotamoConPrisa 2 Pista: fal******* 30 segundos y 20215 Puntos [04:20] HipopotamoConPrisa
2 Pista: fal******* 30 segundos y 20215 Puntos
[04:21] HipopotamoConPrisa 3 Pista: falo**a*ia 15 segundos y 20215 Puntos [04:21] HipopotamoConPrisa
3 Pista: falo**a*ia 15 segundos y 20215 Puntos
[04:21] HipopotamoConPrisa Tiempo! La respuesta es -> falocracia <- [04:21] HipopotamoConPrisa
Tiempo! La respuesta es -> falocracia <-
[04:21] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [04:21] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[04:21] HipopotamoConPrisa Tri.13885 Mitologiaɴjmm.com˅ndladantiguadGrecia,vninfascdexloscfresnos.v?v [04:21] HipopotamoConPrisa
Tri.13885 Mitologiaɴjmm.com˅ndladantiguadGrecia,vninfascdexloscfresnos.v?v
[04:21] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 10599 Puntos [04:21] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 10599 Puntos
[04:21] HipopotamoConPrisa 2 Pista: mel***** 30 segundos y 10599 Puntos [04:21] HipopotamoConPrisa
2 Pista: mel***** 30 segundos y 10599 Puntos
[04:21] HipopotamoConPrisa 3 Pista: melia*e* 15 segundos y 10599 Puntos [04:21] HipopotamoConPrisa
3 Pista: melia*e* 15 segundos y 10599 Puntos
[04:22] HipopotamoConPrisa Tiempo! La respuesta es -> meliades <- [04:22] HipopotamoConPrisa
Tiempo! La respuesta es -> meliades <-
[04:22] HipopotamoConPrisa For The Competitive Edge type !pingme [04:22] HipopotamoConPrisa
For The Competitive Edge type !pingme
[04:22] HipopotamoConPrisa Tri.20346 Personajesɤruida˿Enaqu郰1rciudadspas󃰱rVivaldizmuchosxa񯳃01xdeisuuvidavcomodprofesorideiviol�r?r [04:22] HipopotamoConPrisa
Tri.20346 Personajesɤruida˿Enaqu郰1rciudadspas󃰱rVivaldizmuchosxa񯳃01xdeisuuvidavcomodprofesorideiviol�r?r
[04:22] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 8427 Puntos [04:22] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 8427 Puntos
[04:22] HipopotamoConPrisa 2 Pista: ven**** 30 segundos y 8427 Puntos [04:22] HipopotamoConPrisa
2 Pista: ven**** 30 segundos y 8427 Puntos
[04:22] Oveja\Suave Venecia [04:22] Oveja\Suave
Venecia
[04:22] HipopotamoConPrisa �Suma y sigue Oveja\Suave!! La respuesta: "Venecia" incrementa tu marcador en �427�12 puntos [04:22] HipopotamoConPrisa
�Suma y sigue Oveja\Suave!! La respuesta: "Venecia" incrementa tu marcador en �427�12 puntos
[04:22] HipopotamoConPrisa ACTION awards Oveja\Suave with a +v for having over 15000 points [04:22] HipopotamoConPrisa
ACTION awards Oveja\Suave with a +v for having over 15000 points
[04:22] HipopotamoConPrisa Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 8427, SEMANA: 1631993 y MES: 1631993 [04:22] HipopotamoConPrisa
Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 8427, SEMANA: 1631993 y MES: 1631993
[04:22] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [04:22] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[04:22] HipopotamoConPrisa Tri.12914 Musicaɋwahamot˿Arquengrupospertenecenelwdiscos"Ahiyvienenperez"r?r [04:22] HipopotamoConPrisa
Tri.12914 Musicaɋwahamot˿Arquengrupospertenecenelwdiscos"Ahiyvienenperez"r?r
[04:22] HipopotamoConPrisa 1 Pista: *** ****** Valor pregunta : 14102 Puntos [04:22] HipopotamoConPrisa
1 Pista: *** ****** Valor pregunta : 14102 Puntos
[04:23] Hipopotamo\Especial los mismos [04:23] Hipopotamo\Especial
los mismos
[04:23] HipopotamoConPrisa 2 Pista: los ****** 30 segundos y 14102 Puntos [04:23] HipopotamoConPrisa
2 Pista: los ****** 30 segundos y 14102 Puntos
[04:23] HipopotamoConPrisa 3 Pista: los *e**a* 15 segundos y 14102 Puntos [04:23] HipopotamoConPrisa
3 Pista: los *e**a* 15 segundos y 14102 Puntos
[04:23] HipopotamoConPrisa Tiempo! La respuesta es -> los�erzas <- [04:23] HipopotamoConPrisa
Tiempo! La respuesta es -> los�erzas <-
[04:23] HipopotamoConPrisa R᮫ing MES: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12456595 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [04:23] HipopotamoConPrisa
R᮫ing MES: - #1: Mosca{ConInquietud 12486913 #2: Hipopotamo\Especial 12456595 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[04:23] HipopotamoConPrisa Tri.20165 GeografiaɍARdeJAVA˿ENdQUɃ01dESTADOdESTADOUNIDENSEdCASIdLAdMITADdDEdLAdPOBLACIӎdPERTENECEdAdLAdSECTAdMORMӎICA?d?d [04:23] HipopotamoConPrisa
Tri.20165 GeografiaɍARdeJAVA˿ENdQUɃ01dESTADOdESTADOUNIDENSEdCASIdLAdMITADdDEdLAdPOBLACIӎdPERTENECEdAdLAdSECTAdMORMӎICA?d?d
[04:23] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 9074 Puntos [04:23] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 9074 Puntos
[04:24] HipopotamoConPrisa 2 Pista: uta* 30 segundos y 9074 Puntos [04:24] HipopotamoConPrisa
2 Pista: uta* 30 segundos y 9074 Puntos
[04:24] Oveja\Suave Utap [04:24] Oveja\Suave
Utap
[04:24] HipopotamoConPrisa 3 Pista: uta* 15 segundos y 9074 Puntos [04:24] HipopotamoConPrisa
3 Pista: uta* 15 segundos y 9074 Puntos
[04:24] Oveja\Suave Utas [04:24] Oveja\Suave
Utas
[04:24] Oveja\Suave Utan [04:24] Oveja\Suave
Utan
[04:24] Hipopotamo\Especial utan [04:24] Hipopotamo\Especial
utan
[04:24] HipopotamoConPrisa Tiempo! La respuesta es -> utah <- [04:24] HipopotamoConPrisa
Tiempo! La respuesta es -> utah <-
[04:24] HipopotamoConPrisa Please refrain from using Extreme Bad Language [04:24] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[04:24] HipopotamoConPrisa Tri.19673 Cancionesɓawn˿Conxquewcancionxdewanunciozsewhizozfamosozelygrupoz"undrop"g?g [04:24] HipopotamoConPrisa
Tri.19673 Cancionesɓawn˿Conxquewcancionxdewanunciozsewhizozfamosozelygrupoz"undrop"g?g
[04:24] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 7442 Puntos [04:24] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 7442 Puntos
[04:25] HipopotamoConPrisa 2 Pista: tra** 30 segundos y 7442 Puntos [04:25] HipopotamoConPrisa
2 Pista: tra** 30 segundos y 7442 Puntos
[04:25] HipopotamoConPrisa 3 Pista: trai* 15 segundos y 7442 Puntos [04:25] HipopotamoConPrisa
3 Pista: trai* 15 segundos y 7442 Puntos
[04:25] HipopotamoConPrisa Tiempo! La respuesta es -> train <- [04:25] HipopotamoConPrisa
Tiempo! La respuesta es -> train <-
[04:25] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [04:25] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[04:25] HipopotamoConPrisa Tri.3077 Historiaɴamzarian˿C󭯃01bsegllam󃰱playpol�caycondescendienteghaciayAlemaniayimpulsadayChamberlainrenrlosna񯳃01npreviosnaylayIIpGuerrayMundial?p?p [04:25] HipopotamoConPrisa
Tri.3077 Historiaɴamzarian˿C󭯃01bsegllam󃰱playpol�caycondescendienteghaciayAlemaniayimpulsadayChamberlainrenrlosna񯳃01npreviosnaylayIIpGuerrayMundial?p?p
[04:25] HipopotamoConPrisa 1 Pista: ************** Valor pregunta : 21483 Puntos [04:25] HipopotamoConPrisa
1 Pista: ************** Valor pregunta : 21483 Puntos
[04:26] HipopotamoConPrisa 2 Pista: apa*********** 30 segundos y 21483 Puntos [04:26] HipopotamoConPrisa
2 Pista: apa*********** 30 segundos y 21483 Puntos
[04:26] HipopotamoConPrisa 3 Pista: apa*i*ua*ie**o 15 segundos y 21483 Puntos [04:26] HipopotamoConPrisa
3 Pista: apa*i*ua*ie**o 15 segundos y 21483 Puntos
[04:26] Hipopotamo\Especial apaciguamento+ [04:26] Hipopotamo\Especial
apaciguamento+
[04:26] Hipopotamo\Especial apaciguamento [04:26] Hipopotamo\Especial
apaciguamento
[04:26] HipopotamoConPrisa Tiempo! La respuesta es -> apaciguamiento <- [04:26] HipopotamoConPrisa
Tiempo! La respuesta es -> apaciguamiento <-
[04:26] HipopotamoConPrisa This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [04:26] HipopotamoConPrisa
This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[04:26] HipopotamoConPrisa Tri.19842 Gastronomiaɐsico666˰robablementevlaocomidaom᳃01xcostosaodeljmundoe?d [04:26] HipopotamoConPrisa
Tri.19842 Gastronomiaɐsico666˰robablementevlaocomidaom᳃01xcostosaodeljmundoe?d
[04:26] HipopotamoConPrisa 1 Pista: ***** ****** Valor pregunta : 16728 Puntos [04:26] HipopotamoConPrisa
1 Pista: ***** ****** Valor pregunta : 16728 Puntos
[04:26] HipopotamoConPrisa 2 Pista: tru** ****** 30 segundos y 16728 Puntos [04:26] HipopotamoConPrisa
2 Pista: tru** ****** 30 segundos y 16728 Puntos
[04:27] HipopotamoConPrisa 3 Pista: tru*a **a**a 15 segundos y 16728 Puntos [04:27] HipopotamoConPrisa
3 Pista: tru*a **a**a 15 segundos y 16728 Puntos
[04:27] HipopotamoConPrisa Tiempo! La respuesta es -> trufa�lanca <- [04:27] HipopotamoConPrisa
Tiempo! La respuesta es -> trufa�lanca <-
[04:27] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [04:27] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[04:27] HipopotamoConPrisa Tri.8349 Medicina-Saludɓebosin˿Aqqui鮃01fleqdebenflospsordomudospsunlenguajeqdeqse񡳿q?q [04:27] HipopotamoConPrisa
Tri.8349 Medicina-Saludɓebosin˿Aqqui鮃01fleqdebenflospsordomudospsunlenguajeqdeqse񡳿q?q
[04:27] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 13976 Puntos [04:27] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 13976 Puntos
[04:27] HipopotamoConPrisa 2 Pista: epe* 30 segundos y 13976 Puntos [04:27] HipopotamoConPrisa
2 Pista: epe* 30 segundos y 13976 Puntos
[04:28] Hipopotamo\Especial epel [04:28] Hipopotamo\Especial
epel
[04:28] Hipopotamo\Especial epen [04:28] Hipopotamo\Especial
epen
[04:28] HipopotamoConPrisa 3 Pista: epee 15 segundos y 13976 Puntos [04:28] HipopotamoConPrisa
3 Pista: epee 15 segundos y 13976 Puntos
[04:28] Hipopotamo\Especial epee [04:28] Hipopotamo\Especial
epee
[04:28] HipopotamoConPrisa �Enhorabuena Hipopotamo\Especial!! Has contestado "epee" y por ello has ganado �3976�12 puntos [04:28] HipopotamoConPrisa
�Enhorabuena Hipopotamo\Especial!! Has contestado "epee" y por ello has ganado �3976�12 puntos
[04:28] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 714457, SEMANA: 12470571 y MES: 12470571 [04:28] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 714457, SEMANA: 12470571 y MES: 12470571
[04:28] HipopotamoConPrisa This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [04:28] HipopotamoConPrisa
This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[04:28] HipopotamoConPrisa Tri.13543 CienciaɊAVEA˿DIC-1901:QUEpINVENTORpITALIANOpTRANSMITEpLApPRIMERApSEсLpDEpRADIOpApTRAVESpDELpATLANTICO(APELLIDO)p?p [04:28] HipopotamoConPrisa
Tri.13543 CienciaɊAVEA˿DIC-1901:QUEpINVENTORpITALIANOpTRANSMITEpLApPRIMERApSEсLpDEpRADIOpApTRAVESpDELpATLANTICO(APELLIDO)p?p
[04:28] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 6990 Puntos [04:28] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 6990 Puntos
[04:28] HipopotamoConPrisa 2 Pista: mar**** 30 segundos y 6990 Puntos [04:28] HipopotamoConPrisa
2 Pista: mar**** 30 segundos y 6990 Puntos
[04:28] HipopotamoConPrisa 3 Pista: mar*o*i 15 segundos y 6990 Puntos [04:28] HipopotamoConPrisa
3 Pista: mar*o*i 15 segundos y 6990 Puntos
[04:28] Hipopotamo\Especial marconi [04:28] Hipopotamo\Especial
marconi
[04:28] HipopotamoConPrisa �Increible!! Hipopotamo\Especial contest󺠃04"marconi" en �6.891 segundos, y ha ganado �990�12 puntos [04:28] HipopotamoConPrisa
�Increible!! Hipopotamo\Especial contest󺠃04"marconi" en �6.891 segundos, y ha ganado �990�12 puntos
[04:28] HipopotamoConPrisa Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 721447, SEMANA: 12477561 y MES: 12477561 [04:28] HipopotamoConPrisa
Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 721447, SEMANA: 12477561 y MES: 12477561
[04:29] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [04:29] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[04:29] HipopotamoConPrisa Tri.17396 InformaticaɔeLaRaNhA˿Eniqu郰1hRFChserespecificakeliprotocolokIRC?h?h [04:29] HipopotamoConPrisa
Tri.17396 InformaticaɔeLaRaNhA˿Eniqu郰1hRFChserespecificakeliprotocolokIRC?h?h
[04:29] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 16775 Puntos [04:29] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 16775 Puntos
[04:29] HipopotamoConPrisa 2 Pista: rfc**** 30 segundos y 16775 Puntos [04:29] HipopotamoConPrisa
2 Pista: rfc**** 30 segundos y 16775 Puntos
[04:29] HipopotamoConPrisa 3 Pista: rfc**** 15 segundos y 16775 Puntos [04:29] HipopotamoConPrisa
3 Pista: rfc**** 15 segundos y 16775 Puntos
[04:29] HipopotamoConPrisa Tiempo! La respuesta es -> rfc1459 <- [04:29] HipopotamoConPrisa
Tiempo! La respuesta es -> rfc1459 <-
[04:30] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [04:30] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[04:30] HipopotamoConPrisa Tri.3162 Idiomasɦlipp_er˿LATIN--->ESPAяL:arborq?b [04:30] HipopotamoConPrisa
Tri.3162 Idiomasɦlipp_er˿LATIN--->ESPAяL:arborq?b
[04:30] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 11101 Puntos [04:30] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 11101 Puntos
[04:30] Hipopotamo\Especial arbol [04:30] Hipopotamo\Especial
arbol
[04:30] HipopotamoConPrisa �e nota que sabes mucho de esto Hipopotamo\Especial! Tu respuesta "arbol" es correcta y ganas �1101�12 puntos [04:30] HipopotamoConPrisa
�e nota que sabes mucho de esto Hipopotamo\Especial! Tu respuesta "arbol" es correcta y ganas �1101�12 puntos
[04:30] HipopotamoConPrisa Hipopotamo\Especial has acertado 3 seguidas!! Puntos HOY: 732548, SEMANA: 12488662 y MES: 12488662 [04:30] HipopotamoConPrisa
Hipopotamo\Especial has acertado 3 seguidas!! Puntos HOY: 732548, SEMANA: 12488662 y MES: 12488662
[04:30] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [04:30] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[04:30] HipopotamoConPrisa Tri.10394 Historiaɐsico666ˣuᬃ01aeraslasenfermedadoqueosufr�01slasreinasVictoriasdeoInglaterra?k?k [04:30] HipopotamoConPrisa
Tri.10394 Historiaɐsico666ˣuᬃ01aeraslasenfermedadoqueosufr�01slasreinasVictoriasdeoInglaterra?k?k
[04:30] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 8988 Puntos [04:30] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 8988 Puntos
[04:30] HipopotamoConPrisa 2 Pista: hem****** 30 segundos y 8988 Puntos [04:30] HipopotamoConPrisa
2 Pista: hem****** 30 segundos y 8988 Puntos
[04:30] HipopotamoConPrisa 3 Pista: hemo*i*ia 15 segundos y 8988 Puntos [04:30] HipopotamoConPrisa
3 Pista: hemo*i*ia 15 segundos y 8988 Puntos
[04:31] HipopotamoConPrisa Tiempo! La respuesta es -> hemofilia <- [04:31] HipopotamoConPrisa
Tiempo! La respuesta es -> hemofilia <-
[04:31] HipopotamoConPrisa R᮫ing SEMANA: - #1: Hipopotamo\Especial 12488662 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [04:31] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Hipopotamo\Especial 12488662 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[04:31] HipopotamoConPrisa Tri.10961 DeporteɁrtea˿AxqueuseleccionaleumarcoqZarracunahistoricoqgolaena1950x?x [04:31] HipopotamoConPrisa
Tri.10961 DeporteɁrtea˿AxqueuseleccionaleumarcoqZarracunahistoricoqgolaena1950x?x
[04:31] HipopotamoConPrisa 1 Pista: ********** Valor pregunta : 6509 Puntos [04:31] HipopotamoConPrisa
1 Pista: ********** Valor pregunta : 6509 Puntos
[04:31] HipopotamoConPrisa 2 Pista: ing******* 30 segundos y 6509 Puntos [04:31] HipopotamoConPrisa
2 Pista: ing******* 30 segundos y 6509 Puntos
[04:31] Hipopotamo\Especial inglaterra [04:31] Hipopotamo\Especial
inglaterra
[04:31] HipopotamoConPrisa �Enhorabuena Hipopotamo\Especial!! Has contestado "inglaterra" y por ello has ganado �509�12 puntos [04:31] HipopotamoConPrisa
�Enhorabuena Hipopotamo\Especial!! Has contestado "inglaterra" y por ello has ganado �509�12 puntos
[04:31] HipopotamoConPrisa Hipopotamo\Especial has acertado 4 seguidas!! Puntos HOY: 739057, SEMANA: 12495171 y MES: 12495171 [04:31] HipopotamoConPrisa
Hipopotamo\Especial has acertado 4 seguidas!! Puntos HOY: 739057, SEMANA: 12495171 y MES: 12495171
[04:31] HipopotamoConPrisa We feature over 50,000 Q&A ! [04:31] HipopotamoConPrisa
We feature over 50,000 Q&A !
[04:31] HipopotamoConPrisa Tri.9623 Fisica-Quimicaɫosako˿Contagua,gᣩdoitᲴricoiycbicarbonatoideusosa,gpuedesehacer...g?g [04:31] HipopotamoConPrisa
Tri.9623 Fisica-Quimicaɫosako˿Contagua,gᣩdoitᲴricoiycbicarbonatoideusosa,gpuedesehacer...g?g
[04:31] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 6328 Puntos [04:31] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 6328 Puntos
[04:32] HipopotamoConPrisa 2 Pista: gas**** 30 segundos y 6328 Puntos [04:32] HipopotamoConPrisa
2 Pista: gas**** 30 segundos y 6328 Puntos
[04:32] Hipopotamo\Especial gaseosa [04:32] Hipopotamo\Especial
gaseosa
[04:32] HipopotamoConPrisa �Hipopotamo\Especial acert󡡠La respuesta era: "gaseosa" y contest󠥮 �6.171 segundos. Se lleva: �328�12 puntos [04:32] HipopotamoConPrisa
�Hipopotamo\Especial acert󡡠La respuesta era: "gaseosa" y contest󠥮 �6.171 segundos. Se lleva: �328�12 puntos
[04:32] HipopotamoConPrisa Hipopotamo\Especial has acertado 5 seguidas!! Puntos HOY: 745385, SEMANA: 12501499 y MES: 12501499 [04:32] HipopotamoConPrisa
Hipopotamo\Especial has acertado 5 seguidas!! Puntos HOY: 745385, SEMANA: 12501499 y MES: 12501499
[04:32] HipopotamoConPrisa Tri.21 Cienciaɍorse˿C󤩧ooMorse:cNUMEROc1c?c [04:32] HipopotamoConPrisa
Tri.21 Cienciaɍorse˿C󤩧ooMorse:cNUMEROc1c?c
[04:32] HipopotamoConPrisa 1 Pista: .---- Valor pregunta : 10895 Puntos [04:32] HipopotamoConPrisa
1 Pista: .---- Valor pregunta : 10895 Puntos
[04:32] Hipopotamo\Especial .---- [04:32] Hipopotamo\Especial
.----
[04:32] HipopotamoConPrisa �Suma y sigue Hipopotamo\Especial!! La respuesta: ".----" incrementa tu marcador en �0895�12 puntos [04:32] HipopotamoConPrisa
�Suma y sigue Hipopotamo\Especial!! La respuesta: ".----" incrementa tu marcador en �0895�12 puntos
[04:32] HipopotamoConPrisa Hipopotamo\Especial has acertado 6 seguidas!! Puntos HOY: 756280, SEMANA: 12512394 y MES: 12512394 [04:32] HipopotamoConPrisa
Hipopotamo\Especial has acertado 6 seguidas!! Puntos HOY: 756280, SEMANA: 12512394 y MES: 12512394
[04:32] HipopotamoConPrisa Tri.4450 Medicina-SaludɅME^˿ESTADOnQUEnSEnCARACTERIZAnPORnLAnLECTURAnANORMALMENTEnLENTAn?n [04:32] HipopotamoConPrisa
Tri.4450 Medicina-SaludɅME^˿ESTADOnQUEnSEnCARACTERIZAnPORnLAnLECTURAnANORMALMENTEnLENTAn?n
[04:32] HipopotamoConPrisa 1 Pista: ********** Valor pregunta : 20255 Puntos [04:32] HipopotamoConPrisa
1 Pista: ********** Valor pregunta : 20255 Puntos
[04:32] HipopotamoConPrisa 2 Pista: bra******* 30 segundos y 20255 Puntos [04:32] HipopotamoConPrisa
2 Pista: bra******* 30 segundos y 20255 Puntos
[04:33] HipopotamoConPrisa 3 Pista: bra*i*e*ia 15 segundos y 20255 Puntos [04:33] HipopotamoConPrisa
3 Pista: bra*i*e*ia 15 segundos y 20255 Puntos
[04:33] HipopotamoConPrisa Tiempo! La respuesta es -> bradilexia <- [04:33] HipopotamoConPrisa
Tiempo! La respuesta es -> bradilexia <-
[04:33] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [04:33] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[04:33] HipopotamoConPrisa Tri.458 InformaticaɔeLaRaNhA˿Eneelktecladoynum鲩coyqueatienespastucderecha,equeateclas"baja"e(numqlocklapagado)?e?e [04:33] HipopotamoConPrisa
Tri.458 InformaticaɔeLaRaNhA˿Eneelktecladoynum鲩coyqueatienespastucderecha,equeateclas"baja"e(numqlocklapagado)?e?e
[04:33] HipopotamoConPrisa 1 Pista: * Valor pregunta : 21957 Puntos [04:33] HipopotamoConPrisa
1 Pista: * Valor pregunta : 21957 Puntos
[04:33] HipopotamoConPrisa 2 Pista: 2 30 segundos y 21957 Puntos [04:33] HipopotamoConPrisa
2 Pista: 2 30 segundos y 21957 Puntos
[04:33] Hipopotamo\Especial 2 [04:33] Hipopotamo\Especial
2
[04:33] HipopotamoConPrisa �Eso es Hipopotamo\Especial!! Dijiste: "2" y ello te ha valido: �1957�12 puntos [04:33] HipopotamoConPrisa
�Eso es Hipopotamo\Especial!! Dijiste: "2" y ello te ha valido: �1957�12 puntos
[04:33] HipopotamoConPrisa Hipopotamo\Especial has acertado 7 seguidas!! Puntos HOY: 778237, SEMANA: 12534351 y MES: 12534351 [04:33] HipopotamoConPrisa
Hipopotamo\Especial has acertado 7 seguidas!! Puntos HOY: 778237, SEMANA: 12534351 y MES: 12534351
[04:33] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [04:33] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[04:33] HipopotamoConPrisa Tri.4545 CancionesɃeLTe˿Debquienuesmesmelgtemav"Hungryiheart"p?p [04:33] HipopotamoConPrisa
Tri.4545 CancionesɃeLTe˿Debquienuesmesmelgtemav"Hungryiheart"p?p
[04:33] HipopotamoConPrisa 1 Pista: ***** *********** Valor pregunta : 18152 Puntos [04:33] HipopotamoConPrisa
1 Pista: ***** *********** Valor pregunta : 18152 Puntos
[04:34] HipopotamoConPrisa 2 Pista: bru** *********** 30 segundos y 18152 Puntos [04:34] HipopotamoConPrisa
2 Pista: bru** *********** 30 segundos y 18152 Puntos
[04:34] HipopotamoConPrisa 3 Pista: bru*e ***i****ee* 15 segundos y 18152 Puntos [04:34] HipopotamoConPrisa
3 Pista: bru*e ***i****ee* 15 segundos y 18152 Puntos
[04:34] HipopotamoConPrisa Tiempo! La respuesta es -> bruce�pringsteen <- [04:34] HipopotamoConPrisa
Tiempo! La respuesta es -> bruce�pringsteen <-
[04:34] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [04:34] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[04:34] HipopotamoConPrisa Tri.5208 Eros-SexɁrzobispo˿Comocsetllamaialcvotocquethacenslosareligiososadetnoctenersrelacionesasexuales?c?c [04:34] HipopotamoConPrisa
Tri.5208 Eros-SexɁrzobispo˿Comocsetllamaialcvotocquethacenslosareligiososadetnoctenersrelacionesasexuales?c?c
[04:34] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 19160 Puntos [04:34] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 19160 Puntos
[04:35] HipopotamoConPrisa 2 Pista: cas***** 30 segundos y 19160 Puntos [04:35] HipopotamoConPrisa
2 Pista: cas***** 30 segundos y 19160 Puntos
[04:35] Hipopotamo\Especial castidad [04:35] Hipopotamo\Especial
castidad
[04:35] HipopotamoConPrisa �Enhorabuena Hipopotamo\Especial!! Has contestado "castidad" y por ello has ganado �9160�12 puntos [04:35] HipopotamoConPrisa
�Enhorabuena Hipopotamo\Especial!! Has contestado "castidad" y por ello has ganado �9160�12 puntos
[04:35] HipopotamoConPrisa Hipopotamo\Especial has acertado 8 seguidas!! Puntos HOY: 797397, SEMANA: 12553511 y MES: 12553511 [04:35] HipopotamoConPrisa
Hipopotamo\Especial has acertado 8 seguidas!! Puntos HOY: 797397, SEMANA: 12553511 y MES: 12553511
[04:35] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [04:35] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[04:35] HipopotamoConPrisa Tri.20042 LiteraturaɄRAKULL˿ConqquempagoeelxmercaderfdemVeneciar?x [04:35] HipopotamoConPrisa
Tri.20042 LiteraturaɄRAKULL˿ConqquempagoeelxmercaderfdemVeneciar?x
[04:35] HipopotamoConPrisa 1 Pista: ** ***** ** ** ******* Valor pregunta : 12466 Puntos [04:35] HipopotamoConPrisa
1 Pista: ** ***** ** ** ******* Valor pregunta : 12466 Puntos
[04:35] HipopotamoConPrisa 2 Pista: un�**** ** ** ******* 30 segundos y 12466 Puntos [04:35] HipopotamoConPrisa
2 Pista: un�**** ** ** ******* 30 segundos y 12466 Puntos
[04:35] HipopotamoConPrisa 3 Pista: un�*o*o *e *u *o*a*o* 15 segundos y 12466 Puntos [04:35] HipopotamoConPrisa
3 Pista: un�*o*o *e *u *o*a*o* 15 segundos y 12466 Puntos
[04:36] HipopotamoConPrisa Tiempo! La respuesta es -> un�rozo�e�u�orazon <- [04:36] HipopotamoConPrisa
Tiempo! La respuesta es -> un�rozo�e�u�orazon <-
[04:36] HipopotamoConPrisa For The Competitive Edge type !pingme [04:36] HipopotamoConPrisa
For The Competitive Edge type !pingme
[04:36] HipopotamoConPrisa Tri.17413 Politicaɡnghara˿Autortdea"Espa񡺃01mlaosociedadtviolada",mantiguoxministroxdeaculturaodeaUCDm(nombreaybapellido)m?m [04:36] HipopotamoConPrisa
Tri.17413 Politicaɡnghara˿Autortdea"Espa񡺃01mlaosociedadtviolada",mantiguoxministroxdeaculturaodeaUCDm(nombreaybapellido)m?m
[04:36] HipopotamoConPrisa 1 Pista: ******* ** ** ****** Valor pregunta : 6377 Puntos [04:36] HipopotamoConPrisa
1 Pista: ******* ** ** ****** Valor pregunta : 6377 Puntos
[04:36] HipopotamoConPrisa 2 Pista: ric**** ** ** ****** 30 segundos y 6377 Puntos [04:36] HipopotamoConPrisa
2 Pista: ric**** ** ** ****** 30 segundos y 6377 Puntos
[04:36] HipopotamoConPrisa 3 Pista: rica**o *e *a *ie**a 15 segundos y 6377 Puntos [04:36] HipopotamoConPrisa
3 Pista: rica**o *e *a *ie**a 15 segundos y 6377 Puntos
[04:37] Hipopotamo\Especial ricardo de la sierra [04:37] Hipopotamo\Especial
ricardo de la sierra
[04:37] HipopotamoConPrisa Tiempo! La respuesta es -> ricardo�e�a�ierva <- [04:37] HipopotamoConPrisa
Tiempo! La respuesta es -> ricardo�e�a�ierva <-
[04:37] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [04:37] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[04:37] HipopotamoConPrisa Tri.20148 Medicina-SaludɍARdeJAVAˎOMBREnGENɒICOnQUEnRECIBENnLOSnPIGMENTOSnQUEnSEnENCUENTRANnDISUELTOSnENnLAnORINAnYnQUEnLEnCONFIERENnSUnCARACTER͓TICOnCOLORnDORADO.n?n [04:37] HipopotamoConPrisa
Tri.20148 Medicina-SaludɍARdeJAVAˎOMBREnGENɒICOnQUEnRECIBENnLOSnPIGMENTOSnQUEnSEnENCUENTRANnDISUELTOSnENnLAnORINAnYnQUEnLEnCONFIERENnSUnCARACTER͓TICOnCOLORnDORADO.n?n
[04:37] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 14716 Puntos [04:37] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 14716 Puntos
[04:37] HipopotamoConPrisa 2 Pista: uro****** 30 segundos y 14716 Puntos [04:37] HipopotamoConPrisa
2 Pista: uro****** 30 segundos y 14716 Puntos
[04:37] HipopotamoConPrisa 3 Pista: uro**o*o* 15 segundos y 14716 Puntos [04:37] HipopotamoConPrisa
3 Pista: uro**o*o* 15 segundos y 14716 Puntos
[04:38] HipopotamoConPrisa Tiempo! La respuesta es -> urocromos <- [04:38] HipopotamoConPrisa
Tiempo! La respuesta es -> urocromos <-
[04:38] HipopotamoConPrisa R᮫ing MES: - #1: Hipopotamo\Especial 12553511 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [04:38] HipopotamoConPrisa
R᮫ing MES: - #1: Hipopotamo\Especial 12553511 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[04:38] HipopotamoConPrisa Tri.13944 MitologiaɞYanira^˿AmigosfielodeyUlises,mleyconfiossuqhogaru?m [04:38] HipopotamoConPrisa
Tri.13944 MitologiaɞYanira^˿AmigosfielodeyUlises,mleyconfiossuqhogaru?m
[04:38] HipopotamoConPrisa 1 Pista: ****** Valor pregunta : 15496 Puntos [04:38] HipopotamoConPrisa
1 Pista: ****** Valor pregunta : 15496 Puntos
[04:38] HipopotamoConPrisa 2 Pista: men*** 30 segundos y 15496 Puntos [04:38] HipopotamoConPrisa
2 Pista: men*** 30 segundos y 15496 Puntos
[04:38] HipopotamoConPrisa 3 Pista: men*o* 15 segundos y 15496 Puntos [04:38] HipopotamoConPrisa
3 Pista: men*o* 15 segundos y 15496 Puntos
[04:38] HipopotamoConPrisa Tiempo! La respuesta es -> mentor <- [04:38] HipopotamoConPrisa
Tiempo! La respuesta es -> mentor <-
[04:39] HipopotamoConPrisa Please refrain from using Extreme Bad Language [04:39] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[04:39] HipopotamoConPrisa Tri.2417 Cineɴjmm.com˄irectorqdez"Marqadentro"t(2004).t?t [04:39] HipopotamoConPrisa
Tri.2417 Cineɴjmm.com˄irectorqdez"Marqadentro"t(2004).t?t
[04:39] HipopotamoConPrisa 1 Pista: ********* ******** Valor pregunta : 19749 Puntos [04:39] HipopotamoConPrisa
1 Pista: ********* ******** Valor pregunta : 19749 Puntos
[04:39] HipopotamoConPrisa 2 Pista: ale****** ******** 30 segundos y 19749 Puntos [04:39] HipopotamoConPrisa
2 Pista: ale****** ******** 30 segundos y 19749 Puntos
[04:39] HipopotamoConPrisa �Ol頃04Hipopotamo\Especial!! Has contestado: "alejandro amenabar" en �7.375 segundos y sumas �9749�12 puntos a tu marcador. �Sigue as� [04:39] HipopotamoConPrisa
�Ol頃04Hipopotamo\Especial!! Has contestado: "alejandro amenabar" en �7.375 segundos y sumas �9749�12 puntos a tu marcador. �Sigue as�
[04:39] Hipopotamo\Especial alejandro amenabar [04:39] Hipopotamo\Especial
alejandro amenabar
[04:39] HipopotamoConPrisa Hipopotamo\Especial has acertado 9 seguidas!! Puntos HOY: 817146, SEMANA: 12573260 y MES: 12573260 [04:39] HipopotamoConPrisa
Hipopotamo\Especial has acertado 9 seguidas!! Puntos HOY: 817146, SEMANA: 12573260 y MES: 12573260
[04:39] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [04:39] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[04:39] HipopotamoConPrisa Tri.2624 Miscelaneaɥldanasˁviaci󮃰1g-lInstrumentos:lComohseqdenominazalqinstrumentohqueqnosndazlazaltitudxdelqavion?l?l [04:39] HipopotamoConPrisa
Tri.2624 Miscelaneaɥldanasˁviaci󮃰1g-lInstrumentos:lComohseqdenominazalqinstrumentohqueqnosndazlazaltitudxdelqavion?l?l
[04:39] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 18817 Puntos [04:39] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 18817 Puntos
[04:40] HipopotamoConPrisa 2 Pista: alt****** 30 segundos y 18817 Puntos [04:40] HipopotamoConPrisa
2 Pista: alt****** 30 segundos y 18817 Puntos
[04:40] HipopotamoConPrisa 3 Pista: alti*e**o 15 segundos y 18817 Puntos [04:40] HipopotamoConPrisa
3 Pista: alti*e**o 15 segundos y 18817 Puntos
[04:40] HipopotamoConPrisa �Eso es Hipopotamo\Especial!! Dijiste: "altimetro" y ello te ha valido: �8817�12 puntos [04:40] HipopotamoConPrisa
�Eso es Hipopotamo\Especial!! Dijiste: "altimetro" y ello te ha valido: �8817�12 puntos
[04:40] Hipopotamo\Especial altimetro [04:40] Hipopotamo\Especial
altimetro
[04:40] HipopotamoConPrisa Hipopotamo\Especial has acertado 10 seguidas!! Puntos HOY: 835963, SEMANA: 12592077 y MES: 12592077 [04:40] HipopotamoConPrisa
Hipopotamo\Especial has acertado 10 seguidas!! Puntos HOY: 835963, SEMANA: 12592077 y MES: 12592077
[04:40] HipopotamoConPrisa Bonus especial de 50000 Puntos para Hipopotamo\Especial por acertar 10 seguidas!!! [04:40] HipopotamoConPrisa
Bonus especial de 50000 Puntos para Hipopotamo\Especial por acertar 10 seguidas!!!
[04:40] HipopotamoConPrisa This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [04:40] HipopotamoConPrisa
This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[04:40] HipopotamoConPrisa Tri.13752 CancionesɓERGISOLO˿Dezquiencess"halfuakminut"c?c [04:40] HipopotamoConPrisa
Tri.13752 CancionesɓERGISOLO˿Dezquiencess"halfuakminut"c?c
[04:40] HipopotamoConPrisa 1 Pista: **** ****** Valor pregunta : 23202 Puntos [04:40] HipopotamoConPrisa
1 Pista: **** ****** Valor pregunta : 23202 Puntos
[04:40] HipopotamoConPrisa 2 Pista: mat* ****** 30 segundos y 23202 Puntos [04:40] HipopotamoConPrisa
2 Pista: mat* ****** 30 segundos y 23202 Puntos
[04:40] HipopotamoConPrisa 3 Pista: mat* *ia**o 15 segundos y 23202 Puntos [04:40] HipopotamoConPrisa
3 Pista: mat* *ia**o 15 segundos y 23202 Puntos
[04:41] HipopotamoConPrisa Tiempo! La respuesta es -> matt�ianco <- [04:41] HipopotamoConPrisa
Tiempo! La respuesta es -> matt�ianco <-
[04:41] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [04:41] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[04:41] HipopotamoConPrisa Tri.19751 Biologiaɖivian˿Cu᮴osycorazonesytienepunxpulpo?v?v [04:41] HipopotamoConPrisa
Tri.19751 Biologiaɖivian˿Cu᮴osycorazonesytienepunxpulpo?v?v
[04:41] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 8858 Puntos [04:41] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 8858 Puntos
[04:41] Hipopotamo\Especial tres [04:41] Hipopotamo\Especial
tres
[04:41] HipopotamoConPrisa 2 Pista: tre* 30 segundos y 8858 Puntos [04:41] HipopotamoConPrisa
2 Pista: tre* 30 segundos y 8858 Puntos
[04:41] HipopotamoConPrisa �Increible!! Hipopotamo\Especial contest󺠃04"tres" en �5.172 segundos, y ha ganado �858�12 puntos [04:41] HipopotamoConPrisa
�Increible!! Hipopotamo\Especial contest󺠃04"tres" en �5.172 segundos, y ha ganado �858�12 puntos
[04:41] HipopotamoConPrisa Hipopotamo\Especial has acertado 11 seguidas!! Puntos HOY: 894821, SEMANA: 12650935 y MES: 12650935 [04:41] HipopotamoConPrisa
Hipopotamo\Especial has acertado 11 seguidas!! Puntos HOY: 894821, SEMANA: 12650935 y MES: 12650935
[04:41] HipopotamoConPrisa This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [04:41] HipopotamoConPrisa
This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[04:41] HipopotamoConPrisa Tri.19465 Cineɴjmm.comːel�lapdesJos郰1bLuisyGarcitestrenadapenlOctubresdes2004.b?b [04:41] HipopotamoConPrisa
Tri.19465 Cineɴjmm.comːel�lapdesJos郰1bLuisyGarcitestrenadapenlOctubresdes2004.b?b
[04:41] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 12791 Puntos [04:41] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 12791 Puntos
[04:42] HipopotamoConPrisa 2 Pista: tio**** 30 segundos y 12791 Puntos [04:42] HipopotamoConPrisa
2 Pista: tio**** 30 segundos y 12791 Puntos
[04:42] HipopotamoConPrisa 3 Pista: tio*i*o 15 segundos y 12791 Puntos [04:42] HipopotamoConPrisa
3 Pista: tio*i*o 15 segundos y 12791 Puntos
[04:42] HipopotamoConPrisa �e nota que sabes mucho de esto Hipopotamo\Especial! Tu respuesta "tiovivo" es correcta y ganas �2791�12 puntos [04:42] HipopotamoConPrisa
�e nota que sabes mucho de esto Hipopotamo\Especial! Tu respuesta "tiovivo" es correcta y ganas �2791�12 puntos
[04:42] HipopotamoConPrisa Hipopotamo\Especial has acertado 12 seguidas!! Puntos HOY: 907612, SEMANA: 12663726 y MES: 12663726 [04:42] HipopotamoConPrisa
Hipopotamo\Especial has acertado 12 seguidas!! Puntos HOY: 907612, SEMANA: 12663726 y MES: 12663726
[04:42] Hipopotamo\Especial tiovivo [04:42] Hipopotamo\Especial
tiovivo
[04:42] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [04:42] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[04:42] HipopotamoConPrisa Tri.16540 CienciaɊAVEA˿19jDEjMAYOjDEj1948:jQUEjEMPRESAjSACAjUNAjCAMARAjDEjFOTOGRAFIAjQUEjPOSEEjUNjAUTORELEVADOjINSTANTANEOj?j [04:42] HipopotamoConPrisa
Tri.16540 CienciaɊAVEA˿19jDEjMAYOjDEj1948:jQUEjEMPRESAjSACAjUNAjCAMARAjDEjFOTOGRAFIAjQUEjPOSEEjUNjAUTORELEVADOjINSTANTANEOj?j
[04:42] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 10764 Puntos [04:42] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 10764 Puntos
[04:42] HipopotamoConPrisa 2 Pista: pol***** 30 segundos y 10764 Puntos [04:42] HipopotamoConPrisa
2 Pista: pol***** 30 segundos y 10764 Puntos
[04:42] HipopotamoConPrisa �Hipopotamo\Especial acert󡡠La respuesta era: "polaroid" y contest󠥮 �1.844 segundos. Se lleva: �0764�12 puntos [04:42] HipopotamoConPrisa
�Hipopotamo\Especial acert󡡠La respuesta era: "polaroid" y contest󠥮 �1.844 segundos. Se lleva: �0764�12 puntos
[04:42] HipopotamoConPrisa Hipopotamo\Especial has acertado 13 seguidas!! Puntos HOY: 918376, SEMANA: 12674490 y MES: 12674490 [04:42] HipopotamoConPrisa
Hipopotamo\Especial has acertado 13 seguidas!! Puntos HOY: 918376, SEMANA: 12674490 y MES: 12674490
[04:42] Hipopotamo\Especial polaroid [04:42] Hipopotamo\Especial
polaroid
[04:43] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [04:43] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[04:43] HipopotamoConPrisa Tri.5278 Cotilleo-TVɡnghara˿C󭯃01esenllamaalaaDuquesaadenAlbaa?o [04:43] HipopotamoConPrisa
Tri.5278 Cotilleo-TVɡnghara˿C󭯃01esenllamaalaaDuquesaadenAlbaa?o
[04:43] HipopotamoConPrisa 1 Pista: ******** ********* ****** Valor pregunta : 8262 Puntos [04:43] HipopotamoConPrisa
1 Pista: ******** ********* ****** Valor pregunta : 8262 Puntos
[04:43] HipopotamoConPrisa 2 Pista: cay***** ********* ****** 30 segundos y 8262 Puntos [04:43] HipopotamoConPrisa
2 Pista: cay***** ********* ****** 30 segundos y 8262 Puntos
[04:43] HipopotamoConPrisa 3 Pista: caye*a*a *i***a*e* **ua** 15 segundos y 8262 Puntos [04:43] HipopotamoConPrisa
3 Pista: caye*a*a *i***a*e* **ua** 15 segundos y 8262 Puntos
[04:43] HipopotamoConPrisa Tiempo! La respuesta es -> cayetana�itzjames�tuart <- [04:43] HipopotamoConPrisa
Tiempo! La respuesta es -> cayetana�itzjames�tuart <-
[04:44] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [04:44] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[04:44] HipopotamoConPrisa Tri.15139 Idiomasɦlipp_er˿LATIN--->ESPAяL:nostro-l?l [04:44] HipopotamoConPrisa
Tri.15139 Idiomasɦlipp_er˿LATIN--->ESPAяL:nostro-l?l
[04:44] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 13461 Puntos [04:44] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 13461 Puntos
[04:44] HipopotamoConPrisa 2 Pista: nue**** 30 segundos y 13461 Puntos [04:44] HipopotamoConPrisa
2 Pista: nue**** 30 segundos y 13461 Puntos
[04:44] HipopotamoConPrisa �Eso es Hipopotamo\Especial!! Dijiste: "nuestro" y ello te ha valido: �3461�12 puntos [04:44] HipopotamoConPrisa
�Eso es Hipopotamo\Especial!! Dijiste: "nuestro" y ello te ha valido: �3461�12 puntos
[04:44] HipopotamoConPrisa Hipopotamo\Especial has acertado 14 seguidas!! Puntos HOY: 931837, SEMANA: 12687951 y MES: 12687951 [04:44] HipopotamoConPrisa
Hipopotamo\Especial has acertado 14 seguidas!! Puntos HOY: 931837, SEMANA: 12687951 y MES: 12687951
[04:44] Hipopotamo\Especial nuestro [04:44] Hipopotamo\Especial
nuestro
[04:44] HipopotamoConPrisa R᮫ing SEMANA: - #1: Hipopotamo\Especial 12687951 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [04:44] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Hipopotamo\Especial 12687951 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[04:44] HipopotamoConPrisa Tri.5254 Fisica-Quimicaɓebosin˿C󭯃01csefllamatelum鴯docm᳃01ueficazqdefsaberesiuunatgematesunaturaluochatsidocfabricadatporeeluhombre?q(Estefm鴯docpermitefverelasufigurasudefcrecimientocdeflosudiamantes)q?q [04:44] HipopotamoConPrisa
Tri.5254 Fisica-Quimicaɓebosin˿C󭯃01csefllamatelum鴯docm᳃01ueficazqdefsaberesiuunatgematesunaturaluochatsidocfabricadatporeeluhombre?q(Estefm鴯docpermitefverelasufigurasudefcrecimientocdeflosudiamantes)q?q
[04:44] HipopotamoConPrisa 1 Pista: ******************* Valor pregunta : 17675 Puntos [04:44] HipopotamoConPrisa
1 Pista: ******************* Valor pregunta : 17675 Puntos
[04:44] HipopotamoConPrisa 2 Pista: cat**************** 30 segundos y 17675 Puntos [04:44] HipopotamoConPrisa
2 Pista: cat**************** 30 segundos y 17675 Puntos
[04:45] HipopotamoConPrisa 3 Pista: cato*o*u*i*i**e**ia 15 segundos y 17675 Puntos [04:45] HipopotamoConPrisa
3 Pista: cato*o*u*i*i**e**ia 15 segundos y 17675 Puntos
[04:45] HipopotamoConPrisa Tiempo! La respuesta es -> catodoluminiscencia <- [04:45] HipopotamoConPrisa
Tiempo! La respuesta es -> catodoluminiscencia <-
[04:45] HipopotamoConPrisa We feature over 50,000 Q&A ! [04:45] HipopotamoConPrisa
We feature over 50,000 Q&A !
[04:45] HipopotamoConPrisa Tri.6231 Medicina-Saludɍonteso˿Enbquexorganobestaflafvalvulaftricuspidex?q [04:45] HipopotamoConPrisa
Tri.6231 Medicina-Saludɍonteso˿Enbquexorganobestaflafvalvulaftricuspidex?q
[04:45] HipopotamoConPrisa 1 Pista: ******* Pregunta de BONUS : 200000 Puntos [04:45] HipopotamoConPrisa
1 Pista: ******* Pregunta de BONUS : 200000 Puntos
[04:45] HipopotamoConPrisa 2 Pista: cor**** 30 segundos y 200000 Puntos [04:45] HipopotamoConPrisa
2 Pista: cor**** 30 segundos y 200000 Puntos
[04:45] Hipopotamo\Especial corazon [04:45] Hipopotamo\Especial
corazon
[04:45] HipopotamoConPrisa �e nota que sabes mucho de esto Hipopotamo\Especial! Tu respuesta "corazon" es correcta y ganas �00000�12 puntos [04:45] HipopotamoConPrisa
�e nota que sabes mucho de esto Hipopotamo\Especial! Tu respuesta "corazon" es correcta y ganas �00000�12 puntos
[04:45] HipopotamoConPrisa Hipopotamo\Especial has acertado 15 seguidas!! Puntos HOY: 1131837, SEMANA: 12887951 y MES: 12887951 [04:45] HipopotamoConPrisa
Hipopotamo\Especial has acertado 15 seguidas!! Puntos HOY: 1131837, SEMANA: 12887951 y MES: 12887951
[04:46] HipopotamoConPrisa Tri.4078 Idiomasɲaziel9˿FRANCES--->ESPA񏌺embrasseresurelatboucheq?s [04:46] HipopotamoConPrisa
Tri.4078 Idiomasɲaziel9˿FRANCES--->ESPA񏌺embrasseresurelatboucheq?s
[04:46] HipopotamoConPrisa 1 Pista: ***** ** ** **** Valor pregunta : 22904 Puntos [04:46] HipopotamoConPrisa
1 Pista: ***** ** ** **** Valor pregunta : 22904 Puntos
[04:46] HipopotamoConPrisa 2 Pista: bes** ** ** **** 30 segundos y 22904 Puntos [04:46] HipopotamoConPrisa
2 Pista: bes** ** ** **** 30 segundos y 22904 Puntos
[04:46] HipopotamoConPrisa 3 Pista: besa* e* *a *o*a 15 segundos y 22904 Puntos [04:46] HipopotamoConPrisa
3 Pista: besa* e* *a *o*a 15 segundos y 22904 Puntos
[04:46] Hipopotamo\Especial besos en la boca [04:46] Hipopotamo\Especial
besos en la boca
[04:46] HipopotamoConPrisa Tiempo! La respuesta es -> besar�n�a�oca <- [04:46] HipopotamoConPrisa
Tiempo! La respuesta es -> besar�n�a�oca <-
[04:47] HipopotamoConPrisa Tri.18741 Cotilleo-TVɥloy_˿AbRAIZbDEbQUEbPROGRAMAbSEbPRODUJObUNbBULObACERCAbDEbUNAbNI񁬃01bUNbPERRObYbRICKYbMARTINb?b [04:47] HipopotamoConPrisa
Tri.18741 Cotilleo-TVɥloy_˿AbRAIZbDEbQUEbPROGRAMAbSEbPRODUJObUNbBULObACERCAbDEbUNAbNI񁬃01bUNbPERRObYbRICKYbMARTINb?b
[04:47] HipopotamoConPrisa 1 Pista: ******** ******** Valor pregunta : 7729 Puntos [04:47] HipopotamoConPrisa
1 Pista: ******** ******** Valor pregunta : 7729 Puntos
[04:47] HipopotamoConPrisa 2 Pista: sor***** ******** 30 segundos y 7729 Puntos [04:47] HipopotamoConPrisa
2 Pista: sor***** ******** 30 segundos y 7729 Puntos
[04:47] Hipopotamo\Especial sorpresa sorpresa [04:47] Hipopotamo\Especial
sorpresa sorpresa
[04:47] HipopotamoConPrisa 3 Pista: sor**e*a *o***e*a 15 segundos y 7729 Puntos [04:47] HipopotamoConPrisa
3 Pista: sor**e*a *o***e*a 15 segundos y 7729 Puntos
[04:47] HipopotamoConPrisa �Bingo!! Hipopotamo\Especial dio la respuesta: "sorpresa sorpresa" en �0.125 segundos e incrementa sus ganancias con �729�12 puntos [04:47] HipopotamoConPrisa
�Bingo!! Hipopotamo\Especial dio la respuesta: "sorpresa sorpresa" en �0.125 segundos e incrementa sus ganancias con �729�12 puntos
[04:47] HipopotamoConPrisa Hipopotamo\Especial has acertado 16 seguidas!! Puntos HOY: 1139566, SEMANA: 12895680 y MES: 12895680 [04:47] HipopotamoConPrisa
Hipopotamo\Especial has acertado 16 seguidas!! Puntos HOY: 1139566, SEMANA: 12895680 y MES: 12895680
[04:47] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [04:47] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[04:47] HipopotamoConPrisa Tri.11130 CienciaɞIrati˿Laxerupci󮃰1itranquilaxdemlavaxaxtrav鳃01odemfisurasoyxformaxflujosohorizontalesoesodemtipo...u?u [04:47] HipopotamoConPrisa
Tri.11130 CienciaɞIrati˿Laxerupci󮃰1itranquilaxdemlavaxaxtrav鳃01odemfisurasoyxformaxflujosohorizontalesoesodemtipo...u?u
[04:47] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 23388 Puntos [04:47] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 23388 Puntos
[04:47] HipopotamoConPrisa 2 Pista: isl****** 30 segundos y 23388 Puntos [04:47] HipopotamoConPrisa
2 Pista: isl****** 30 segundos y 23388 Puntos
[04:48] HipopotamoConPrisa 3 Pista: isla**e*a 15 segundos y 23388 Puntos [04:48] HipopotamoConPrisa
3 Pista: isla**e*a 15 segundos y 23388 Puntos
[04:48] HipopotamoConPrisa Tiempo! La respuesta es -> islandesa <- [04:48] HipopotamoConPrisa
Tiempo! La respuesta es -> islandesa <-
[04:48] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [04:48] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[04:48] HipopotamoConPrisa Tri.9679 Biologiaɳtephenwo˿Elzsistemabbinominalzparabdefinirtanimalessenklatinkquemdosscategoriassutiliza?g?g [04:48] HipopotamoConPrisa
Tri.9679 Biologiaɳtephenwo˿Elzsistemabbinominalzparabdefinirtanimalessenklatinkquemdosscategoriassutiliza?g?g
[04:48] HipopotamoConPrisa 1 Pista: ****** * ******* Valor pregunta : 24885 Puntos [04:48] HipopotamoConPrisa
1 Pista: ****** * ******* Valor pregunta : 24885 Puntos
[04:48] HipopotamoConPrisa 2 Pista: gen*** * ******* 30 segundos y 24885 Puntos [04:48] HipopotamoConPrisa
2 Pista: gen*** * ******* 30 segundos y 24885 Puntos
[04:49] Hipopotamo\Especial genero y especie [04:49] Hipopotamo\Especial
genero y especie
[04:49] HipopotamoConPrisa �Hipopotamo\Especial acert󡡠La respuesta era: "genero y especie" y contest󠥮 �8.281 segundos. Se lleva: �4885�12 puntos [04:49] HipopotamoConPrisa
�Hipopotamo\Especial acert󡡠La respuesta era: "genero y especie" y contest󠥮 �8.281 segundos. Se lleva: �4885�12 puntos
[04:49] HipopotamoConPrisa Hipopotamo\Especial has acertado 17 seguidas!! Puntos HOY: 1164451, SEMANA: 12920565 y MES: 12920565 [04:49] HipopotamoConPrisa
Hipopotamo\Especial has acertado 17 seguidas!! Puntos HOY: 1164451, SEMANA: 12920565 y MES: 12920565
[04:49] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [04:49] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[04:49] HipopotamoConPrisa Tri.19089 HistoriaɎordik˿Hispania:kcapitalodectarraconensis?k?k [04:49] HipopotamoConPrisa
Tri.19089 HistoriaɎordik˿Hispania:kcapitalodectarraconensis?k?k
[04:49] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 7432 Puntos [04:49] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 7432 Puntos
[04:49] HipopotamoConPrisa 2 Pista: tar**** 30 segundos y 7432 Puntos [04:49] HipopotamoConPrisa
2 Pista: tar**** 30 segundos y 7432 Puntos
[04:49] HipopotamoConPrisa 3 Pista: tar*a*o 15 segundos y 7432 Puntos [04:49] HipopotamoConPrisa
3 Pista: tar*a*o 15 segundos y 7432 Puntos
[04:49] Hipopotamo\Especial tarraco [04:49] Hipopotamo\Especial
tarraco
[04:49] HipopotamoConPrisa �Enhorabuena Hipopotamo\Especial!! Has contestado "tarraco" y por ello has ganado �432�12 puntos [04:49] HipopotamoConPrisa
�Enhorabuena Hipopotamo\Especial!! Has contestado "tarraco" y por ello has ganado �432�12 puntos
[04:49] HipopotamoConPrisa Hipopotamo\Especial has acertado 18 seguidas!! Puntos HOY: 1171883, SEMANA: 12927997 y MES: 12927997 [04:49] HipopotamoConPrisa
Hipopotamo\Especial has acertado 18 seguidas!! Puntos HOY: 1171883, SEMANA: 12927997 y MES: 12927997
[04:50] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [04:50] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[04:50] HipopotamoConPrisa Tri.17255 Cienciaɲainby˿CualesisonslasitresiRqutilizadasiparaetratardeljproblemaedezlasibasurasi?q [04:50] HipopotamoConPrisa
Tri.17255 Cienciaɲainby˿CualesisonslasitresiRqutilizadasiparaetratardeljproblemaedezlasibasurasi?q
[04:50] HipopotamoConPrisa 1 Pista: ******* ********** ******** Valor pregunta : 17866 Puntos [04:50] HipopotamoConPrisa
1 Pista: ******* ********** ******** Valor pregunta : 17866 Puntos
[04:50] HipopotamoConPrisa 2 Pista: red**** ********** ******** 30 segundos y 17866 Puntos [04:50] HipopotamoConPrisa
2 Pista: red**** ********** ******** 30 segundos y 17866 Puntos
[04:50] HipopotamoConPrisa 3 Pista: redu*i* *eu*i*i*a* *e*i**a* 15 segundos y 17866 Puntos [04:50] HipopotamoConPrisa
3 Pista: redu*i* *eu*i*i*a* *e*i**a* 15 segundos y 17866 Puntos
[04:50] HipopotamoConPrisa Tiempo! La respuesta es -> reducir�eutilizar�eciclar <- [04:50] HipopotamoConPrisa
Tiempo! La respuesta es -> reducir�eutilizar�eciclar <-
[04:51] HipopotamoConPrisa For The Competitive Edge type !pingme [04:51] HipopotamoConPrisa
For The Competitive Edge type !pingme
[04:51] HipopotamoConPrisa Tri.1011 Gastronomiaɒolo˿Cuantosmgradosmdesalcoholvtieneslapginebrap?b [04:51] HipopotamoConPrisa
Tri.1011 Gastronomiaɒolo˿Cuantosmgradosmdesalcoholvtieneslapginebrap?b
[04:51] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 17224 Puntos [04:51] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 17224 Puntos
[04:51] HipopotamoConPrisa 2 Pista: CUA***** 30 segundos y 17224 Puntos [04:51] HipopotamoConPrisa
2 Pista: CUA***** 30 segundos y 17224 Puntos
[04:51] Hipopotamo\Especial cuarenta [04:51] Hipopotamo\Especial
cuarenta
[04:51] HipopotamoConPrisa �Increible!! Hipopotamo\Especial contest󺠃04"cuarenta" en �1.266 segundos, y ha ganado �7224�12 puntos [04:51] HipopotamoConPrisa
�Increible!! Hipopotamo\Especial contest󺠃04"cuarenta" en �1.266 segundos, y ha ganado �7224�12 puntos
[04:51] HipopotamoConPrisa Hipopotamo\Especial has acertado 19 seguidas!! Puntos HOY: 1189107, SEMANA: 12945221 y MES: 12945221 [04:51] HipopotamoConPrisa
Hipopotamo\Especial has acertado 19 seguidas!! Puntos HOY: 1189107, SEMANA: 12945221 y MES: 12945221
[04:51] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [04:51] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[04:51] HipopotamoConPrisa Tri.20395 Idiomasɭartuniki˿LANCEdDEdCAPOTEdCONdNOMBREdDEdMUJERd?d [04:51] HipopotamoConPrisa
Tri.20395 Idiomasɭartuniki˿LANCEdDEdCAPOTEdCONdNOMBREdDEdMUJERd?d
[04:51] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 14498 Puntos [04:51] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 14498 Puntos
[04:51] HipopotamoConPrisa �Bien Hipopotamo\Especial!! Tu respuesta: "veronica" es correcta y ganas �4498�12 puntos [04:51] HipopotamoConPrisa
�Bien Hipopotamo\Especial!! Tu respuesta: "veronica" es correcta y ganas �4498�12 puntos
[04:51] Hipopotamo\Especial veronica [04:51] Hipopotamo\Especial
veronica
[04:51] HipopotamoConPrisa Hipopotamo\Especial has acertado 20 seguidas!! Puntos HOY: 1203605, SEMANA: 12959719 y MES: 12959719 [04:51] HipopotamoConPrisa
Hipopotamo\Especial has acertado 20 seguidas!! Puntos HOY: 1203605, SEMANA: 12959719 y MES: 12959719
[04:51] HipopotamoConPrisa Bonus especial de 60000 Puntos para Hipopotamo\Especial por acertar 20 seguidas!!! [04:51] HipopotamoConPrisa
Bonus especial de 60000 Puntos para Hipopotamo\Especial por acertar 20 seguidas!!!
[04:51] HipopotamoConPrisa 20 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [04:51] HipopotamoConPrisa
20 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[04:51] HipopotamoConPrisa R᮫ing MES: - #1: Hipopotamo\Especial 12945221 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [04:51] HipopotamoConPrisa
R᮫ing MES: - #1: Hipopotamo\Especial 12945221 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[04:51] HipopotamoConPrisa Tri.10078 Geografiaɓebosin˿Enwqu郰1nislanseeencuentranwNarsarsuaq,nNarsaqayklanbah�01ndeeTasiussaq?n?n [04:51] HipopotamoConPrisa
Tri.10078 Geografiaɓebosin˿Enwqu郰1nislanseeencuentranwNarsarsuaq,nNarsaqayklanbah�01ndeeTasiussaq?n?n
[04:51] HipopotamoConPrisa 1 Pista: *********** Valor pregunta : 15136 Puntos [04:51] HipopotamoConPrisa
1 Pista: *********** Valor pregunta : 15136 Puntos
[04:52] HipopotamoConPrisa 2 Pista: gro******** 30 segundos y 15136 Puntos [04:52] HipopotamoConPrisa
2 Pista: gro******** 30 segundos y 15136 Puntos
[04:52] Hipopotamo\Especial groenlandia [04:52] Hipopotamo\Especial
groenlandia
[04:52] HipopotamoConPrisa �Suma y sigue Hipopotamo\Especial!! La respuesta: "groenlandia" incrementa tu marcador en �5136�12 puntos [04:52] HipopotamoConPrisa
�Suma y sigue Hipopotamo\Especial!! La respuesta: "groenlandia" incrementa tu marcador en �5136�12 puntos
[04:52] HipopotamoConPrisa Hipopotamo\Especial has acertado 21 seguidas!! Puntos HOY: 1278741, SEMANA: 13034855 y MES: 13034855 [04:52] HipopotamoConPrisa
Hipopotamo\Especial has acertado 21 seguidas!! Puntos HOY: 1278741, SEMANA: 13034855 y MES: 13034855
[04:52] HipopotamoConPrisa 21 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [04:52] HipopotamoConPrisa
21 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[04:52] HipopotamoConPrisa Please refrain from using Extreme Bad Language [04:52] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[04:52] HipopotamoConPrisa Tri.17571 Biologiaɐegaso_R˿CUALyESyELyMASyANCHOyDEyLOSyPECESyPLANOSy?y [04:52] HipopotamoConPrisa
Tri.17571 Biologiaɐegaso_R˿CUALyESyELyMASyANCHOyDEyLOSyPECESyPLANOSy?y
[04:52] HipopotamoConPrisa 1 Pista: ********* Pregunta de BONUS : 100000 Puntos [04:52] HipopotamoConPrisa
1 Pista: ********* Pregunta de BONUS : 100000 Puntos
[04:52] HipopotamoConPrisa 2 Pista: rod****** 30 segundos y 100000 Puntos [04:52] HipopotamoConPrisa
2 Pista: rod****** 30 segundos y 100000 Puntos
[04:52] Hipopotamo\Especial rodavallo [04:52] Hipopotamo\Especial
rodavallo
[04:53] HipopotamoConPrisa 3 Pista: roda*a**o 15 segundos y 100000 Puntos [04:53] HipopotamoConPrisa
3 Pista: roda*a**o 15 segundos y 100000 Puntos
[04:53] HipopotamoConPrisa �Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "rodaballo" era la respuesta? Venga, �00000�12 puntos suben a tu marcador [04:53] HipopotamoConPrisa
�Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "rodaballo" era la respuesta? Venga, �00000�12 puntos suben a tu marcador
[04:53] HipopotamoConPrisa Hipopotamo\Especial has acertado 22 seguidas!! Puntos HOY: 1378741, SEMANA: 13134855 y MES: 13134855 [04:53] HipopotamoConPrisa
Hipopotamo\Especial has acertado 22 seguidas!! Puntos HOY: 1378741, SEMANA: 13134855 y MES: 13134855
[04:53] HipopotamoConPrisa 22 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [04:53] HipopotamoConPrisa
22 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[04:53] Hipopotamo\Especial rodaballo [04:53] Hipopotamo\Especial
rodaballo
[04:53] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [04:53] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[04:53] HipopotamoConPrisa Tri.9529 DeporteɁiarako˿ComohseillamawelzestadiohdelzRealzUnionldeiIrunl?t [04:53] HipopotamoConPrisa
Tri.9529 DeporteɁiarako˿ComohseillamawelzestadiohdelzRealzUnionldeiIrunl?t
[04:53] HipopotamoConPrisa 1 Pista: *** Valor pregunta : 11896 Puntos [04:53] HipopotamoConPrisa
1 Pista: *** Valor pregunta : 11896 Puntos
[04:53] HipopotamoConPrisa 2 Pista: gal 30 segundos y 11896 Puntos [04:53] HipopotamoConPrisa
2 Pista: gal 30 segundos y 11896 Puntos
[04:53] HipopotamoConPrisa �emuestra lo que sabes Hipopotamo\Especial! Has respondido "gal" correctamente y eso te da: �1896�12 puntos [04:53] HipopotamoConPrisa
�emuestra lo que sabes Hipopotamo\Especial! Has respondido "gal" correctamente y eso te da: �1896�12 puntos
[04:53] HipopotamoConPrisa Hipopotamo\Especial has acertado 23 seguidas!! Puntos HOY: 1390637, SEMANA: 13146751 y MES: 13146751 [04:53] HipopotamoConPrisa
Hipopotamo\Especial has acertado 23 seguidas!! Puntos HOY: 1390637, SEMANA: 13146751 y MES: 13146751
[04:53] HipopotamoConPrisa 23 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [04:53] HipopotamoConPrisa
23 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[04:53] Hipopotamo\Especial gal [04:53] Hipopotamo\Especial
gal
[04:53] HipopotamoConPrisa This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [04:53] HipopotamoConPrisa
This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[04:53] HipopotamoConPrisa Tri.16974 Musicaɚytox˿EludiscoeAedayyinqthebraceslesldeb?e [04:53] HipopotamoConPrisa
Tri.16974 Musicaɚytox˿EludiscoeAedayyinqthebraceslesldeb?e
[04:53] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 11006 Puntos [04:53] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 11006 Puntos
[04:53] HipopotamoConPrisa 2 Pista: que** 30 segundos y 11006 Puntos [04:53] HipopotamoConPrisa
2 Pista: que** 30 segundos y 11006 Puntos
[04:54] Hipopotamo\Especial queen [04:54] Hipopotamo\Especial
queen
[04:54] HipopotamoConPrisa �Eso es Hipopotamo\Especial!! Dijiste: "queen" y ello te ha valido: �1006�12 puntos [04:54] HipopotamoConPrisa
�Eso es Hipopotamo\Especial!! Dijiste: "queen" y ello te ha valido: �1006�12 puntos
[04:54] HipopotamoConPrisa Hipopotamo\Especial has acertado 24 seguidas!! Puntos HOY: 1401643, SEMANA: 13157757 y MES: 13157757 [04:54] HipopotamoConPrisa
Hipopotamo\Especial has acertado 24 seguidas!! Puntos HOY: 1401643, SEMANA: 13157757 y MES: 13157757
[04:54] HipopotamoConPrisa 24 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [04:54] HipopotamoConPrisa
24 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[04:54] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [04:54] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[04:54] HipopotamoConPrisa Tri.3229 PersonajesɍARdeJAVA˿CU�pERApELpSIGNOpDELpZODIACOpDEpLOSpSIGUIENTESpPERSONAJESpCɌEBRES:pADOLFpHITLER,pVINCENTpVANpGOGHpYpCHARLESpCHAPLIN?p?p [04:54] HipopotamoConPrisa
Tri.3229 PersonajesɍARdeJAVA˿CU�pERApELpSIGNOpDELpZODIACOpDEpLOSpSIGUIENTESpPERSONAJESpCɌEBRES:pADOLFpHITLER,pVINCENTpVANpGOGHpYpCHARLESpCHAPLIN?p?p
[04:54] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 17682 Puntos [04:54] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 17682 Puntos
[04:54] HipopotamoConPrisa 2 Pista: ari** 30 segundos y 17682 Puntos [04:54] HipopotamoConPrisa
2 Pista: ari** 30 segundos y 17682 Puntos
[04:54] Hipopotamo\Especial aries [04:54] Hipopotamo\Especial
aries
[04:54] HipopotamoConPrisa �Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "aries" era la respuesta? Venga, �7682�12 puntos suben a tu marcador [04:54] HipopotamoConPrisa
�Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "aries" era la respuesta? Venga, �7682�12 puntos suben a tu marcador
[04:54] HipopotamoConPrisa Hipopotamo\Especial has acertado 25 seguidas!! Puntos HOY: 1419325, SEMANA: 13175439 y MES: 13175439 [04:54] HipopotamoConPrisa
Hipopotamo\Especial has acertado 25 seguidas!! Puntos HOY: 1419325, SEMANA: 13175439 y MES: 13175439
[04:54] HipopotamoConPrisa 25 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [04:54] HipopotamoConPrisa
25 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[04:54] HipopotamoConPrisa This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [04:54] HipopotamoConPrisa
This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[04:54] HipopotamoConPrisa Tri.7445 DeporteɔDI˿CUANTOSlMUNDIALESlJUGOl"DELlSOL"l?l [04:54] HipopotamoConPrisa
Tri.7445 DeporteɔDI˿CUANTOSlMUNDIALESlJUGOl"DELlSOL"l?l
[04:54] HipopotamoConPrisa 1 Pista: *** Pregunta de BONUS : 50000 Puntos [04:54] HipopotamoConPrisa
1 Pista: *** Pregunta de BONUS : 50000 Puntos
[04:55] HipopotamoConPrisa 2 Pista: dos 30 segundos y 50000 Puntos [04:55] HipopotamoConPrisa
2 Pista: dos 30 segundos y 50000 Puntos
[04:55] HipopotamoConPrisa �As�e hace Hipopotamo\Especial!! Contestaste "dos" en �8.015 segundos y sumas �0000�12 puntos [04:55] HipopotamoConPrisa
�As�e hace Hipopotamo\Especial!! Contestaste "dos" en �8.015 segundos y sumas �0000�12 puntos
[04:55] HipopotamoConPrisa Hipopotamo\Especial has acertado 26 seguidas!! Puntos HOY: 1469325, SEMANA: 13225439 y MES: 13225439 [04:55] HipopotamoConPrisa
Hipopotamo\Especial has acertado 26 seguidas!! Puntos HOY: 1469325, SEMANA: 13225439 y MES: 13225439
[04:55] HipopotamoConPrisa 26 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [04:55] HipopotamoConPrisa
26 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[04:55] Hipopotamo\Especial dos [04:55] Hipopotamo\Especial
dos
[04:55] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [04:55] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[04:55] HipopotamoConPrisa Tri.14208 MusicaɬusieˆaithoNolMorefߣomponente?s?s [04:55] HipopotamoConPrisa
Tri.14208 MusicaɬusieˆaithoNolMorefߣomponente?s?s
[04:55] HipopotamoConPrisa 1 Pista: **** ****** Valor pregunta : 20957 Puntos [04:55] HipopotamoConPrisa
1 Pista: **** ****** Valor pregunta : 20957 Puntos
[04:55] HipopotamoConPrisa 2 Pista: mik* ****** 30 segundos y 20957 Puntos [04:55] HipopotamoConPrisa
2 Pista: mik* ****** 30 segundos y 20957 Puntos
[04:55] HipopotamoConPrisa 3 Pista: mike *a**o* 15 segundos y 20957 Puntos [04:55] HipopotamoConPrisa
3 Pista: mike *a**o* 15 segundos y 20957 Puntos
[04:56] HipopotamoConPrisa Tiempo! La respuesta es -> mike�atton <- [04:56] HipopotamoConPrisa
Tiempo! La respuesta es -> mike�atton <-
[04:56] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [04:56] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[04:56] HipopotamoConPrisa Tri.1728 Fisica-Quimicaɤassler˿Enaqu郰1destadoufiguralelxMendeleviouenalaltablalperi󤩣a?d?d [04:56] HipopotamoConPrisa
Tri.1728 Fisica-Quimicaɤassler˿Enaqu郰1destadoufiguralelxMendeleviouenalaltablalperi󤩣a?d?d
[04:56] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 19027 Puntos [04:56] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 19027 Puntos
[04:56] HipopotamoConPrisa 2 Pista: Sin****** 30 segundos y 19027 Puntos [04:56] HipopotamoConPrisa
2 Pista: Sin****** 30 segundos y 19027 Puntos
[04:56] HipopotamoConPrisa 3 Pista: Sin*e*i*o 15 segundos y 19027 Puntos [04:56] HipopotamoConPrisa
3 Pista: Sin*e*i*o 15 segundos y 19027 Puntos
[04:56] Hipopotamo\Especial sintetico [04:56] Hipopotamo\Especial
sintetico
[04:56] HipopotamoConPrisa �Hipopotamo\Especial acert󡡠La respuesta era: "sintetico" y contest󠥮 �1.5 segundos. Se lleva: �9027�12 puntos [04:56] HipopotamoConPrisa
�Hipopotamo\Especial acert󡡠La respuesta era: "sintetico" y contest󠥮 �1.5 segundos. Se lleva: �9027�12 puntos
[04:56] HipopotamoConPrisa Hipopotamo\Especial has acertado 27 seguidas!! Puntos HOY: 1488352, SEMANA: 13244466 y MES: 13244466 [04:56] HipopotamoConPrisa
Hipopotamo\Especial has acertado 27 seguidas!! Puntos HOY: 1488352, SEMANA: 13244466 y MES: 13244466
[04:56] HipopotamoConPrisa 27 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [04:56] HipopotamoConPrisa
27 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[04:57] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [04:57] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[04:57] HipopotamoConPrisa Tri.2284 Idiomasɲaziel9˿FRANCES--->ESPA񏌺auyniveauydeqlaemert?o [04:57] HipopotamoConPrisa
Tri.2284 Idiomasɲaziel9˿FRANCES--->ESPA񏌺auyniveauydeqlaemert?o
[04:57] HipopotamoConPrisa 1 Pista: ** ***** *** *** Valor pregunta : 21035 Puntos [04:57] HipopotamoConPrisa
1 Pista: ** ***** *** *** Valor pregunta : 21035 Puntos
[04:57] HipopotamoConPrisa 2 Pista: al�**** *** *** 30 segundos y 21035 Puntos [04:57] HipopotamoConPrisa
2 Pista: al�**** *** *** 30 segundos y 21035 Puntos
[04:57] HipopotamoConPrisa 3 Pista: al�i*e* *e* *a* 15 segundos y 21035 Puntos [04:57] HipopotamoConPrisa
3 Pista: al�i*e* *e* *a* 15 segundos y 21035 Puntos
[04:57] HipopotamoConPrisa Tiempo! La respuesta es -> al�ivel�el�ar <- [04:57] HipopotamoConPrisa
Tiempo! La respuesta es -> al�ivel�el�ar <-
[04:58] HipopotamoConPrisa R᮫ing SEMANA: - #1: Hipopotamo\Especial 13244466 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [04:58] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Hipopotamo\Especial 13244466 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[04:58] HipopotamoConPrisa Tri.11370 Literaturaɣass_˿AUTORbDEb"NEGRAbESPALDAbDELbTIEMPOb?b [04:58] HipopotamoConPrisa
Tri.11370 Literaturaɣass_˿AUTORbDEb"NEGRAbESPALDAbDELbTIEMPOb?b
[04:58] HipopotamoConPrisa 1 Pista: ****** ****** Valor pregunta : 8979 Puntos [04:58] HipopotamoConPrisa
1 Pista: ****** ****** Valor pregunta : 8979 Puntos
[04:58] HipopotamoConPrisa 2 Pista: jav*** ****** 30 segundos y 8979 Puntos [04:58] HipopotamoConPrisa
2 Pista: jav*** ****** 30 segundos y 8979 Puntos
[04:58] HipopotamoConPrisa �Increible!! Hipopotamo\Especial contest󺠃04"javier marias" en �3.282 segundos, y ha ganado �979�12 puntos [04:58] HipopotamoConPrisa
�Increible!! Hipopotamo\Especial contest󺠃04"javier marias" en �3.282 segundos, y ha ganado �979�12 puntos
[04:58] HipopotamoConPrisa Hipopotamo\Especial has acertado 28 seguidas!! Puntos HOY: 1497331, SEMANA: 13253445 y MES: 13253445 [04:58] HipopotamoConPrisa
Hipopotamo\Especial has acertado 28 seguidas!! Puntos HOY: 1497331, SEMANA: 13253445 y MES: 13253445
[04:58] HipopotamoConPrisa 28 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [04:58] HipopotamoConPrisa
28 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[04:58] Hipopotamo\Especial javier marias [04:58] Hipopotamo\Especial
javier marias
[04:58] HipopotamoConPrisa We feature over 50,000 Q&A ! [04:58] HipopotamoConPrisa
We feature over 50,000 Q&A !
[04:58] HipopotamoConPrisa Tri.18221 MiscelaneaɍARdeJAVA˔ROZOqPEQUEяqDEqPAPEL,qCONqTIMBREqOFICIAL,qQUEqSEqPEGAqAqCIERTOSqDOCUMENTOSqYqAqLASqCARTASqPARAqFRANQUEARLASqOqCERTIFICARLAS.q?q [04:58] HipopotamoConPrisa
Tri.18221 MiscelaneaɍARdeJAVA˔ROZOqPEQUEяqDEqPAPEL,qCONqTIMBREqOFICIAL,qQUEqSEqPEGAqAqCIERTOSqDOCUMENTOSqYqAqLASqCARTASqPARAqFRANQUEARLASqOqCERTIFICARLAS.q?q
[04:58] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 9583 Puntos [04:58] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 9583 Puntos
[04:58] HipopotamoConPrisa 2 Pista: sel** 30 segundos y 9583 Puntos [04:58] HipopotamoConPrisa
2 Pista: sel** 30 segundos y 9583 Puntos
[04:58] Hipopotamo\Especial sello [04:58] Hipopotamo\Especial
sello
[04:58] HipopotamoConPrisa �Muy bien Hipopotamo\Especial!! Acertaste "sello" en tan s󬯠�9.187 segundos y por eso has ganado: �583�12 puntos [04:58] HipopotamoConPrisa
�Muy bien Hipopotamo\Especial!! Acertaste "sello" en tan s󬯠�9.187 segundos y por eso has ganado: �583�12 puntos
[04:58] HipopotamoConPrisa Hipopotamo\Especial has acertado 29 seguidas!! Puntos HOY: 1506914, SEMANA: 13263028 y MES: 13263028 [04:58] HipopotamoConPrisa
Hipopotamo\Especial has acertado 29 seguidas!! Puntos HOY: 1506914, SEMANA: 13263028 y MES: 13263028
[04:58] HipopotamoConPrisa 29 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [04:58] HipopotamoConPrisa
29 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[04:59] HipopotamoConPrisa Tri.6872 Mitologiaɖivi˿Deequ郰1heraudios,hseg�nxlaumitolog�01uclᳩca,hCupido?h?h [04:59] HipopotamoConPrisa
Tri.6872 Mitologiaɖivi˿Deequ郰1heraudios,hseg�nxlaumitolog�01uclᳩca,hCupido?h?h
[04:59] HipopotamoConPrisa 1 Pista: *** **** Valor pregunta : 9533 Puntos [04:59] HipopotamoConPrisa
1 Pista: *** **** Valor pregunta : 9533 Puntos
[04:59] HipopotamoConPrisa 2 Pista: del **** 30 segundos y 9533 Puntos [04:59] HipopotamoConPrisa
2 Pista: del **** 30 segundos y 9533 Puntos
[04:59] Hipopotamo\Especial del amor [04:59] Hipopotamo\Especial
del amor
[04:59] HipopotamoConPrisa �Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "del amor" era la respuesta? Venga, �533�12 puntos suben a tu marcador [04:59] HipopotamoConPrisa
�Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "del amor" era la respuesta? Venga, �533�12 puntos suben a tu marcador
[04:59] HipopotamoConPrisa Hipopotamo\Especial has acertado 30 seguidas!! Puntos HOY: 1516447, SEMANA: 13272561 y MES: 13272561 [04:59] HipopotamoConPrisa
Hipopotamo\Especial has acertado 30 seguidas!! Puntos HOY: 1516447, SEMANA: 13272561 y MES: 13272561
[04:59] HipopotamoConPrisa Bonus especial de 80000 Puntos para Hipopotamo\Especial por acertar 30 seguidas!!! [04:59] HipopotamoConPrisa
Bonus especial de 80000 Puntos para Hipopotamo\Especial por acertar 30 seguidas!!!
[04:59] HipopotamoConPrisa 30 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [04:59] HipopotamoConPrisa
30 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[04:59] HipopotamoConPrisa Tri.11354 Arteɏrigenes˿ENjQUEjCIUDADjNACIӃ01jJOSehRIBERA,jM�jCONOCIDOjCOMOjELjESPA񏌅TOj?j [04:59] HipopotamoConPrisa
Tri.11354 Arteɏrigenes˿ENjQUEjCIUDADjNACIӃ01jJOSehRIBERA,jM�jCONOCIDOjCOMOjELjESPA񏌅TOj?j
[04:59] HipopotamoConPrisa 1 Pista: ****** Valor pregunta : 15356 Puntos [04:59] HipopotamoConPrisa
1 Pista: ****** Valor pregunta : 15356 Puntos
[04:59] HipopotamoConPrisa 2 Pista: jat*** 30 segundos y 15356 Puntos [04:59] HipopotamoConPrisa
2 Pista: jat*** 30 segundos y 15356 Puntos
[04:59] Hipopotamo\Especial jativa [04:59] Hipopotamo\Especial
jativa
[04:59] HipopotamoConPrisa �e nota que sabes mucho de esto Hipopotamo\Especial! Tu respuesta "jativa" es correcta y ganas �5356�12 puntos [04:59] HipopotamoConPrisa
�e nota que sabes mucho de esto Hipopotamo\Especial! Tu respuesta "jativa" es correcta y ganas �5356�12 puntos
[04:59] HipopotamoConPrisa Hipopotamo\Especial has acertado 31 seguidas!! Puntos HOY: 1611803, SEMANA: 13367917 y MES: 13367917 [04:59] HipopotamoConPrisa
Hipopotamo\Especial has acertado 31 seguidas!! Puntos HOY: 1611803, SEMANA: 13367917 y MES: 13367917
[04:59] HipopotamoConPrisa 31 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [04:59] HipopotamoConPrisa
31 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[05:00] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [05:00] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[05:00] HipopotamoConPrisa Tri.19019 ArteɎefthis˿Cualaesllahtumbahorientalamaslfamosahenqmemoriahdelunahesposa?m?m [05:00] HipopotamoConPrisa
Tri.19019 ArteɎefthis˿Cualaesllahtumbahorientalamaslfamosahenqmemoriahdelunahesposa?m?m
[05:00] HipopotamoConPrisa 1 Pista: *** ***** Valor pregunta : 14479 Puntos [05:00] HipopotamoConPrisa
1 Pista: *** ***** Valor pregunta : 14479 Puntos
[05:00] HipopotamoConPrisa 2 Pista: taj ***** 30 segundos y 14479 Puntos [05:00] HipopotamoConPrisa
2 Pista: taj ***** 30 segundos y 14479 Puntos
[05:00] Hipopotamo\Especial taj mahal [05:00] Hipopotamo\Especial
taj mahal
[05:00] HipopotamoConPrisa �Increible!! Hipopotamo\Especial contest󺠃04"taj mahal" en �7.969 segundos, y ha ganado �4479�12 puntos [05:00] HipopotamoConPrisa
�Increible!! Hipopotamo\Especial contest󺠃04"taj mahal" en �7.969 segundos, y ha ganado �4479�12 puntos
[05:00] HipopotamoConPrisa Hipopotamo\Especial has acertado 32 seguidas!! Puntos HOY: 1626282, SEMANA: 13382396 y MES: 13382396 [05:00] HipopotamoConPrisa
Hipopotamo\Especial has acertado 32 seguidas!! Puntos HOY: 1626282, SEMANA: 13382396 y MES: 13382396
[05:00] HipopotamoConPrisa 32 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [05:00] HipopotamoConPrisa
32 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[05:00] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [05:00] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[05:00] HipopotamoConPrisa Tri.9704 CienciaɌopes_˿Comonllamamoseaflafmodelizacionamatematicafdelmespacion?o [05:00] HipopotamoConPrisa
Tri.9704 CienciaɌopes_˿Comonllamamoseaflafmodelizacionamatematicafdelmespacion?o
[05:00] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 22142 Puntos [05:00] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 22142 Puntos
[05:00] HipopotamoConPrisa 2 Pista: geo****** 30 segundos y 22142 Puntos [05:00] HipopotamoConPrisa
2 Pista: geo****** 30 segundos y 22142 Puntos
[05:01] Hipopotamo\Especial geometria [05:01] Hipopotamo\Especial
geometria
[05:01] HipopotamoConPrisa �Bien Hipopotamo\Especial!! Tu respuesta: "geometria" es correcta y ganas �2142�12 puntos [05:01] HipopotamoConPrisa
�Bien Hipopotamo\Especial!! Tu respuesta: "geometria" es correcta y ganas �2142�12 puntos
[05:01] HipopotamoConPrisa Hipopotamo\Especial has acertado 33 seguidas!! Puntos HOY: 1648424, SEMANA: 13404538 y MES: 13404538 [05:01] HipopotamoConPrisa
Hipopotamo\Especial has acertado 33 seguidas!! Puntos HOY: 1648424, SEMANA: 13404538 y MES: 13404538
[05:01] HipopotamoConPrisa 33 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [05:01] HipopotamoConPrisa
33 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[05:01] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [05:01] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[05:01] HipopotamoConPrisa Tri.15571 Medicina-SaludɃygna˿Elmdolorqdedo�sbseddenomina...?k?k [05:01] HipopotamoConPrisa
Tri.15571 Medicina-SaludɃygna˿Elmdolorqdedo�sbseddenomina...?k?k
[05:01] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 20038 Puntos [05:01] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 20038 Puntos
[05:01] HipopotamoConPrisa 2 Pista: ota**** 30 segundos y 20038 Puntos [05:01] HipopotamoConPrisa
2 Pista: ota**** 30 segundos y 20038 Puntos
[05:01] HipopotamoConPrisa 3 Pista: ota**ia 15 segundos y 20038 Puntos [05:01] HipopotamoConPrisa
3 Pista: ota**ia 15 segundos y 20038 Puntos
[05:02] HipopotamoConPrisa Tiempo! La respuesta es -> otalgia <- [05:02] HipopotamoConPrisa
Tiempo! La respuesta es -> otalgia <-
[05:02] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [05:02] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[05:02] HipopotamoConPrisa Tri.3820 Historiaɓebosin˿Contqu郰1ynombreuerahconocidahantiguamenteulahciudadpdeuBarcelona?y?y [05:02] HipopotamoConPrisa
Tri.3820 Historiaɓebosin˿Contqu郰1ynombreuerahconocidahantiguamenteulahciudadpdeuBarcelona?y?y
[05:02] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 20969 Puntos [05:02] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 20969 Puntos
[05:02] HipopotamoConPrisa 2 Pista: bar**** 30 segundos y 20969 Puntos [05:02] HipopotamoConPrisa
2 Pista: bar**** 30 segundos y 20969 Puntos
[05:02] HipopotamoConPrisa 3 Pista: bar*i*o 15 segundos y 20969 Puntos [05:02] HipopotamoConPrisa
3 Pista: bar*i*o 15 segundos y 20969 Puntos
[05:02] HipopotamoConPrisa Tiempo! La respuesta es -> barcino <- [05:02] HipopotamoConPrisa
Tiempo! La respuesta es -> barcino <-
[05:03] HipopotamoConPrisa For The Competitive Edge type !pingme [05:03] HipopotamoConPrisa
For The Competitive Edge type !pingme
[05:03] HipopotamoConPrisa Tri.10526 Idiomasɓebosin˿Diccionario-Sin󮩭ozdeqboda,tcasamiento,tenlace,tuni󮬃01tmatrimonio?t?t [05:03] HipopotamoConPrisa
Tri.10526 Idiomasɓebosin˿Diccionario-Sin󮩭ozdeqboda,tcasamiento,tenlace,tuni󮬃01tmatrimonio?t?t
[05:03] HipopotamoConPrisa 1 Pista: ******* Pregunta de BONUS : 25000 Puntos [05:03] HipopotamoConPrisa
1 Pista: ******* Pregunta de BONUS : 25000 Puntos
[05:03] HipopotamoConPrisa 2 Pista: him**** 30 segundos y 25000 Puntos [05:03] HipopotamoConPrisa
2 Pista: him**** 30 segundos y 25000 Puntos
[05:03] HipopotamoConPrisa 3 Pista: hime*eo 15 segundos y 25000 Puntos [05:03] HipopotamoConPrisa
3 Pista: hime*eo 15 segundos y 25000 Puntos
[05:03] HipopotamoConPrisa Tiempo! La respuesta es -> himeneo <- [05:03] HipopotamoConPrisa
Tiempo! La respuesta es -> himeneo <-
[05:04] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [05:04] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[05:04] HipopotamoConPrisa Tri.15144 Geografiaɓebosin˿Deequ郰1hEstadoqaustralianoqesosuoCapitaluSydney?h?h [05:04] HipopotamoConPrisa
Tri.15144 Geografiaɓebosin˿Deequ郰1hEstadoqaustralianoqesosuoCapitaluSydney?h?h
[05:04] HipopotamoConPrisa 1 Pista: ***** ***** *** *** Pregunta de BONUS : 25000 Puntos [05:04] HipopotamoConPrisa
1 Pista: ***** ***** *** *** Pregunta de BONUS : 25000 Puntos
[05:04] HipopotamoConPrisa 2 Pista: nue** ***** *** *** 30 segundos y 25000 Puntos [05:04] HipopotamoConPrisa
2 Pista: nue** ***** *** *** 30 segundos y 25000 Puntos
[05:04] HipopotamoConPrisa 3 Pista: nue*a *a*e* *e* *u* 15 segundos y 25000 Puntos [05:04] HipopotamoConPrisa
3 Pista: nue*a *a*e* *e* *u* 15 segundos y 25000 Puntos
[05:04] HipopotamoConPrisa Tiempo! La respuesta es -> nueva�ales�el�ur <- [05:04] HipopotamoConPrisa
Tiempo! La respuesta es -> nueva�ales�el�ur <-
[05:05] HipopotamoConPrisa R᮫ing MES: - #1: Hipopotamo\Especial 13404538 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [05:05] HipopotamoConPrisa
R᮫ing MES: - #1: Hipopotamo\Especial 13404538 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[05:05] HipopotamoConPrisa Tri.20000 Mitologiaɐsico666˳eg�nalarleyenda,yquermat󃰱ySanaJorger?y [05:05] HipopotamoConPrisa
Tri.20000 Mitologiaɐsico666˳eg�nalarleyenda,yquermat󃰱ySanaJorger?y
[05:05] HipopotamoConPrisa 1 Pista: ** ****** Valor pregunta : 22155 Puntos [05:05] HipopotamoConPrisa
1 Pista: ** ****** Valor pregunta : 22155 Puntos
[05:05] HipopotamoConPrisa 2 Pista: un�***** 30 segundos y 22155 Puntos [05:05] HipopotamoConPrisa
2 Pista: un�***** 30 segundos y 22155 Puntos
[05:05] Hipopotamo\Especial un dragon [05:05] Hipopotamo\Especial
un dragon
[05:05] HipopotamoConPrisa �As�e hace Hipopotamo\Especial!! Contestaste "un dragon" en �0.86 segundos y sumas �2155�12 puntos [05:05] HipopotamoConPrisa
�As�e hace Hipopotamo\Especial!! Contestaste "un dragon" en �0.86 segundos y sumas �2155�12 puntos
[05:05] HipopotamoConPrisa Hipopotamo\Especial has acertado 34 seguidas!! Puntos HOY: 1670579, SEMANA: 13426693 y MES: 13426693 [05:05] HipopotamoConPrisa
Hipopotamo\Especial has acertado 34 seguidas!! Puntos HOY: 1670579, SEMANA: 13426693 y MES: 13426693
[05:05] HipopotamoConPrisa 34 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [05:05] HipopotamoConPrisa
34 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[05:05] HipopotamoConPrisa Please refrain from using Extreme Bad Language [05:05] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[05:05] HipopotamoConPrisa Tri.8959 Literaturaɡnghara˿AutorudemLahultimahsalidahdemManuelfAza񡃰1h?u [05:05] HipopotamoConPrisa
Tri.8959 Literaturaɡnghara˿AutorudemLahultimahsalidahdemManuelfAza񡃰1h?u
[05:05] HipopotamoConPrisa 1 Pista: ******** ******* ******** Valor pregunta : 17478 Puntos [05:05] HipopotamoConPrisa
1 Pista: ******** ******* ******** Valor pregunta : 17478 Puntos
[05:05] HipopotamoConPrisa 2 Pista: fed***** ******* ******** 30 segundos y 17478 Puntos [05:05] HipopotamoConPrisa
2 Pista: fed***** ******* ******** 30 segundos y 17478 Puntos
[05:06] HipopotamoConPrisa 3 Pista: fede*i*o *i*e*e* *o*a**o* 15 segundos y 17478 Puntos [05:06] HipopotamoConPrisa
3 Pista: fede*i*o *i*e*e* *o*a**o* 15 segundos y 17478 Puntos
[05:06] Hipopotamo\Especial federico jjimenes losantos [05:06] Hipopotamo\Especial
federico jjimenes losantos
[05:06] HipopotamoConPrisa Tiempo! La respuesta es -> federico�imenez�osantos <- [05:06] HipopotamoConPrisa
Tiempo! La respuesta es -> federico�imenez�osantos <-
[05:06] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [05:06] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[05:06] HipopotamoConPrisa Tri.10827 CienciaɆilipides˿Aeronautica-1939:b߉ngenierokrusokemigradokacestadosbunidos,bconstuctorvdelkVS-300,bprimervhelic󰴥rokverdaderamentehoperativo?b?b [05:06] HipopotamoConPrisa
Tri.10827 CienciaɆilipides˿Aeronautica-1939:b߉ngenierokrusokemigradokacestadosbunidos,bconstuctorvdelkVS-300,bprimervhelic󰴥rokverdaderamentehoperativo?b?b
[05:06] HipopotamoConPrisa 1 Pista: **** ******** Valor pregunta : 11330 Puntos [05:06] HipopotamoConPrisa
1 Pista: **** ******** Valor pregunta : 11330 Puntos
[05:06] HipopotamoConPrisa 2 Pista: igo* ******** 30 segundos y 11330 Puntos [05:06] HipopotamoConPrisa
2 Pista: igo* ******** 30 segundos y 11330 Puntos
[05:06] HipopotamoConPrisa 3 Pista: igo* *i*o**** 15 segundos y 11330 Puntos [05:06] HipopotamoConPrisa
3 Pista: igo* *i*o**** 15 segundos y 11330 Puntos
[05:07] HipopotamoConPrisa Tiempo! La respuesta es -> igor�ikorsky <- [05:07] HipopotamoConPrisa
Tiempo! La respuesta es -> igor�ikorsky <-
[05:07] HipopotamoConPrisa This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [05:07] HipopotamoConPrisa
This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[05:07] HipopotamoConPrisa Tri.12051 Cotilleo-TVɖivian˿ApellidojdesKrustyfelppayasoj?m [05:07] HipopotamoConPrisa
Tri.12051 Cotilleo-TVɖivian˿ApellidojdesKrustyfelppayasoj?m
[05:07] HipopotamoConPrisa 1 Pista: ********** Valor pregunta : 16801 Puntos [05:07] HipopotamoConPrisa
1 Pista: ********** Valor pregunta : 16801 Puntos
[05:07] HipopotamoConPrisa 2 Pista: kru******* 30 segundos y 16801 Puntos [05:07] HipopotamoConPrisa
2 Pista: kru******* 30 segundos y 16801 Puntos
[05:07] HipopotamoConPrisa 3 Pista: kru**o**** 15 segundos y 16801 Puntos [05:07] HipopotamoConPrisa
3 Pista: kru**o**** 15 segundos y 16801 Puntos
[05:08] HipopotamoConPrisa Tiempo! La respuesta es -> krustovsky <- [05:08] HipopotamoConPrisa
Tiempo! La respuesta es -> krustovsky <-
[05:08] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [05:08] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[05:08] HipopotamoConPrisa Tri.17664 Geografiaɂatval˿AVIACION-NOMBREjDELjAEROPUERTOjDEjTRIESTEj?j [05:08] HipopotamoConPrisa
Tri.17664 Geografiaɂatval˿AVIACION-NOMBREjDELjAEROPUERTOjDEjTRIESTEj?j
[05:08] HipopotamoConPrisa 1 Pista: ****** *** ********* Pregunta de BONUS : 25000 Puntos [05:08] HipopotamoConPrisa
1 Pista: ****** *** ********* Pregunta de BONUS : 25000 Puntos
[05:08] HipopotamoConPrisa 2 Pista: ron*** *** ********* 30 segundos y 25000 Puntos [05:08] HipopotamoConPrisa
2 Pista: ron*** *** ********* 30 segundos y 25000 Puntos
[05:08] HipopotamoConPrisa 3 Pista: ron**i *ei *e*io*a*i 15 segundos y 25000 Puntos [05:08] HipopotamoConPrisa
3 Pista: ron**i *ei *e*io*a*i 15 segundos y 25000 Puntos
[05:09] HipopotamoConPrisa Tiempo! La respuesta es -> ronchi�ei�egionari <- [05:09] HipopotamoConPrisa
Tiempo! La respuesta es -> ronchi�ei�egionari <-
[05:09] HipopotamoConPrisa This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [05:09] HipopotamoConPrisa
This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[05:09] HipopotamoConPrisa Tri.6954 DeporteɔDI˿ApQUEpCONJUNTOpCEDIOpELpREALpMADRIDpApBETANCORTp?p [05:09] HipopotamoConPrisa
Tri.6954 DeporteɔDI˿ApQUEpCONJUNTOpCEDIOpELpREALpMADRIDpApBETANCORTp?p
[05:09] HipopotamoConPrisa 1 Pista: ********* ** ** ****񪠃 Valor pregunta : 16612 Puntos [05:09] HipopotamoConPrisa
1 Pista: ********* ** ** ****񪠃 Valor pregunta : 16612 Puntos
[05:09] HipopotamoConPrisa 2 Pista: dep****** ** ** ****񪠃 30 segundos y 16612 Puntos [05:09] HipopotamoConPrisa
2 Pista: dep****** ** ** ****񪠃 30 segundos y 16612 Puntos
[05:09] HipopotamoConPrisa �Increible!! Hipopotamo\Especial contest󺠃04"deportivo de la coru񡢃12 en �6.156 segundos, y ha ganado �6612�12 puntos [05:09] HipopotamoConPrisa
�Increible!! Hipopotamo\Especial contest󺠃04"deportivo de la coru񡢃12 en �6.156 segundos, y ha ganado �6612�12 puntos
[05:09] HipopotamoConPrisa Hipopotamo\Especial has acertado 35 seguidas!! Puntos HOY: 1687191, SEMANA: 13443305 y MES: 13443305 [05:09] HipopotamoConPrisa
Hipopotamo\Especial has acertado 35 seguidas!! Puntos HOY: 1687191, SEMANA: 13443305 y MES: 13443305
[05:09] HipopotamoConPrisa 35 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [05:09] HipopotamoConPrisa
35 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[05:09] Hipopotamo\Especial deportivo de la coru�a [05:09] Hipopotamo\Especial
deportivo de la coru�a
[05:09] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [05:09] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[05:09] HipopotamoConPrisa Tri.518 Cienciaɇlubin˿(Matematicas)tߣuantovesw7453tmultiplicadovpore9993tyrdivididoventrej3t?t [05:09] HipopotamoConPrisa
Tri.518 Cienciaɇlubin˿(Matematicas)tߣuantovesw7453tmultiplicadovpore9993tyrdivididoventrej3t?t
[05:09] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 13003 Puntos [05:09] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 13003 Puntos
[05:10] HipopotamoConPrisa 2 Pista: 248***** 30 segundos y 13003 Puntos [05:10] HipopotamoConPrisa
2 Pista: 248***** 30 segundos y 13003 Puntos
[05:10] HipopotamoConPrisa 3 Pista: 248***** 15 segundos y 13003 Puntos [05:10] HipopotamoConPrisa
3 Pista: 248***** 15 segundos y 13003 Puntos
[05:10] HipopotamoConPrisa Tiempo! La respuesta es -> 24825943 <- [05:10] HipopotamoConPrisa
Tiempo! La respuesta es -> 24825943 <-
[05:10] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [05:10] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[05:10] HipopotamoConPrisa Tri.17560 Musicaɴjmm.com˃orrienteddedlosp80spenllauquedsedencuadrabanlgrupospcomouKortatu,kLauPollauRecords,kEskorbuto....k?k [05:10] HipopotamoConPrisa
Tri.17560 Musicaɴjmm.com˃orrienteddedlosp80spenllauquedsedencuadrabanlgrupospcomouKortatu,kLauPollauRecords,kEskorbuto....k?k
[05:10] HipopotamoConPrisa 1 Pista: **** ******* ***** Valor pregunta : 18366 Puntos [05:10] HipopotamoConPrisa
1 Pista: **** ******* ***** Valor pregunta : 18366 Puntos
[05:11] HipopotamoConPrisa 2 Pista: roc* ******* ***** 30 segundos y 18366 Puntos [05:11] HipopotamoConPrisa
2 Pista: roc* ******* ***** 30 segundos y 18366 Puntos
[05:11] HipopotamoConPrisa 3 Pista: roc* *a*i*a* *a**o 15 segundos y 18366 Puntos [05:11] HipopotamoConPrisa
3 Pista: roc* *a*i*a* *a**o 15 segundos y 18366 Puntos
[05:11] HipopotamoConPrisa Tiempo! La respuesta es -> rock�adical�asco <- [05:11] HipopotamoConPrisa
Tiempo! La respuesta es -> rock�adical�asco <-
[05:11] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [05:11] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[05:11] HipopotamoConPrisa Tri.2925 CienciaɌOCUTUS˿Albyesotquerenxlaqnaturalezaqserencuentraqenxformaqcristalinaq(CaSO4)eserlerdenomina...e?e [05:11] HipopotamoConPrisa
Tri.2925 CienciaɌOCUTUS˿Albyesotquerenxlaqnaturalezaqserencuentraqenxformaqcristalinaq(CaSO4)eserlerdenomina...e?e
[05:11] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 19596 Puntos [05:11] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 19596 Puntos
[05:11] HipopotamoConPrisa 2 Pista: anh****** 30 segundos y 19596 Puntos [05:11] HipopotamoConPrisa
2 Pista: anh****** 30 segundos y 19596 Puntos
[05:12] HipopotamoConPrisa 3 Pista: anhi**i*a 15 segundos y 19596 Puntos [05:12] HipopotamoConPrisa
3 Pista: anhi**i*a 15 segundos y 19596 Puntos
[05:12] HipopotamoConPrisa �Suma y sigue Hipopotamo\Especial!! La respuesta: "anhidrita" incrementa tu marcador en �9596�12 puntos [05:12] HipopotamoConPrisa
�Suma y sigue Hipopotamo\Especial!! La respuesta: "anhidrita" incrementa tu marcador en �9596�12 puntos
[05:12] HipopotamoConPrisa Hipopotamo\Especial has acertado 36 seguidas!! Puntos HOY: 1706787, SEMANA: 13462901 y MES: 13462901 [05:12] HipopotamoConPrisa
Hipopotamo\Especial has acertado 36 seguidas!! Puntos HOY: 1706787, SEMANA: 13462901 y MES: 13462901
[05:12] HipopotamoConPrisa 36 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [05:12] HipopotamoConPrisa
36 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[05:12] Hipopotamo\Especial anhidrita [05:12] Hipopotamo\Especial
anhidrita
[05:12] HipopotamoConPrisa R᮫ing SEMANA: - #1: Hipopotamo\Especial 13462901 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [05:12] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Hipopotamo\Especial 13462901 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1631993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[05:12] HipopotamoConPrisa Tri.16791 MiscelaneaɔeLaRaNhA˿Alvcomerzywalvcagarz?j [05:12] HipopotamoConPrisa
Tri.16791 MiscelaneaɔeLaRaNhA˿Alvcomerzywalvcagarz?j
[05:12] HipopotamoConPrisa 1 Pista: ***** ** ** *** ** *** Valor pregunta : 15535 Puntos [05:12] HipopotamoConPrisa
1 Pista: ***** ** ** *** ** *** Valor pregunta : 15535 Puntos
[05:12] HipopotamoConPrisa 2 Pista: pri** ** ** *** ** *** 30 segundos y 15535 Puntos [05:12] HipopotamoConPrisa
2 Pista: pri** ** ** *** ** *** 30 segundos y 15535 Puntos
[05:12] HipopotamoConPrisa 3 Pista: pri*a *o *e *a* *e *a* 15 segundos y 15535 Puntos [05:12] HipopotamoConPrisa
3 Pista: pri*a *o *e *a* *e *a* 15 segundos y 15535 Puntos
[05:13] HipopotamoConPrisa Tiempo! La respuesta es -> prisa�o�e�as�e�ar <- [05:13] HipopotamoConPrisa
Tiempo! La respuesta es -> prisa�o�e�as�e�ar <-
[05:13] HipopotamoConPrisa We feature over 50,000 Q&A ! [05:13] HipopotamoConPrisa
We feature over 50,000 Q&A !
[05:13] HipopotamoConPrisa Tri.6603 Miscelaneaɥldanasˁviaci󮃰1i-gControles:gQuejinstrumentoldelbavionicontrolaklakprofundidad?g?g [05:13] HipopotamoConPrisa
Tri.6603 Miscelaneaɥldanasˁviaci󮃰1i-gControles:gQuejinstrumentoldelbavionicontrolaklakprofundidad?g?g
[05:13] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 11470 Puntos [05:13] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 11470 Puntos
[05:13] HipopotamoConPrisa 2 Pista: cue**** 30 segundos y 11470 Puntos [05:13] HipopotamoConPrisa
2 Pista: cue**** 30 segundos y 11470 Puntos
[05:13] HipopotamoConPrisa 3 Pista: cue**o* 15 segundos y 11470 Puntos [05:13] HipopotamoConPrisa
3 Pista: cue**o* 15 segundos y 11470 Puntos
[05:14] HipopotamoConPrisa Tiempo! La respuesta es -> cuernos <- [05:14] HipopotamoConPrisa
Tiempo! La respuesta es -> cuernos <-
[05:14] HipopotamoConPrisa Tri.3824 Cienciaɳtephenwo˿Elx"CharlottebDundas"hfuebelxprimero,hperoeeraqung...?"h?h [05:14] HipopotamoConPrisa
Tri.3824 Cienciaɳtephenwo˿Elx"CharlottebDundas"hfuebelxprimero,hperoeeraqung...?"h?h
[05:14] HipopotamoConPrisa 1 Pista: ***** ** ***** Valor pregunta : 10963 Puntos [05:14] HipopotamoConPrisa
1 Pista: ***** ** ***** Valor pregunta : 10963 Puntos
[05:14] HipopotamoConPrisa 2 Pista: bar** ** ***** 30 segundos y 10963 Puntos [05:14] HipopotamoConPrisa
2 Pista: bar** ** ***** 30 segundos y 10963 Puntos
[05:14] HipopotamoConPrisa 3 Pista: bar*o *e *a*o* 15 segundos y 10963 Puntos [05:14] HipopotamoConPrisa
3 Pista: bar*o *e *a*o* 15 segundos y 10963 Puntos
[05:15] HipopotamoConPrisa Tiempo! La respuesta es -> barco�e�apor <- [05:15] HipopotamoConPrisa
Tiempo! La respuesta es -> barco�e�apor <-
[05:15] HipopotamoConPrisa Tri.20890 Mitologiaɭalila˿DEuDӎDEuZARPӃ01uLAuEXPEDICIӎuDEuLOSuARGONAUTASu?u [05:15] HipopotamoConPrisa
Tri.20890 Mitologiaɭalila˿DEuDӎDEuZARPӃ01uLAuEXPEDICIӎuDEuLOSuARGONAUTASu?u
[05:15] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 7888 Puntos [05:15] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 7888 Puntos
[05:15] HipopotamoConPrisa 2 Pista: yol** 30 segundos y 7888 Puntos [05:15] HipopotamoConPrisa
2 Pista: yol** 30 segundos y 7888 Puntos
[05:15] HipopotamoConPrisa 3 Pista: yol*o 15 segundos y 7888 Puntos [05:15] HipopotamoConPrisa
3 Pista: yol*o 15 segundos y 7888 Puntos
[05:15] HipopotamoConPrisa �Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "yolco" era la respuesta? Venga, �888�12 puntos suben a tu marcador [05:15] HipopotamoConPrisa
�Est᳠que lo tiras Hipopotamo\Especial!! ߃󭯠supiste que "yolco" era la respuesta? Venga, �888�12 puntos suben a tu marcador
[05:15] HipopotamoConPrisa Hipopotamo\Especial has acertado 37 seguidas!! Puntos HOY: 1714675, SEMANA: 13470789 y MES: 13470789 [05:15] HipopotamoConPrisa
Hipopotamo\Especial has acertado 37 seguidas!! Puntos HOY: 1714675, SEMANA: 13470789 y MES: 13470789
[05:15] HipopotamoConPrisa 37 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!? [05:15] HipopotamoConPrisa
37 in a Row !!! I Think that Hipopotamo\Especial is HOGGING the Quiz !!! Is Everybody Asleep!?
[05:15] Hipopotamo\Especial yolco [05:15] Hipopotamo\Especial
yolco
[05:15] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [05:15] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[05:15] HipopotamoConPrisa Tri.7983 CienciaɊAVEA˿7ySEPTIEMBREyDEy1910:yQUEyLOGRAyAISLARyMARIyCURIEy?y [05:15] HipopotamoConPrisa
Tri.7983 CienciaɊAVEA˿7ySEPTIEMBREyDEy1910:yQUEyLOGRAyAISLARyMARIyCURIEy?y
[05:15] HipopotamoConPrisa 1 Pista: ** ***** Pregunta de BONUS : 25000 Puntos [05:15] HipopotamoConPrisa
1 Pista: ** ***** Pregunta de BONUS : 25000 Puntos
[05:16] HipopotamoConPrisa 2 Pista: el�**** 30 segundos y 25000 Puntos [05:16] HipopotamoConPrisa
2 Pista: el�**** 30 segundos y 25000 Puntos
[05:16] HipopotamoConPrisa 3 Pista: el�a*io 15 segundos y 25000 Puntos [05:16] HipopotamoConPrisa
3 Pista: el�a*io 15 segundos y 25000 Puntos
[05:16] Oveja\Suave El radio [05:16] Oveja\Suave
El radio
[05:16] HipopotamoConPrisa �Enhorabuena Oveja\Suave!! Has contestado "El radio" y por ello has ganado �5000�12 puntos [05:16] HipopotamoConPrisa
�Enhorabuena Oveja\Suave!! Has contestado "El radio" y por ello has ganado �5000�12 puntos
[05:16] HipopotamoConPrisa ACTION awards Oveja\Suave with a +v for having over 15000 points [05:16] HipopotamoConPrisa
ACTION awards Oveja\Suave with a +v for having over 15000 points
[05:16] HipopotamoConPrisa Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 33427, SEMANA: 1656993 y MES: 1656993 [05:16] HipopotamoConPrisa
Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 33427, SEMANA: 1656993 y MES: 1656993
[05:16] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [05:16] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[05:16] HipopotamoConPrisa Tri.15764 LiteraturaɂRUJI˿COMPOSICIONmENmQUEmSEmELOGIAmAmALGUIENm?m [05:16] HipopotamoConPrisa
Tri.15764 LiteraturaɂRUJI˿COMPOSICIONmENmQUEmSEmELOGIAmAmALGUIENm?m
[05:16] HipopotamoConPrisa 1 Pista: ********** Valor pregunta : 14268 Puntos [05:16] HipopotamoConPrisa
1 Pista: ********** Valor pregunta : 14268 Puntos
[05:16] HipopotamoConPrisa 2 Pista: pan******* 30 segundos y 14268 Puntos [05:16] HipopotamoConPrisa
2 Pista: pan******* 30 segundos y 14268 Puntos
[05:17] HipopotamoConPrisa 3 Pista: pane*i*i*o 15 segundos y 14268 Puntos [05:17] HipopotamoConPrisa
3 Pista: pane*i*i*o 15 segundos y 14268 Puntos
[05:17] HipopotamoConPrisa Tiempo! La respuesta es -> panegirico <- [05:17] HipopotamoConPrisa
Tiempo! La respuesta es -> panegirico <-
[05:17] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [05:17] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[05:17] HipopotamoConPrisa Tri.4043 Politicaɭ˿Deyqu郰1xciudadnalemanapfueyalcaldeyWillymBrandtwantesudeyserccancillerc?x [05:17] HipopotamoConPrisa
Tri.4043 Politicaɭ˿Deyqu郰1xciudadnalemanapfueyalcaldeyWillymBrandtwantesudeyserccancillerc?x
[05:17] HipopotamoConPrisa 1 Pista: ****** Valor pregunta : 12258 Puntos [05:17] HipopotamoConPrisa
1 Pista: ****** Valor pregunta : 12258 Puntos
[05:17] HipopotamoConPrisa 2 Pista: ber*** 30 segundos y 12258 Puntos [05:17] HipopotamoConPrisa
2 Pista: ber*** 30 segundos y 12258 Puntos
[05:18] HipopotamoConPrisa �Bien Hipopotamo\Especial!! Tu respuesta: "berlin" es correcta y ganas �2258�12 puntos [05:18] HipopotamoConPrisa
�Bien Hipopotamo\Especial!! Tu respuesta: "berlin" es correcta y ganas �2258�12 puntos
[05:18] HipopotamoConPrisa Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 1726933, SEMANA: 13483047 y MES: 13483047 [05:18] HipopotamoConPrisa
Hipopotamo\Especial has acertado 1 seguidas!! Puntos HOY: 1726933, SEMANA: 13483047 y MES: 13483047
[05:18] Hipopotamo\Especial berlin [05:18] Hipopotamo\Especial
berlin
[05:18] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [05:18] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[05:18] HipopotamoConPrisa Tri.9845 Cotilleo-TVɡnghara˿C󭯃01kseellamaalaahijaaadoptivaadeeJoseeOrtegaaCanok?j [05:18] HipopotamoConPrisa
Tri.9845 Cotilleo-TVɡnghara˿C󭯃01kseellamaalaahijaaadoptivaadeeJoseeOrtegaaCanok?j
[05:18] HipopotamoConPrisa 1 Pista: ****** ****** Valor pregunta : 19261 Puntos [05:18] HipopotamoConPrisa
1 Pista: ****** ****** Valor pregunta : 19261 Puntos
[05:18] HipopotamoConPrisa 2 Pista: glo*** ****** 30 segundos y 19261 Puntos [05:18] HipopotamoConPrisa
2 Pista: glo*** ****** 30 segundos y 19261 Puntos
[05:18] Oveja\Suave Gloria Ortega [05:18] Oveja\Suave
Gloria Ortega
[05:18] HipopotamoConPrisa 3 Pista: glo*ia *a*i*a 15 segundos y 19261 Puntos [05:18] HipopotamoConPrisa
3 Pista: glo*ia *a*i*a 15 segundos y 19261 Puntos
[05:18] HipopotamoConPrisa Tiempo! La respuesta es -> gloria�amila <- [05:18] HipopotamoConPrisa
Tiempo! La respuesta es -> gloria�amila <-
[05:19] HipopotamoConPrisa For The Competitive Edge type !pingme [05:19] HipopotamoConPrisa
For The Competitive Edge type !pingme
[05:19] HipopotamoConPrisa Tri.2657 Fisica-QuimicaɐiNKiTa˿ALEACIONqDEqMERCURIOqCONqOTROqMETALq?q [05:19] HipopotamoConPrisa
Tri.2657 Fisica-QuimicaɐiNKiTa˿ALEACIONqDEqMERCURIOqCONqOTROqMETALq?q
[05:19] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 7291 Puntos [05:19] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 7291 Puntos
[05:19] HipopotamoConPrisa 2 Pista: ama***** 30 segundos y 7291 Puntos [05:19] HipopotamoConPrisa
2 Pista: ama***** 30 segundos y 7291 Puntos
[05:19] HipopotamoConPrisa 3 Pista: ama**a*a 15 segundos y 7291 Puntos [05:19] HipopotamoConPrisa
3 Pista: ama**a*a 15 segundos y 7291 Puntos
[05:19] HipopotamoConPrisa �Increible!! Hipopotamo\Especial contest󺠃04"amalgama" en �4.437 segundos, y ha ganado �291�12 puntos [05:19] HipopotamoConPrisa
�Increible!! Hipopotamo\Especial contest󺠃04"amalgama" en �4.437 segundos, y ha ganado �291�12 puntos
[05:19] HipopotamoConPrisa Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 1734224, SEMANA: 13490338 y MES: 13490338 [05:19] HipopotamoConPrisa
Hipopotamo\Especial has acertado 2 seguidas!! Puntos HOY: 1734224, SEMANA: 13490338 y MES: 13490338
[05:19] Hipopotamo\Especial amalgama [05:19] Hipopotamo\Especial
amalgama
[05:19] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [05:19] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[05:19] HipopotamoConPrisa Tri.17388 Cotilleo-TVɂRUJI˿DIBUJOS:eCOMOeLEeLLAMANeALe"JEFE"eDELePATIOe(LAeBANDAeDELePATIO)"e?e [05:19] HipopotamoConPrisa
Tri.17388 Cotilleo-TVɂRUJI˿DIBUJOS:eCOMOeLEeLLAMANeALe"JEFE"eDELePATIOe(LAeBANDAeDELePATIO)"e?e
[05:19] HipopotamoConPrisa 1 Pista: *** *** Valor pregunta : 6478 Puntos [05:19] HipopotamoConPrisa
1 Pista: *** *** Valor pregunta : 6478 Puntos
[05:20] HipopotamoConPrisa 2 Pista: rey *** 30 segundos y 6478 Puntos [05:20] HipopotamoConPrisa
2 Pista: rey *** 30 segundos y 6478 Puntos
[05:20] Oveja\Suave Rey feo [05:20] Oveja\Suave
Rey feo
[05:20] Oveja\Suave 😂 [05:20] Oveja\Suave
😂
[05:20] HipopotamoConPrisa 3 Pista: rey *o* 15 segundos y 6478 Puntos [05:20] HipopotamoConPrisa
3 Pista: rey *o* 15 segundos y 6478 Puntos
[05:20] Oveja\Suave Rey roy [05:20] Oveja\Suave
Rey roy
[05:20] HipopotamoConPrisa Tiempo! La respuesta es -> rey�ob <- [05:20] HipopotamoConPrisa
Tiempo! La respuesta es -> rey�ob <-
[05:20] HipopotamoConPrisa R᮫ing MES: - #1: Hipopotamo\Especial 13490338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1656993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [05:20] HipopotamoConPrisa
R᮫ing MES: - #1: Hipopotamo\Especial 13490338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1656993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 878803 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[05:20] HipopotamoConPrisa Tri.8091 CineɔeLaRaNhA˿BSOn-nQUIENnCOMPUSOnLAnBSOnDEn"ELnHOMBREnDEnALCATRAZ"n(1962)nYn"VALORnDEnLEY"n(1969)?n?n [05:20] HipopotamoConPrisa
Tri.8091 CineɔeLaRaNhA˿BSOn-nQUIENnCOMPUSOnLAnBSOnDEn"ELnHOMBREnDEnALCATRAZ"n(1962)nYn"VALORnDEnLEY"n(1969)?n?n
[05:20] HipopotamoConPrisa 1 Pista: ***** ********* Valor pregunta : 24032 Puntos [05:20] HipopotamoConPrisa
1 Pista: ***** ********* Valor pregunta : 24032 Puntos
[05:21] HipopotamoConPrisa 2 Pista: elm** ********* 30 segundos y 24032 Puntos [05:21] HipopotamoConPrisa
2 Pista: elm** ********* 30 segundos y 24032 Puntos
[05:21] HipopotamoConPrisa 3 Pista: elme* *e****ei* 15 segundos y 24032 Puntos [05:21] HipopotamoConPrisa
3 Pista: elme* *e****ei* 15 segundos y 24032 Puntos
[05:21] Hipopotamo\Especial !Stats [05:21] Hipopotamo\Especial
!Stats
[05:21] Cobaya}Breve Realización de estadísticas en curso. Solicitadas por: Hipopotamo\Especial. [05:21] Cobaya}Breve
Realización de estadísticas en curso. Solicitadas por: Hipopotamo\Especial.
[05:21] HipopotamoConPrisa Tiempo! La respuesta es -> elmer�ernstein <- [05:21] HipopotamoConPrisa
Tiempo! La respuesta es -> elmer�ernstein <-
[05:21] Cobaya}Breve Resumen de estadísticas - Los que más han escrito hoy -> HipopotamoConPrisa ( 1352 ), Hipopotamo\Especial ( 100), Lince{Torpe ( 68), Mosca{ConInquietud ( 32), Oveja\Suave ( 10), Oveja-DelMonton_ ( 4), Valentina_-_23 ( 3), elvigilante ( 1), Oso_Insufrible ( 1), hola_HispachatApp ( 1 ) [05:21] Cobaya}Breve
Resumen de estadísticas - Los que más han escrito hoy -> HipopotamoConPrisa ( 1352 ), Hipopotamo\Especial ( 100), Lince{Torpe ( 68), Mosca{ConInquietud ( 32), Oveja\Suave ( 10), Oveja-DelMonton_ ( 4), Valentina_-_23 ( 3), elvigilante ( 1), Oso_Insufrible ( 1), hola_HispachatApp ( 1 )
[05:21] Cobaya}Breve Estadísticas actualizadas por Hipopotamo\Especial. Visite las estadísticas en https://www.winstats.es/stats/mexico.html [05:21] Cobaya}Breve
Estadísticas actualizadas por Hipopotamo\Especial. Visite las estadísticas en https://www.winstats.es/stats/mexico.html
[05:21] HipopotamoConPrisa Please refrain from using Extreme Bad Language [05:21] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[05:21] HipopotamoConPrisa Tri.17108 GeografiaɍARdeJAVA˿ENeQUɃ01eESTADOeINDIOeSEeENCUENTRAeLAeCIUDADeDEeJAIPUR,eSIENDOeADEM�eSUeCAPITAL?e?e [05:21] HipopotamoConPrisa
Tri.17108 GeografiaɍARdeJAVA˿ENeQUɃ01eESTADOeINDIOeSEeENCUENTRAeLAeCIUDADeDEeJAIPUR,eSIENDOeADEM�eSUeCAPITAL?e?e
[05:21] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 15249 Puntos [05:21] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 15249 Puntos
[05:22] HipopotamoConPrisa 2 Pista: raj***** 30 segundos y 15249 Puntos [05:22] HipopotamoConPrisa
2 Pista: raj***** 30 segundos y 15249 Puntos
[05:22] HipopotamoConPrisa 3 Pista: raja**a* 15 segundos y 15249 Puntos [05:22] HipopotamoConPrisa
3 Pista: raja**a* 15 segundos y 15249 Puntos
[05:22] HipopotamoConPrisa Tiempo! La respuesta es -> rajastan <- [05:22] HipopotamoConPrisa
Tiempo! La respuesta es -> rajastan <-
[05:22] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [05:22] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[05:22] HipopotamoConPrisa Tri.3739 Gastronomiaɓort˿DEeDONDEeSONeTIPICOSeLOSeROBIOLSe?e [05:22] HipopotamoConPrisa
Tri.3739 Gastronomiaɓort˿DEeDONDEeSONeTIPICOSeLOSeROBIOLSe?e
[05:22] HipopotamoConPrisa 1 Pista: ******** Pregunta de BONUS : 25000 Puntos [05:22] HipopotamoConPrisa
1 Pista: ******** Pregunta de BONUS : 25000 Puntos
[05:22] HipopotamoConPrisa 2 Pista: bal***** 30 segundos y 25000 Puntos [05:22] HipopotamoConPrisa
2 Pista: bal***** 30 segundos y 25000 Puntos
[05:23] Oveja\Suave Balderas [05:23] Oveja\Suave
Balderas
[05:23] Hipopotamo\Especial baleares [05:23] Hipopotamo\Especial
baleares
[05:23] HipopotamoConPrisa �Enhorabuena Hipopotamo\Especial!! Has contestado "baleares" y por ello has ganado �5000�12 puntos [05:23] HipopotamoConPrisa
�Enhorabuena Hipopotamo\Especial!! Has contestado "baleares" y por ello has ganado �5000�12 puntos
[05:23] HipopotamoConPrisa Hipopotamo\Especial has acertado 3 seguidas!! Puntos HOY: 1759224, SEMANA: 13515338 y MES: 13515338 [05:23] HipopotamoConPrisa
Hipopotamo\Especial has acertado 3 seguidas!! Puntos HOY: 1759224, SEMANA: 13515338 y MES: 13515338
[05:23] Oveja\Suave 😅 [05:23] Oveja\Suave
😅
[05:23] HipopotamoConPrisa This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [05:23] HipopotamoConPrisa
This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[05:23] HipopotamoConPrisa Tri.3012 Arteɂuzzati˿FUEtELtM�tCɌEBREtDISC͐ULOtDEtRUBENStYtUNOtDEtLOStMEJOREStRETRATISTAStDEtLAtHISTORIAtDEtLAtPINTURAt(NOMBREtYtAPELLIDO)t?t [05:23] HipopotamoConPrisa
Tri.3012 Arteɂuzzati˿FUEtELtM�tCɌEBREtDISC͐ULOtDEtRUBENStYtUNOtDEtLOStMEJOREStRETRATISTAStDEtLAtHISTORIAtDEtLAtPINTURAt(NOMBREtYtAPELLIDO)t?t
[05:23] HipopotamoConPrisa 1 Pista: ***** *** **** Pregunta de BONUS : 100000 Puntos [05:23] HipopotamoConPrisa
1 Pista: ***** *** **** Pregunta de BONUS : 100000 Puntos
[05:23] HipopotamoConPrisa 2 Pista: ant** *** **** 30 segundos y 100000 Puntos [05:23] HipopotamoConPrisa
2 Pista: ant** *** **** 30 segundos y 100000 Puntos
[05:23] HipopotamoConPrisa 3 Pista: anto* *a* **** 15 segundos y 100000 Puntos [05:23] HipopotamoConPrisa
3 Pista: anto* *a* **** 15 segundos y 100000 Puntos
[05:24] HipopotamoConPrisa Tiempo! La respuesta es -> anton�an�yck <- [05:24] HipopotamoConPrisa
Tiempo! La respuesta es -> anton�an�yck <-
[05:24] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [05:24] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[05:24] HipopotamoConPrisa Tri.10419 Biologiaɓheva˿ComogseallamaalaafamiliaavegetalevivaamaslantiguaadealaaTierra,jqueaapenaslhaaevolucionadogdesdeaentoncesl?j [05:24] HipopotamoConPrisa
Tri.10419 Biologiaɓheva˿ComogseallamaalaafamiliaavegetalevivaamaslantiguaadealaaTierra,jqueaapenaslhaaevolucionadogdesdeaentoncesl?j
[05:24] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 20428 Puntos [05:24] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 20428 Puntos
[05:24] HipopotamoConPrisa 2 Pista: hep****** 30 segundos y 20428 Puntos [05:24] HipopotamoConPrisa
2 Pista: hep****** 30 segundos y 20428 Puntos
[05:24] HipopotamoConPrisa 3 Pista: hepa*i*a* 15 segundos y 20428 Puntos [05:24] HipopotamoConPrisa
3 Pista: hepa*i*a* 15 segundos y 20428 Puntos
[05:24] HipopotamoConPrisa Tiempo! La respuesta es -> hepaticas <- [05:24] HipopotamoConPrisa
Tiempo! La respuesta es -> hepaticas <-
[05:25] HipopotamoConPrisa This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [05:25] HipopotamoConPrisa
This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[05:25] HipopotamoConPrisa Tri.9478 Gastronomiaɐsico666˰latillowtipicowdewNigeriaxelaboradowconumandiocaxow񡭥wmolidosj?o [05:25] HipopotamoConPrisa
Tri.9478 Gastronomiaɐsico666˰latillowtipicowdewNigeriaxelaboradowconumandiocaxow񡭥wmolidosj?o
[05:25] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 6807 Puntos [05:25] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 6807 Puntos
[05:25] HipopotamoConPrisa 2 Pista: fuf* 30 segundos y 6807 Puntos [05:25] HipopotamoConPrisa
2 Pista: fuf* 30 segundos y 6807 Puntos
[05:25] Hipopotamo\Insufrible Fufu [05:25] Hipopotamo\Insufrible
Fufu
[05:25] HipopotamoConPrisa �Muy bien Hipopotamo\Insufrible!! Acertaste "Fufu" en tan s󬯠�4.047 segundos y por eso has ganado: �807�12 puntos [05:25] HipopotamoConPrisa
�Muy bien Hipopotamo\Insufrible!! Acertaste "Fufu" en tan s󬯠�4.047 segundos y por eso has ganado: �807�12 puntos
[05:25] HipopotamoConPrisa ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points [05:25] HipopotamoConPrisa
ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points
[05:25] HipopotamoConPrisa Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 6807, SEMANA: 885610 y MES: 885610 [05:25] HipopotamoConPrisa
Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 6807, SEMANA: 885610 y MES: 885610
[05:25] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [05:25] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[05:25] HipopotamoConPrisa Tri.7637 Idiomasɲaziel9˿FRANCES--->ESPA񏌺donneraunhcoupqdenmainh?j [05:25] HipopotamoConPrisa
Tri.7637 Idiomasɲaziel9˿FRANCES--->ESPA񏌺donneraunhcoupqdenmainh?j
[05:25] HipopotamoConPrisa 1 Pista: ***** *** **** Pregunta de BONUS : 50000 Puntos [05:25] HipopotamoConPrisa
1 Pista: ***** *** **** Pregunta de BONUS : 50000 Puntos
[05:25] HipopotamoConPrisa 2 Pista: ech** *** **** 30 segundos y 50000 Puntos [05:25] HipopotamoConPrisa
2 Pista: ech** *** **** 30 segundos y 50000 Puntos
[05:26] HipopotamoConPrisa 3 Pista: echa* u*a *a*o 15 segundos y 50000 Puntos [05:26] HipopotamoConPrisa
3 Pista: echa* u*a *a*o 15 segundos y 50000 Puntos
[05:26] Gata_Elocuente DJ "elvigilante" cierra peticiones [05:26] Gata_Elocuente
DJ "elvigilante" cierra peticiones
[05:26] HipopotamoConPrisa Tiempo! La respuesta es -> echar�na�ano <- [05:26] HipopotamoConPrisa
Tiempo! La respuesta es -> echar�na�ano <-
[05:26] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [05:26] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[05:26] HipopotamoConPrisa Tri.20121 Gastronomiaɔruchi˿Cu᮴osehuevosehacenrfaltalcomomm�momparalhacerhunalmahonesal?f [05:26] HipopotamoConPrisa
Tri.20121 Gastronomiaɔruchi˿Cu᮴osehuevosehacenrfaltalcomomm�momparalhacerhunalmahonesal?f
[05:26] HipopotamoConPrisa 1 Pista: *** Valor pregunta : 10061 Puntos [05:26] HipopotamoConPrisa
1 Pista: *** Valor pregunta : 10061 Puntos
[05:26] HipopotamoConPrisa 2 Pista: uno 30 segundos y 10061 Puntos [05:26] HipopotamoConPrisa
2 Pista: uno 30 segundos y 10061 Puntos
[05:27] HipopotamoConPrisa 3 Pista: uno 15 segundos y 10061 Puntos [05:27] HipopotamoConPrisa
3 Pista: uno 15 segundos y 10061 Puntos
[05:27] HipopotamoConPrisa Tiempo! La respuesta es -> uno <- [05:27] HipopotamoConPrisa
Tiempo! La respuesta es -> uno <-
[05:27] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [05:27] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[05:27] HipopotamoConPrisa Tri.15630 Deporteɲaziel9˿BALONCESTO:QUEdJUGADORdTIENEdELdRECORDdDEdASISTENCIASdENdLAdHISTORIAdDEdLAdLIGAdACB(2003)?d?d [05:27] HipopotamoConPrisa
Tri.15630 Deporteɲaziel9˿BALONCESTO:QUEdJUGADORdTIENEdELdRECORDdDEdASISTENCIASdENdLAdHISTORIAdDEdLAdLIGAdACB(2003)?d?d
[05:27] HipopotamoConPrisa 1 Pista: ***** **** Valor pregunta : 5852 Puntos [05:27] HipopotamoConPrisa
1 Pista: ***** **** Valor pregunta : 5852 Puntos
[05:27] HipopotamoConPrisa 2 Pista: pab** **** 30 segundos y 5852 Puntos [05:27] HipopotamoConPrisa
2 Pista: pab** **** 30 segundos y 5852 Puntos
[05:28] HipopotamoConPrisa 3 Pista: pab*o *a*o 15 segundos y 5852 Puntos [05:28] HipopotamoConPrisa
3 Pista: pab*o *a*o 15 segundos y 5852 Puntos
[05:28] HipopotamoConPrisa Tiempo! La respuesta es -> pablo�aso <- [05:28] HipopotamoConPrisa
Tiempo! La respuesta es -> pablo�aso <-
[05:28] HipopotamoConPrisa R᮫ing SEMANA: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1656993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 885610 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [05:28] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1656993 #5: siva- 1210919 #6: Hipopotamo\Insufrible 885610 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[05:28] HipopotamoConPrisa Tri.9658 Medicina-Saludɲaziel9˿COMOmSEmLLAMAmELmMIEDOmAmLAmRISAm?m [05:28] HipopotamoConPrisa
Tri.9658 Medicina-Saludɲaziel9˿COMOmSEmLLAMAmELmMIEDOmAmLAmRISAm?m
[05:28] HipopotamoConPrisa 1 Pista: ********** Valor pregunta : 23387 Puntos [05:28] HipopotamoConPrisa
1 Pista: ********** Valor pregunta : 23387 Puntos
[05:28] Gata_Elocuente 📻 Finalizando emisión. Vuelve el AutoDJ. [05:28] Gata_Elocuente
📻 Finalizando emisión. Vuelve el AutoDJ.
[05:28] HipopotamoConPrisa 2 Pista: gel******* 30 segundos y 23387 Puntos [05:28] HipopotamoConPrisa
2 Pista: gel******* 30 segundos y 23387 Puntos
[05:28] HipopotamoConPrisa 3 Pista: gelio*o*ia 15 segundos y 23387 Puntos [05:28] HipopotamoConPrisa
3 Pista: gelio*o*ia 15 segundos y 23387 Puntos
[05:29] Oveja\Suave Geliofobia [05:29] Oveja\Suave
Geliofobia
[05:29] HipopotamoConPrisa �Suma y sigue Oveja\Suave!! La respuesta: "Geliofobia" incrementa tu marcador en �3387�12 puntos [05:29] HipopotamoConPrisa
�Suma y sigue Oveja\Suave!! La respuesta: "Geliofobia" incrementa tu marcador en �3387�12 puntos
[05:29] HipopotamoConPrisa ACTION awards Oveja\Suave with a +v for having over 15000 points [05:29] HipopotamoConPrisa
ACTION awards Oveja\Suave with a +v for having over 15000 points
[05:29] HipopotamoConPrisa Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 56814, SEMANA: 1680380 y MES: 1680380 [05:29] HipopotamoConPrisa
Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 56814, SEMANA: 1680380 y MES: 1680380
[05:29] HipopotamoConPrisa We feature over 50,000 Q&A ! [05:29] HipopotamoConPrisa
We feature over 50,000 Q&A !
[05:29] HipopotamoConPrisa Tri.19440 Deporteɭartuniki˿JUGADORtMaStJOVENtQUEtGANowELtMASTERtDEtAUGUSTAt?t [05:29] HipopotamoConPrisa
Tri.19440 Deporteɭartuniki˿JUGADORtMaStJOVENtQUEtGANowELtMASTERtDEtAUGUSTAt?t
[05:29] HipopotamoConPrisa 1 Pista: ***** ***** Valor pregunta : 14543 Puntos [05:29] HipopotamoConPrisa
1 Pista: ***** ***** Valor pregunta : 14543 Puntos
[05:29] HipopotamoConPrisa 2 Pista: tig** ***** 30 segundos y 14543 Puntos [05:29] HipopotamoConPrisa
2 Pista: tig** ***** 30 segundos y 14543 Puntos
[05:29] HipopotamoConPrisa 3 Pista: tige* *oo** 15 segundos y 14543 Puntos [05:29] HipopotamoConPrisa
3 Pista: tige* *oo** 15 segundos y 14543 Puntos
[05:29] Hipopotamo\Insufrible Tiger woods [05:29] Hipopotamo\Insufrible
Tiger woods
[05:29] HipopotamoConPrisa �Ol頃04Hipopotamo\Insufrible!! Has contestado: "Tiger woods" en �4.609 segundos y sumas �4543�12 puntos a tu marcador. �Sigue as� [05:29] HipopotamoConPrisa
�Ol頃04Hipopotamo\Insufrible!! Has contestado: "Tiger woods" en �4.609 segundos y sumas �4543�12 puntos a tu marcador. �Sigue as�
[05:29] HipopotamoConPrisa ACTION Aplausos Hipopotamo\Insufrible una Pepsi y pizza por 900000 victorias!! Ole Hipopotamo\Insufrible!!! [05:29] HipopotamoConPrisa
ACTION Aplausos Hipopotamo\Insufrible una Pepsi y pizza por 900000 victorias!! Ole Hipopotamo\Insufrible!!!
[05:29] HipopotamoConPrisa ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points [05:29] HipopotamoConPrisa
ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points
[05:29] HipopotamoConPrisa Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 21350, SEMANA: 900153 y MES: 900153 [05:29] HipopotamoConPrisa
Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 21350, SEMANA: 900153 y MES: 900153
[05:30] HipopotamoConPrisa Tri.3538 Geografiaɣarlovigo˿EnfqueepaiswpodriamoswverilaaRocaaAyersw?z [05:30] HipopotamoConPrisa
Tri.3538 Geografiaɣarlovigo˿EnfqueepaiswpodriamoswverilaaRocaaAyersw?z
[05:30] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 20372 Puntos [05:30] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 20372 Puntos
[05:30] HipopotamoConPrisa 2 Pista: aus****** 30 segundos y 20372 Puntos [05:30] HipopotamoConPrisa
2 Pista: aus****** 30 segundos y 20372 Puntos
[05:30] Oveja\Suave Australia [05:30] Oveja\Suave
Australia
[05:30] HipopotamoConPrisa �Bingo!! Oveja\Suave dio la respuesta: "Australia" en �7.11 segundos e incrementa sus ganancias con �0372�12 puntos [05:30] HipopotamoConPrisa
�Bingo!! Oveja\Suave dio la respuesta: "Australia" en �7.11 segundos e incrementa sus ganancias con �0372�12 puntos
[05:30] HipopotamoConPrisa ACTION awards Oveja\Suave with a +v for having over 15000 points [05:30] HipopotamoConPrisa
ACTION awards Oveja\Suave with a +v for having over 15000 points
[05:30] HipopotamoConPrisa Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 77186, SEMANA: 1700752 y MES: 1700752 [05:30] HipopotamoConPrisa
Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 77186, SEMANA: 1700752 y MES: 1700752
[05:30] HipopotamoConPrisa Tri.19725 Personajesɤisney˿(Dibujos)߃u᮴oshcompa񥲯shten�01yQuasimodox(engletra)?t?t [05:30] HipopotamoConPrisa
Tri.19725 Personajesɤisney˿(Dibujos)߃u᮴oshcompa񥲯shten�01yQuasimodox(engletra)?t?t
[05:30] HipopotamoConPrisa 1 Pista: **** Valor pregunta : 11100 Puntos [05:30] HipopotamoConPrisa
1 Pista: **** Valor pregunta : 11100 Puntos
[05:30] HipopotamoConPrisa 2 Pista: tre* 30 segundos y 11100 Puntos [05:30] HipopotamoConPrisa
2 Pista: tre* 30 segundos y 11100 Puntos
[05:30] HipopotamoConPrisa �As�e hace Hipopotamo\Insufrible!! Contestaste "Tres" en �9.859 segundos y sumas �1100�12 puntos [05:30] HipopotamoConPrisa
�As�e hace Hipopotamo\Insufrible!! Contestaste "Tres" en �9.859 segundos y sumas �1100�12 puntos
[05:30] HipopotamoConPrisa ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points [05:30] HipopotamoConPrisa
ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points
[05:30] HipopotamoConPrisa Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 32450, SEMANA: 911253 y MES: 911253 [05:30] HipopotamoConPrisa
Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 32450, SEMANA: 911253 y MES: 911253
[05:30] Hipopotamo\Insufrible Tres [05:30] Hipopotamo\Insufrible
Tres
[05:31] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [05:31] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[05:31] HipopotamoConPrisa Tri.14261 Musicaɴjmm.com˿Enxlosniniciosn(a񯳃01n60)rdeqqu郰1rcorrienteqmusicalzfueronxfigurasnclaveqTerrywRileywywLauMonteqYoungt?r [05:31] HipopotamoConPrisa
Tri.14261 Musicaɴjmm.com˿Enxlosniniciosn(a񯳃01n60)rdeqqu郰1rcorrienteqmusicalzfueronxfigurasnclaveqTerrywRileywywLauMonteqYoungt?r
[05:31] HipopotamoConPrisa 1 Pista: *********** Valor pregunta : 15926 Puntos [05:31] HipopotamoConPrisa
1 Pista: *********** Valor pregunta : 15926 Puntos
[05:31] HipopotamoConPrisa 2 Pista: min******** 30 segundos y 15926 Puntos [05:31] HipopotamoConPrisa
2 Pista: min******** 30 segundos y 15926 Puntos
[05:31] HipopotamoConPrisa 3 Pista: mini*a*i**o 15 segundos y 15926 Puntos [05:31] HipopotamoConPrisa
3 Pista: mini*a*i**o 15 segundos y 15926 Puntos
[05:31] HipopotamoConPrisa Tiempo! La respuesta es -> minimalismo <- [05:31] HipopotamoConPrisa
Tiempo! La respuesta es -> minimalismo <-
[05:32] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [05:32] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[05:32] HipopotamoConPrisa Tri.11721 PersonajesɈdosO˿CUALvESvELvNOMBREvDELvTOREROvESPARTACOv?v [05:32] HipopotamoConPrisa
Tri.11721 PersonajesɈdosO˿CUALvESvELvNOMBREvDELvTOREROvESPARTACOv?v
[05:32] HipopotamoConPrisa 1 Pista: **** ******* **** Valor pregunta : 15567 Puntos [05:32] HipopotamoConPrisa
1 Pista: **** ******* **** Valor pregunta : 15567 Puntos
[05:32] HipopotamoConPrisa 2 Pista: jua* ******* **** 30 segundos y 15567 Puntos [05:32] HipopotamoConPrisa
2 Pista: jua* ******* **** 30 segundos y 15567 Puntos
[05:32] HipopotamoConPrisa 3 Pista: jua* a**o*io *ui* 15 segundos y 15567 Puntos [05:32] HipopotamoConPrisa
3 Pista: jua* a**o*io *ui* 15 segundos y 15567 Puntos
[05:32] HipopotamoConPrisa Tiempo! La respuesta es -> juan�ntonio�uiz <- [05:32] HipopotamoConPrisa
Tiempo! La respuesta es -> juan�ntonio�uiz <-
[05:32] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [05:32] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[05:32] HipopotamoConPrisa Tri.6459 Medicina-Saludɲaziel9˿COMOaSEaLLAMAaELaMIEDOaAaLOSaCRISTALESa?a [05:32] HipopotamoConPrisa
Tri.6459 Medicina-Saludɲaziel9˿COMOaSEaLLAMAaELaMIEDOaAaLOSaCRISTALESa?a
[05:32] HipopotamoConPrisa 1 Pista: ************** Pregunta de BONUS : 25000 Puntos [05:32] HipopotamoConPrisa
1 Pista: ************** Pregunta de BONUS : 25000 Puntos
[05:33] HipopotamoConPrisa 2 Pista: cry*********** 30 segundos y 25000 Puntos [05:33] HipopotamoConPrisa
2 Pista: cry*********** 30 segundos y 25000 Puntos
[05:33] HipopotamoConPrisa 3 Pista: cry**a**o*o*ia 15 segundos y 25000 Puntos [05:33] HipopotamoConPrisa
3 Pista: cry**a**o*o*ia 15 segundos y 25000 Puntos
[05:33] Hipopotamo\Insufrible Crystalofobia [05:33] Hipopotamo\Insufrible
Crystalofobia
[05:33] HipopotamoConPrisa Tiempo! La respuesta es -> crystallofobia <- [05:33] HipopotamoConPrisa
Tiempo! La respuesta es -> crystallofobia <-
[05:33] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [05:33] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[05:33] HipopotamoConPrisa Tri.14940 Medicina-Saludɖivian˿Conocu᮴ayfrecuenciayseqreemplazanolascc鬵lascdelbcerebro?l?l [05:33] HipopotamoConPrisa
Tri.14940 Medicina-Saludɖivian˿Conocu᮴ayfrecuenciayseqreemplazanolascc鬵lascdelbcerebro?l?l
[05:33] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 22875 Puntos [05:33] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 22875 Puntos
[05:34] HipopotamoConPrisa 2 Pista: nin**** 30 segundos y 22875 Puntos [05:34] HipopotamoConPrisa
2 Pista: nin**** 30 segundos y 22875 Puntos
[05:34] Oveja\Suave Ninguna [05:34] Oveja\Suave
Ninguna
[05:34] HipopotamoConPrisa �Suma y sigue Oveja\Suave!! La respuesta: "Ninguna" incrementa tu marcador en �2875�12 puntos [05:34] HipopotamoConPrisa
�Suma y sigue Oveja\Suave!! La respuesta: "Ninguna" incrementa tu marcador en �2875�12 puntos
[05:34] HipopotamoConPrisa ACTION awards Oveja\Suave with a +v for having over 15000 points [05:34] HipopotamoConPrisa
ACTION awards Oveja\Suave with a +v for having over 15000 points
[05:34] HipopotamoConPrisa Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 100061, SEMANA: 1723627 y MES: 1723627 [05:34] HipopotamoConPrisa
Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 100061, SEMANA: 1723627 y MES: 1723627
[05:34] HipopotamoConPrisa For The Competitive Edge type !pingme [05:34] HipopotamoConPrisa
For The Competitive Edge type !pingme
[05:34] HipopotamoConPrisa Tri.18755 Cineɥrboni˿ENmQUEmPELICULAmUNmPERSONAJEmDICE:m"MAMA,mߓImHICIERASmUNAmPELICULAmPORNOmALEMANAmMEmLOmDIRIAS,mVERDAD??m?m [05:34] HipopotamoConPrisa
Tri.18755 Cineɥrboni˿ENmQUEmPELICULAmUNmPERSONAJEmDICE:m"MAMA,mߓImHICIERASmUNAmPELICULAmPORNOmALEMANAmMEmLOmDIRIAS,mVERDAD??m?m
[05:34] HipopotamoConPrisa 1 Pista: ***** **** Pregunta de BONUS : 25000 Puntos [05:34] HipopotamoConPrisa
1 Pista: ***** **** Pregunta de BONUS : 25000 Puntos
[05:34] HipopotamoConPrisa 2 Pista: sou** **** 30 segundos y 25000 Puntos [05:34] HipopotamoConPrisa
2 Pista: sou** **** 30 segundos y 25000 Puntos
[05:34] HipopotamoConPrisa 3 Pista: sou** *a** 15 segundos y 25000 Puntos [05:34] HipopotamoConPrisa
3 Pista: sou** *a** 15 segundos y 25000 Puntos
[05:35] HipopotamoConPrisa �Est᳠que lo tiras Oveja\Suave!! ߃󭯠supiste que "South park" era la respuesta? Venga, �5000�12 puntos suben a tu marcador [05:35] HipopotamoConPrisa
�Est᳠que lo tiras Oveja\Suave!! ߃󭯠supiste que "South park" era la respuesta? Venga, �5000�12 puntos suben a tu marcador
[05:35] HipopotamoConPrisa ACTION awards Oveja\Suave with a +v for having over 15000 points [05:35] HipopotamoConPrisa
ACTION awards Oveja\Suave with a +v for having over 15000 points
[05:35] HipopotamoConPrisa Oveja\Suave has acertado 2 seguidas!! Puntos HOY: 125061, SEMANA: 1748627 y MES: 1748627 [05:35] HipopotamoConPrisa
Oveja\Suave has acertado 2 seguidas!! Puntos HOY: 125061, SEMANA: 1748627 y MES: 1748627
[05:35] Oveja\Suave South park [05:35] Oveja\Suave
South park
[05:35] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [05:35] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[05:35] HipopotamoConPrisa Tri.8067 Biologiaɖivian˿Cuᬃ01reskelrmam�rotterrestreaqueaviveamᳬgdespu鳃01kdelrhombre?g?g [05:35] HipopotamoConPrisa
Tri.8067 Biologiaɖivian˿Cuᬃ01reskelrmam�rotterrestreaqueaviveamᳬgdespu鳃01kdelrhombre?g?g
[05:35] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 13821 Puntos [05:35] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 13821 Puntos
[05:35] Oveja\Suave Elefante [05:35] Oveja\Suave
Elefante
[05:35] HipopotamoConPrisa �Ol頃04Oveja\Suave!! Has contestado: "Elefante" en �2.312 segundos y sumas �3821�12 puntos a tu marcador. �Sigue as� [05:35] HipopotamoConPrisa
�Ol頃04Oveja\Suave!! Has contestado: "Elefante" en �2.312 segundos y sumas �3821�12 puntos a tu marcador. �Sigue as�
[05:35] HipopotamoConPrisa ACTION awards Oveja\Suave with a +v for having over 15000 points [05:35] HipopotamoConPrisa
ACTION awards Oveja\Suave with a +v for having over 15000 points
[05:35] HipopotamoConPrisa Oveja\Suave has acertado 3 seguidas!! Puntos HOY: 138882, SEMANA: 1762448 y MES: 1762448 [05:35] HipopotamoConPrisa
Oveja\Suave has acertado 3 seguidas!! Puntos HOY: 138882, SEMANA: 1762448 y MES: 1762448
[05:35] HipopotamoConPrisa R᮫ing MES: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1748627 #5: siva- 1210919 #6: Hipopotamo\Insufrible 911253 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [05:35] HipopotamoConPrisa
R᮫ing MES: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1748627 #5: siva- 1210919 #6: Hipopotamo\Insufrible 911253 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[05:35] HipopotamoConPrisa Tri.6220 LiteraturaɁlkaid˿CUALESeSONeLASeMASeFAMOSASeCOPLASeDEeHERNANDOeDELePULGAR?e?e [05:35] HipopotamoConPrisa
Tri.6220 LiteraturaɁlkaid˿CUALESeSONeLASeMASeFAMOSASeCOPLASeDEeHERNANDOeDELePULGAR?e?e
[05:35] HipopotamoConPrisa 1 Pista: ****** ** ***** ******* Pregunta de BONUS : 50000 Puntos [05:35] HipopotamoConPrisa
1 Pista: ****** ** ***** ******* Pregunta de BONUS : 50000 Puntos
[05:35] HipopotamoConPrisa 2 Pista: cop*** ** ***** ******* 30 segundos y 50000 Puntos [05:35] HipopotamoConPrisa
2 Pista: cop*** ** ***** ******* 30 segundos y 50000 Puntos
[05:36] HipopotamoConPrisa 3 Pista: cop*a* *e *i**o *e*u**o 15 segundos y 50000 Puntos [05:36] HipopotamoConPrisa
3 Pista: cop*a* *e *i**o *e*u**o 15 segundos y 50000 Puntos
[05:36] HipopotamoConPrisa Tiempo! La respuesta es -> coplas�e�ingo�evulgo <- [05:36] HipopotamoConPrisa
Tiempo! La respuesta es -> coplas�e�ingo�evulgo <-
[05:36] HipopotamoConPrisa Please refrain from using Extreme Bad Language [05:36] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[05:36] HipopotamoConPrisa Tri.11645 HistoriaɊAVEA˿DIC-1912.QUEvPRESIDENTEvESPAяLvESvASESINADOvENvLAvPUERTAvDELvSOLvENvMADRIDv?v [05:36] HipopotamoConPrisa
Tri.11645 HistoriaɊAVEA˿DIC-1912.QUEvPRESIDENTEvESPAяLvESvASESINADOvENvLAvPUERTAvDELvSOLvENvMADRIDv?v
[05:36] HipopotamoConPrisa 1 Pista: **** ********* Valor pregunta : 24240 Puntos [05:36] HipopotamoConPrisa
1 Pista: **** ********* Valor pregunta : 24240 Puntos
[05:36] HipopotamoConPrisa 2 Pista: jos* ********* 30 segundos y 24240 Puntos [05:36] HipopotamoConPrisa
2 Pista: jos* ********* 30 segundos y 24240 Puntos
[05:37] HipopotamoConPrisa 3 Pista: jose *a*a*e*a* 15 segundos y 24240 Puntos [05:37] HipopotamoConPrisa
3 Pista: jose *a*a*e*a* 15 segundos y 24240 Puntos
[05:37] HipopotamoConPrisa Tiempo! La respuesta es -> jose�analejas <- [05:37] HipopotamoConPrisa
Tiempo! La respuesta es -> jose�analejas <-
[05:37] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [05:37] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[05:37] HipopotamoConPrisa Tri.19960 Cotilleo-TVɴjmm.comːrogramaenocturnomdemAntena3g(Juniom2004)gpresentadompor,gentremotros,gNuriaeRocaeykFlorentinomFernᮤez.g?g [05:37] HipopotamoConPrisa
Tri.19960 Cotilleo-TVɴjmm.comːrogramaenocturnomdemAntena3g(Juniom2004)gpresentadompor,gentremotros,gNuriaeRocaeykFlorentinomFernᮤez.g?g
[05:37] HipopotamoConPrisa 1 Pista: *** Valor pregunta : 10888 Puntos [05:37] HipopotamoConPrisa
1 Pista: *** Valor pregunta : 10888 Puntos
[05:37] HipopotamoConPrisa 2 Pista: uhf 30 segundos y 10888 Puntos [05:37] HipopotamoConPrisa
2 Pista: uhf 30 segundos y 10888 Puntos
[05:37] Hipopotamo\Insufrible Uhf [05:37] Hipopotamo\Insufrible
Uhf
[05:37] HipopotamoConPrisa �Increible!! Hipopotamo\Insufrible contest󺠃04"Uhf" en �1.531 segundos, y ha ganado �0888�12 puntos [05:37] HipopotamoConPrisa
�Increible!! Hipopotamo\Insufrible contest󺠃04"Uhf" en �1.531 segundos, y ha ganado �0888�12 puntos
[05:37] HipopotamoConPrisa ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points [05:37] HipopotamoConPrisa
ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points
[05:37] HipopotamoConPrisa Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 43338, SEMANA: 922141 y MES: 922141 [05:37] HipopotamoConPrisa
Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 43338, SEMANA: 922141 y MES: 922141
[05:37] Oveja\Suave Uhf [05:37] Oveja\Suave
Uhf
[05:38] HipopotamoConPrisa This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [05:38] HipopotamoConPrisa
This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[05:38] HipopotamoConPrisa Tri.929 HistoriaɊAVEA˿ENsQUEsESTACIONsITALIANAsSEsPRODUJOsELsBRUTALsATENTADOsNEOFASCISTAsQUEsPROVOCOs83sMUERTOSsAsFINALESsDEsLOSsAяSs70s?s [05:38] HipopotamoConPrisa
Tri.929 HistoriaɊAVEA˿ENsQUEsESTACIONsITALIANAsSEsPRODUJOsELsBRUTALsATENTADOsNEOFASCISTAsQUEsPROVOCOs83sMUERTOSsAsFINALESsDEsLOSsAяSs70s?s
[05:38] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 20345 Puntos [05:38] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 20345 Puntos
[05:38] HipopotamoConPrisa 2 Pista: BOL**** 30 segundos y 20345 Puntos [05:38] HipopotamoConPrisa
2 Pista: BOL**** 30 segundos y 20345 Puntos
[05:38] HipopotamoConPrisa �Hipopotamo\Insufrible acert󡡠La respuesta era: "Bolonia" y contest󠥮 �2.766 segundos. Se lleva: �0345�12 puntos [05:38] HipopotamoConPrisa
�Hipopotamo\Insufrible acert󡡠La respuesta era: "Bolonia" y contest󠥮 �2.766 segundos. Se lleva: �0345�12 puntos
[05:38] HipopotamoConPrisa ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points [05:38] HipopotamoConPrisa
ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points
[05:38] HipopotamoConPrisa Hipopotamo\Insufrible has acertado 2 seguidas!! Puntos HOY: 63683, SEMANA: 942486 y MES: 942486 [05:38] HipopotamoConPrisa
Hipopotamo\Insufrible has acertado 2 seguidas!! Puntos HOY: 63683, SEMANA: 942486 y MES: 942486
[05:38] Hipopotamo\Insufrible Bolonia [05:38] Hipopotamo\Insufrible
Bolonia
[05:38] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [05:38] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[05:38] HipopotamoConPrisa Tri.17265 Fisica-QuimicaɐiNKiTa˿Comoysefdenominaalaapartefdelxvaportquefsefcondensaaynsefreintroducefenfunaacolumnaadefdestilacionf?u [05:38] HipopotamoConPrisa
Tri.17265 Fisica-QuimicaɐiNKiTa˿Comoysefdenominaalaapartefdelxvaportquefsefcondensaaynsefreintroducefenfunaacolumnaadefdestilacionf?u
[05:38] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 17503 Puntos [05:38] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 17503 Puntos
[05:38] HipopotamoConPrisa 2 Pista: ref**** 30 segundos y 17503 Puntos [05:38] HipopotamoConPrisa
2 Pista: ref**** 30 segundos y 17503 Puntos
[05:39] HipopotamoConPrisa 3 Pista: ref*u*o 15 segundos y 17503 Puntos [05:39] HipopotamoConPrisa
3 Pista: ref*u*o 15 segundos y 17503 Puntos
[05:39] Oveja\Suave Reflujo [05:39] Oveja\Suave
Reflujo
[05:39] HipopotamoConPrisa �Suma y sigue Oveja\Suave!! La respuesta: "Reflujo" incrementa tu marcador en �7503�12 puntos [05:39] HipopotamoConPrisa
�Suma y sigue Oveja\Suave!! La respuesta: "Reflujo" incrementa tu marcador en �7503�12 puntos
[05:39] HipopotamoConPrisa ACTION awards Oveja\Suave with a +v for having over 15000 points [05:39] HipopotamoConPrisa
ACTION awards Oveja\Suave with a +v for having over 15000 points
[05:39] HipopotamoConPrisa Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 156385, SEMANA: 1779951 y MES: 1779951 [05:39] HipopotamoConPrisa
Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 156385, SEMANA: 1779951 y MES: 1779951
[05:39] HipopotamoConPrisa This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [05:39] HipopotamoConPrisa
This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[05:39] HipopotamoConPrisa Tri.4672 BiologiaɄonNadieˌaedezPrzewalskipesgunaerazaesalvajezߤezqu郰1xanimal?x?x [05:39] HipopotamoConPrisa
Tri.4672 BiologiaɄonNadieˌaedezPrzewalskipesgunaerazaesalvajezߤezqu郰1xanimal?x?x
[05:39] HipopotamoConPrisa 1 Pista: ******* Pregunta de BONUS : 25000 Puntos [05:39] HipopotamoConPrisa
1 Pista: ******* Pregunta de BONUS : 25000 Puntos
[05:39] HipopotamoConPrisa 2 Pista: cab**** 30 segundos y 25000 Puntos [05:39] HipopotamoConPrisa
2 Pista: cab**** 30 segundos y 25000 Puntos
[05:39] HipopotamoConPrisa �emuestra lo que sabes Hipopotamo\Insufrible! Has respondido "Caballo" correctamente y eso te da: �5000�12 puntos [05:39] HipopotamoConPrisa
�emuestra lo que sabes Hipopotamo\Insufrible! Has respondido "Caballo" correctamente y eso te da: �5000�12 puntos
[05:39] HipopotamoConPrisa ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points [05:39] HipopotamoConPrisa
ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points
[05:39] HipopotamoConPrisa Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 88683, SEMANA: 967486 y MES: 967486 [05:39] HipopotamoConPrisa
Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 88683, SEMANA: 967486 y MES: 967486
[05:39] Hipopotamo\Insufrible Caballo [05:39] Hipopotamo\Insufrible
Caballo
[05:39] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [05:39] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[05:39] HipopotamoConPrisa Tri.13258 EconomiaɊarreando˿CuallesjellsignificadoydetlasjsiglasjMIBOR?h?h [05:39] HipopotamoConPrisa
Tri.13258 EconomiaɊarreando˿CuallesjellsignificadoydetlasjsiglasjMIBOR?h?h
[05:39] HipopotamoConPrisa 1 Pista: ****** ********* ******* **** Valor pregunta : 13841 Puntos [05:39] HipopotamoConPrisa
1 Pista: ****** ********* ******* **** Valor pregunta : 13841 Puntos
[05:40] HipopotamoConPrisa 2 Pista: mad*** ********* ******* **** 30 segundos y 13841 Puntos [05:40] HipopotamoConPrisa
2 Pista: mad*** ********* ******* **** 30 segundos y 13841 Puntos
[05:40] HipopotamoConPrisa 3 Pista: mad*i* i**e**a** o**e*e* *a*e 15 segundos y 13841 Puntos [05:40] HipopotamoConPrisa
3 Pista: mad*i* i**e**a** o**e*e* *a*e 15 segundos y 13841 Puntos
[05:40] HipopotamoConPrisa Tiempo! La respuesta es -> madrid�nterbank�ffered�ate <- [05:40] HipopotamoConPrisa
Tiempo! La respuesta es -> madrid�nterbank�ffered�ate <-
[05:40] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [05:40] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[05:40] HipopotamoConPrisa Tri.17063 MusicaɌopes_˿CualafuejelanombrejdejManonNegragdespu鳃01tdejllamarsejas탰1u?u [05:40] HipopotamoConPrisa
Tri.17063 MusicaɌopes_˿CualafuejelanombrejdejManonNegragdespu鳃01tdejllamarsejas탰1u?u
[05:40] HipopotamoConPrisa 1 Pista: ***** ***** ***** ****** Valor pregunta : 14570 Puntos [05:40] HipopotamoConPrisa
1 Pista: ***** ***** ***** ****** Valor pregunta : 14570 Puntos
[05:41] HipopotamoConPrisa 2 Pista: rad** ***** ***** ****** 30 segundos y 14570 Puntos [05:41] HipopotamoConPrisa
2 Pista: rad** ***** ***** ****** 30 segundos y 14570 Puntos
[05:41] HipopotamoConPrisa 3 Pista: radio *e**a *ou** ****e* 15 segundos y 14570 Puntos [05:41] HipopotamoConPrisa
3 Pista: radio *e**a *ou** ****e* 15 segundos y 14570 Puntos
[05:41] HipopotamoConPrisa Tiempo! La respuesta es -> radio�emba�ound�ystem <- [05:41] HipopotamoConPrisa
Tiempo! La respuesta es -> radio�emba�ound�ystem <-
[05:41] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [05:41] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[05:41] HipopotamoConPrisa Tri.14160 Cotilleo-TVɅME^˿ISABELmPREYSLERmSEmHAmCASADOmCONmJULIOmIGLESIAS,mCARLOSmFALCӃ01mY.......m?m [05:41] HipopotamoConPrisa
Tri.14160 Cotilleo-TVɅME^˿ISABELmPREYSLERmSEmHAmCASADOmCONmJULIOmIGLESIAS,mCARLOSmFALCӃ01mY.......m?m
[05:41] HipopotamoConPrisa 1 Pista: ****** ***** Valor pregunta : 10331 Puntos [05:41] HipopotamoConPrisa
1 Pista: ****** ***** Valor pregunta : 10331 Puntos
[05:42] HipopotamoConPrisa 2 Pista: mig*** ***** 30 segundos y 10331 Puntos [05:42] HipopotamoConPrisa
2 Pista: mig*** ***** 30 segundos y 10331 Puntos
[05:42] HipopotamoConPrisa 3 Pista: migue* *o*e* 15 segundos y 10331 Puntos [05:42] HipopotamoConPrisa
3 Pista: migue* *o*e* 15 segundos y 10331 Puntos
[05:42] HipopotamoConPrisa Tiempo! La respuesta es -> miguel�oyer <- [05:42] HipopotamoConPrisa
Tiempo! La respuesta es -> miguel�oyer <-
[05:42] HipopotamoConPrisa R᮫ing SEMANA: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1779951 #5: siva- 1210919 #6: Hipopotamo\Insufrible 967486 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [05:42] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1779951 #5: siva- 1210919 #6: Hipopotamo\Insufrible 967486 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[05:42] HipopotamoConPrisa Tri.15621 LiteraturaɔeLaRaNhA˿Autorudeu"deuacuerdo,tjeeves"t?t [05:42] HipopotamoConPrisa
Tri.15621 LiteraturaɔeLaRaNhA˿Autorudeu"deuacuerdo,tjeeves"t?t
[05:42] HipopotamoConPrisa 1 Pista: * * ********* Valor pregunta : 9042 Puntos [05:42] HipopotamoConPrisa
1 Pista: * * ********* Valor pregunta : 9042 Puntos
[05:42] HipopotamoConPrisa 2 Pista: p� ********* 30 segundos y 9042 Puntos [05:42] HipopotamoConPrisa
2 Pista: p� ********* 30 segundos y 9042 Puntos
[05:43] HipopotamoConPrisa 3 Pista: p� *o*e*ou*e 15 segundos y 9042 Puntos [05:43] HipopotamoConPrisa
3 Pista: p� *o*e*ou*e 15 segundos y 9042 Puntos
[05:43] HipopotamoConPrisa Tiempo! La respuesta es -> p��odehouse <- [05:43] HipopotamoConPrisa
Tiempo! La respuesta es -> p��odehouse <-
[05:43] HipopotamoConPrisa We feature over 50,000 Q&A ! [05:43] HipopotamoConPrisa
We feature over 50,000 Q&A !
[05:43] HipopotamoConPrisa Tri.3913 GastronomiaɄactylis˿Formaxdeycalentarfunll�idotenlunlrecipiente,bsumergidotenlotrotdeyaguaxhirviendo:b?b [05:43] HipopotamoConPrisa
Tri.3913 GastronomiaɄactylis˿Formaxdeycalentarfunll�idotenlunlrecipiente,bsumergidotenlotrotdeyaguaxhirviendo:b?b
[05:43] HipopotamoConPrisa 1 Pista: **񪠪**** Pregunta de BONUS : 200000 Puntos [05:43] HipopotamoConPrisa
1 Pista: **񪠪**** Pregunta de BONUS : 200000 Puntos
[05:43] HipopotamoConPrisa 2 Pista: ba񪠪**** 30 segundos y 200000 Puntos [05:43] HipopotamoConPrisa
2 Pista: ba񪠪**** 30 segundos y 200000 Puntos
[05:44] HipopotamoConPrisa 3 Pista: ba񯠪a*ia 15 segundos y 200000 Puntos [05:44] HipopotamoConPrisa
3 Pista: ba񯠪a*ia 15 segundos y 200000 Puntos
[05:44] HipopotamoConPrisa Tiempo! La respuesta es -> ba񯠭aria <- [05:44] HipopotamoConPrisa
Tiempo! La respuesta es -> ba񯠭aria <-
[05:44] HipopotamoConPrisa Tri.11768 LiteraturaɍARdeJAVAˑUɃ01vAUTORvMEXICANOv(1581-1639)vESCRIBIӃ01v"vLAvCRUELDADvPORvELvHONOR".v(TR�ICA)v?v [05:44] HipopotamoConPrisa
Tri.11768 LiteraturaɍARdeJAVAˑUɃ01vAUTORvMEXICANOv(1581-1639)vESCRIBIӃ01v"vLAvCRUELDADvPORvELvHONOR".v(TR�ICA)v?v
[05:44] HipopotamoConPrisa 1 Pista: **** **** ** ******* Valor pregunta : 16260 Puntos [05:44] HipopotamoConPrisa
1 Pista: **** **** ** ******* Valor pregunta : 16260 Puntos
[05:44] HipopotamoConPrisa 2 Pista: jua* **** ** ******* 30 segundos y 16260 Puntos [05:44] HipopotamoConPrisa
2 Pista: jua* **** ** ******* 30 segundos y 16260 Puntos
[05:45] HipopotamoConPrisa 3 Pista: jua* *ui* *e a*a**o* 15 segundos y 16260 Puntos [05:45] HipopotamoConPrisa
3 Pista: jua* *ui* *e a*a**o* 15 segundos y 16260 Puntos
[05:45] HipopotamoConPrisa Tiempo! La respuesta es -> juan�uiz�e�larcon <- [05:45] HipopotamoConPrisa
Tiempo! La respuesta es -> juan�uiz�e�larcon <-
[05:45] HipopotamoConPrisa Tri.8316 Miscelaneaɓebosin˿C󭯃01fseyllamanlancosa,epersonanofsituaci󮃰1fimaginarianeyidealryqperfecta,equeynofpuedeyexistirxenflanrealidad?e?e [05:45] HipopotamoConPrisa
Tri.8316 Miscelaneaɓebosin˿C󭯃01fseyllamanlancosa,epersonanofsituaci󮃰1fimaginarianeyidealryqperfecta,equeynofpuedeyexistirxenflanrealidad?e?e
[05:45] HipopotamoConPrisa 1 Pista: ********** Valor pregunta : 17837 Puntos [05:45] HipopotamoConPrisa
1 Pista: ********** Valor pregunta : 17837 Puntos
[05:45] HipopotamoConPrisa 2 Pista: ent******* 30 segundos y 17837 Puntos [05:45] HipopotamoConPrisa
2 Pista: ent******* 30 segundos y 17837 Puntos
[05:45] HipopotamoConPrisa 3 Pista: ente*e*uia 15 segundos y 17837 Puntos [05:45] HipopotamoConPrisa
3 Pista: ente*e*uia 15 segundos y 17837 Puntos
[05:46] HipopotamoConPrisa Tiempo! La respuesta es -> entelequia <- [05:46] HipopotamoConPrisa
Tiempo! La respuesta es -> entelequia <-
[05:46] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [05:46] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[05:46] HipopotamoConPrisa Tri.10566 DeporteɔeLaRaNhA˿GanadorvdelpDakarv2002,vcategoriamCOCHESv?v [05:46] HipopotamoConPrisa
Tri.10566 DeporteɔeLaRaNhA˿GanadorvdelpDakarv2002,vcategoriamCOCHESv?v
[05:46] HipopotamoConPrisa 1 Pista: ******* ******* Pregunta de BONUS : 25000 Puntos [05:46] HipopotamoConPrisa
1 Pista: ******* ******* Pregunta de BONUS : 25000 Puntos
[05:46] HipopotamoConPrisa 2 Pista: hir**** ******* 30 segundos y 25000 Puntos [05:46] HipopotamoConPrisa
2 Pista: hir**** ******* 30 segundos y 25000 Puntos
[05:46] HipopotamoConPrisa 3 Pista: hiro**i *a*uo*a 15 segundos y 25000 Puntos [05:46] HipopotamoConPrisa
3 Pista: hiro**i *a*uo*a 15 segundos y 25000 Puntos
[05:47] HipopotamoConPrisa Tiempo! La respuesta es -> hiroshi�asuoka <- [05:47] HipopotamoConPrisa
Tiempo! La respuesta es -> hiroshi�asuoka <-
[05:47] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [05:47] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[05:47] HipopotamoConPrisa Tri.13346 Biologiaɂatval˿AqQUEqORDENqDEqINSECTOSqPERTENECENqLOSqPIOJOS?q?q [05:47] HipopotamoConPrisa
Tri.13346 Biologiaɂatval˿AqQUEqORDENqDEqINSECTOSqPERTENECENqLOSqPIOJOS?q?q
[05:47] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 7706 Puntos [05:47] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 7706 Puntos
[05:47] HipopotamoConPrisa 2 Pista: mal****** 30 segundos y 7706 Puntos [05:47] HipopotamoConPrisa
2 Pista: mal****** 30 segundos y 7706 Puntos
[05:47] Oveja-DelMonton quiero fiestasss [05:47] Oveja-DelMonton
quiero fiestasss
[05:47] HipopotamoConPrisa 3 Pista: malo*a*o* 15 segundos y 7706 Puntos [05:47] HipopotamoConPrisa
3 Pista: malo*a*o* 15 segundos y 7706 Puntos
[05:47] Oveja-DelMonton con senioras armadsa [05:47] Oveja-DelMonton
con senioras armadsa
[05:47] Oveja-DelMonton armadas [05:47] Oveja-DelMonton
armadas
[05:47] Oveja-DelMonton que les guste mucho la soda [05:47] Oveja-DelMonton
que les guste mucho la soda
[05:48] HipopotamoConPrisa Tiempo! La respuesta es -> malofagos <- [05:48] HipopotamoConPrisa
Tiempo! La respuesta es -> malofagos <-
[05:48] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [05:48] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[05:48] HipopotamoConPrisa Tri.2548 IdiomasɎAPINE˿Definiciones:mREPETICIONmDEmUNOmOmVARIOSmSONIDOSmIGUALESmOmSEMEJANTESmENmUNAmPALABRAmOmENUNCIADOm?m [05:48] HipopotamoConPrisa
Tri.2548 IdiomasɎAPINE˿Definiciones:mREPETICIONmDEmUNOmOmVARIOSmSONIDOSmIGUALESmOmSEMEJANTESmENmUNAmPALABRAmOmENUNCIADOm?m
[05:48] HipopotamoConPrisa 1 Pista: *********** Valor pregunta : 24824 Puntos [05:48] HipopotamoConPrisa
1 Pista: *********** Valor pregunta : 24824 Puntos
[05:48] HipopotamoConPrisa 2 Pista: ali******** 30 segundos y 24824 Puntos [05:48] HipopotamoConPrisa
2 Pista: ali******** 30 segundos y 24824 Puntos
[05:48] HipopotamoConPrisa 3 Pista: ali*e*a*io* 15 segundos y 24824 Puntos [05:48] HipopotamoConPrisa
3 Pista: ali*e*a*io* 15 segundos y 24824 Puntos
[05:48] HipopotamoConPrisa Tiempo! La respuesta es -> aliteracion <- [05:48] HipopotamoConPrisa
Tiempo! La respuesta es -> aliteracion <-
[05:49] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [05:49] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[05:49] HipopotamoConPrisa Tri.10978 Idiomasɦlipp_er˿Cuallesrellsegundosidiomaumasrhabladosenrellmundo?r?r [05:49] HipopotamoConPrisa
Tri.10978 Idiomasɦlipp_er˿Cuallesrellsegundosidiomaumasrhabladosenrellmundo?r?r
[05:49] HipopotamoConPrisa 1 Pista: ****** Valor pregunta : 7354 Puntos [05:49] HipopotamoConPrisa
1 Pista: ****** Valor pregunta : 7354 Puntos
[05:49] HipopotamoConPrisa 2 Pista: ing*** 30 segundos y 7354 Puntos [05:49] HipopotamoConPrisa
2 Pista: ing*** 30 segundos y 7354 Puntos
[05:49] Oveja\Suave Ingles [05:49] Oveja\Suave
Ingles
[05:49] HipopotamoConPrisa �Enhorabuena Oveja\Suave!! Has contestado "Ingles" y por ello has ganado �354�12 puntos [05:49] HipopotamoConPrisa
�Enhorabuena Oveja\Suave!! Has contestado "Ingles" y por ello has ganado �354�12 puntos
[05:49] HipopotamoConPrisa ACTION awards Oveja\Suave with a +v for having over 15000 points [05:49] HipopotamoConPrisa
ACTION awards Oveja\Suave with a +v for having over 15000 points
[05:49] HipopotamoConPrisa Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 163739, SEMANA: 1787305 y MES: 1787305 [05:49] HipopotamoConPrisa
Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 163739, SEMANA: 1787305 y MES: 1787305
[05:49] HipopotamoConPrisa For The Competitive Edge type !pingme [05:49] HipopotamoConPrisa
For The Competitive Edge type !pingme
[05:49] HipopotamoConPrisa Tri.13655 Gastronomiaɓort˿ESTOYeCOMIENDOeKUIBAeSURI,eESTOYeEN...e?e [05:49] HipopotamoConPrisa
Tri.13655 Gastronomiaɓort˿ESTOYeCOMIENDOeKUIBAeSURI,eESTOYeEN...e?e
[05:49] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 9922 Puntos [05:49] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 9922 Puntos
[05:49] HipopotamoConPrisa 2 Pista: mar****** 30 segundos y 9922 Puntos [05:49] HipopotamoConPrisa
2 Pista: mar****** 30 segundos y 9922 Puntos
[05:50] Hipopotamo\Insufrible Marruecos [05:50] Hipopotamo\Insufrible
Marruecos
[05:50] HipopotamoConPrisa �e nota que sabes mucho de esto Hipopotamo\Insufrible! Tu respuesta "Marruecos" es correcta y ganas �922�12 puntos [05:50] HipopotamoConPrisa
�e nota que sabes mucho de esto Hipopotamo\Insufrible! Tu respuesta "Marruecos" es correcta y ganas �922�12 puntos
[05:50] HipopotamoConPrisa ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points [05:50] HipopotamoConPrisa
ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points
[05:50] HipopotamoConPrisa Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 98605, SEMANA: 977408 y MES: 977408 [05:50] HipopotamoConPrisa
Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 98605, SEMANA: 977408 y MES: 977408
[05:50] Oveja-DelMonton queremos destete con fiesta [05:50] Oveja-DelMonton
queremos destete con fiesta
[05:50] Oveja-DelMonton la fiesta promete [05:50] Oveja-DelMonton
la fiesta promete
[05:50] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [05:50] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[05:50] HipopotamoConPrisa Tri.12884 LiteraturaɍARdeJAVAˑUɃ01uAUTORu(1562-1635)uESCRIBIӃ01uLAuCOMEDIAuRELIGIOSAu"LAuCREACIӎuDELuMUNDO".u?u [05:50] HipopotamoConPrisa
Tri.12884 LiteraturaɍARdeJAVAˑUɃ01uAUTORu(1562-1635)uESCRIBIӃ01uLAuCOMEDIAuRELIGIOSAu"LAuCREACIӎuDELuMUNDO".u?u
[05:50] HipopotamoConPrisa 1 Pista: **** ** **** Valor pregunta : 11100 Puntos [05:50] HipopotamoConPrisa
1 Pista: **** ** **** Valor pregunta : 11100 Puntos
[05:50] Oveja-DelMonton las senoras armadas se mueven mu bien [05:50] Oveja-DelMonton
las senoras armadas se mueven mu bien
[05:50] HipopotamoConPrisa 2 Pista: lop* ** **** 30 segundos y 11100 Puntos [05:50] HipopotamoConPrisa
2 Pista: lop* ** **** 30 segundos y 11100 Puntos
[05:50] HipopotamoConPrisa 3 Pista: lope *e *e*a 15 segundos y 11100 Puntos [05:50] HipopotamoConPrisa
3 Pista: lope *e *e*a 15 segundos y 11100 Puntos
[05:51] HipopotamoConPrisa Tiempo! La respuesta es -> lope�e�ega <- [05:51] HipopotamoConPrisa
Tiempo! La respuesta es -> lope�e�ega <-
[05:51] HipopotamoConPrisa R᮫ing MES: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1787305 #5: siva- 1210919 #6: Hipopotamo\Insufrible 977408 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [05:51] HipopotamoConPrisa
R᮫ing MES: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1787305 #5: siva- 1210919 #6: Hipopotamo\Insufrible 977408 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[05:51] HipopotamoConPrisa Tri.555 Cienciaɲuin˿CualbesdelbvalorpdelbmumerorPil(conk7ddecimales)d?d [05:51] HipopotamoConPrisa
Tri.555 Cienciaɲuin˿CualbesdelbvalorpdelbmumerorPil(conk7ddecimales)d?d
[05:51] HipopotamoConPrisa 1 Pista: *'******* Valor pregunta : 19905 Puntos [05:51] HipopotamoConPrisa
1 Pista: *'******* Valor pregunta : 19905 Puntos
[05:51] Oveja-DelMonton traen fiesta [05:51] Oveja-DelMonton
traen fiesta
[05:51] HipopotamoConPrisa 2 Pista: 3'1****** 30 segundos y 19905 Puntos [05:51] HipopotamoConPrisa
2 Pista: 3'1****** 30 segundos y 19905 Puntos
[05:51] HipopotamoConPrisa 3 Pista: 3'1****** 15 segundos y 19905 Puntos [05:51] HipopotamoConPrisa
3 Pista: 3'1****** 15 segundos y 19905 Puntos
[05:51] HipopotamoConPrisa Tiempo! La respuesta es -> 3'1415926 <- [05:51] HipopotamoConPrisa
Tiempo! La respuesta es -> 3'1415926 <-
[05:52] HipopotamoConPrisa Please refrain from using Extreme Bad Language [05:52] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[05:52] HipopotamoConPrisa Tri.14197 PoliticaɓESINO˿Cuᬃ01cesyelcnombreapropion(compuesto)udelcex-presidenteadealayUni󮃰1ySovi鴩cayGorbachov?u?u [05:52] HipopotamoConPrisa
Tri.14197 PoliticaɓESINO˿Cuᬃ01cesyelcnombreapropion(compuesto)udelcex-presidenteadealayUni󮃰1ySovi鴩cayGorbachov?u?u
[05:52] HipopotamoConPrisa 1 Pista: ****** *********** Valor pregunta : 16183 Puntos [05:52] HipopotamoConPrisa
1 Pista: ****** *********** Valor pregunta : 16183 Puntos
[05:52] HipopotamoConPrisa 2 Pista: mij*** *********** 30 segundos y 16183 Puntos [05:52] HipopotamoConPrisa
2 Pista: mij*** *********** 30 segundos y 16183 Puntos
[05:52] Hipopotamo\Insufrible ? [05:52] Hipopotamo\Insufrible
?
[05:52] HipopotamoConPrisa 3 Pista: mijai* *e**ei*i*** 15 segundos y 16183 Puntos [05:52] HipopotamoConPrisa
3 Pista: mijai* *e**ei*i*** 15 segundos y 16183 Puntos
[05:52] HipopotamoConPrisa Tiempo! La respuesta es -> mijail�ergeivitch <- [05:52] HipopotamoConPrisa
Tiempo! La respuesta es -> mijail�ergeivitch <-
[05:53] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [05:53] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[05:53] HipopotamoConPrisa Tri.5044 LiteraturaɂRUJI˿DONDEtSEtENCUENTRANtREALMENTEtLOStPERSONAJEStDEtLAtOBRAt"LAtFUNDACION"?t?t [05:53] HipopotamoConPrisa
Tri.5044 LiteraturaɂRUJI˿DONDEtSEtENCUENTRANtREALMENTEtLOStPERSONAJEStDEtLAtOBRAt"LAtFUNDACION"?t?t
[05:53] HipopotamoConPrisa 1 Pista: ****** Valor pregunta : 21963 Puntos [05:53] HipopotamoConPrisa
1 Pista: ****** Valor pregunta : 21963 Puntos
[05:53] HipopotamoConPrisa 2 Pista: car*** 30 segundos y 21963 Puntos [05:53] HipopotamoConPrisa
2 Pista: car*** 30 segundos y 21963 Puntos
[05:53] HipopotamoConPrisa 3 Pista: car*e* 15 segundos y 21963 Puntos [05:53] HipopotamoConPrisa
3 Pista: car*e* 15 segundos y 21963 Puntos
[05:53] HipopotamoConPrisa Tiempo! La respuesta es -> carcel <- [05:53] HipopotamoConPrisa
Tiempo! La respuesta es -> carcel <-
[05:54] HipopotamoConPrisa This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [05:54] HipopotamoConPrisa
This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[05:54] HipopotamoConPrisa Tri.5389 GeografiaɍARdeJAVA˿CU�wESwLAwSEGUNDAwISLAwM�wGRANDEwDELwMEDITERR�EO?w?w [05:54] HipopotamoConPrisa
Tri.5389 GeografiaɍARdeJAVA˿CU�wESwLAwSEGUNDAwISLAwM�wGRANDEwDELwMEDITERR�EO?w?w
[05:54] HipopotamoConPrisa 1 Pista: *****񪠃 Valor pregunta : 9600 Puntos [05:54] HipopotamoConPrisa
1 Pista: *****񪠃 Valor pregunta : 9600 Puntos
[05:54] HipopotamoConPrisa 2 Pista: cer**񪠃 30 segundos y 9600 Puntos [05:54] HipopotamoConPrisa
2 Pista: cer**񪠃 30 segundos y 9600 Puntos
[05:54] HipopotamoConPrisa 3 Pista: cer*e񡠃 15 segundos y 9600 Puntos [05:54] HipopotamoConPrisa
3 Pista: cer*e񡠃 15 segundos y 9600 Puntos
[05:54] HipopotamoConPrisa Tiempo! La respuesta es -> cerde񡠃12 <- [05:54] HipopotamoConPrisa
Tiempo! La respuesta es -> cerde񡠃12 <-
[05:54] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [05:54] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[05:54] HipopotamoConPrisa Tri.18500 Cienciaɴjmm.com˿Ingenierozdeuorigenmrusoz(1889-1972)eperfeccionadorwdelhhelic󰴥rozmonorrotorw(apellido)e?e [05:54] HipopotamoConPrisa
Tri.18500 Cienciaɴjmm.com˿Ingenierozdeuorigenmrusoz(1889-1972)eperfeccionadorwdelhhelic󰴥rozmonorrotorw(apellido)e?e
[05:54] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 23423 Puntos [05:54] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 23423 Puntos
[05:55] HipopotamoConPrisa 2 Pista: sik***** 30 segundos y 23423 Puntos [05:55] HipopotamoConPrisa
2 Pista: sik***** 30 segundos y 23423 Puntos
[05:55] HipopotamoConPrisa 3 Pista: siko**** 15 segundos y 23423 Puntos [05:55] HipopotamoConPrisa
3 Pista: siko**** 15 segundos y 23423 Puntos
[05:55] HipopotamoConPrisa Tiempo! La respuesta es -> sikorsky <- [05:55] HipopotamoConPrisa
Tiempo! La respuesta es -> sikorsky <-
[05:55] HipopotamoConPrisa This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [05:55] HipopotamoConPrisa
This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[05:55] HipopotamoConPrisa Tri.20943 EconomiaɞIrati˿Autorescded"CalidadcTotalgenmlanGesti󮃰1mdedServicios.uComoklograrbelgEquilibriokentredlascpercepcionescyslascexpectativas"u?u [05:55] HipopotamoConPrisa
Tri.20943 EconomiaɞIrati˿Autorescded"CalidadcTotalgenmlanGesti󮃰1mdedServicios.uComoklograrbelgEquilibriokentredlascpercepcionescyslascexpectativas"u?u
[05:55] HipopotamoConPrisa 1 Pista: ******** *********** * ***** Valor pregunta : 7173 Puntos [05:55] HipopotamoConPrisa
1 Pista: ******** *********** * ***** Valor pregunta : 7173 Puntos
[05:56] HipopotamoConPrisa 2 Pista: zei***** *********** * ***** 30 segundos y 7173 Puntos [05:56] HipopotamoConPrisa
2 Pista: zei***** *********** * ***** 30 segundos y 7173 Puntos
[05:56] HipopotamoConPrisa 3 Pista: zei**a** *a*a*u*a*a* * *e*** 15 segundos y 7173 Puntos [05:56] HipopotamoConPrisa
3 Pista: zei**a** *a*a*u*a*a* * *e*** 15 segundos y 7173 Puntos
[05:56] HipopotamoConPrisa Tiempo! La respuesta es -> zeithaml�arasuraman��erry <- [05:56] HipopotamoConPrisa
Tiempo! La respuesta es -> zeithaml�arasuraman��erry <-
[05:56] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [05:56] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[05:56] HipopotamoConPrisa Tri.6167 Fisica-QuimicaɈdosO˿COMOmSEmLLAMAmLAmALEACIONmDEmCOBREmYmNIQUELmUSADAmPARAmRESISTENCIASmELECTRICASm?m [05:56] HipopotamoConPrisa
Tri.6167 Fisica-QuimicaɈdosO˿COMOmSEmLLAMAmLAmALEACIONmDEmCOBREmYmNIQUELmUSADAmPARAmRESISTENCIASmELECTRICASm?m
[05:56] HipopotamoConPrisa 1 Pista: ********** Valor pregunta : 18583 Puntos [05:56] HipopotamoConPrisa
1 Pista: ********** Valor pregunta : 18583 Puntos
[05:57] HipopotamoConPrisa 2 Pista: con******* 30 segundos y 18583 Puntos [05:57] HipopotamoConPrisa
2 Pista: con******* 30 segundos y 18583 Puntos
[05:57] HipopotamoConPrisa 3 Pista: con**a**a* 15 segundos y 18583 Puntos [05:57] HipopotamoConPrisa
3 Pista: con**a**a* 15 segundos y 18583 Puntos
[05:57] HipopotamoConPrisa Tiempo! La respuesta es -> constantan <- [05:57] HipopotamoConPrisa
Tiempo! La respuesta es -> constantan <-
[05:57] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [05:57] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[05:57] HipopotamoConPrisa Tri.1083 IdiomasɄUBLINERS˿Enofrancesl..Lapin,,enocastellanobsera?w?w [05:57] HipopotamoConPrisa
Tri.1083 IdiomasɄUBLINERS˿Enofrancesl..Lapin,,enocastellanobsera?w?w
[05:57] HipopotamoConPrisa 1 Pista: ****** Valor pregunta : 8414 Puntos [05:57] HipopotamoConPrisa
1 Pista: ****** Valor pregunta : 8414 Puntos
[05:57] HipopotamoConPrisa 2 Pista: Con*** 30 segundos y 8414 Puntos [05:57] HipopotamoConPrisa
2 Pista: Con*** 30 segundos y 8414 Puntos
[05:58] HipopotamoConPrisa 3 Pista: Cone*o 15 segundos y 8414 Puntos [05:58] HipopotamoConPrisa
3 Pista: Cone*o 15 segundos y 8414 Puntos
[05:58] HipopotamoConPrisa Tiempo! La respuesta es -> Conejo <- [05:58] HipopotamoConPrisa
Tiempo! La respuesta es -> Conejo <-
[05:58] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [05:58] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[05:58] HipopotamoConPrisa Tri.6319 Economiaɦurillo˿COMOoSEoDENOMINANoLOSoCOSTESoENoLOSoQUEoINCURRENoLOSoCONTRIBUYENTESoPARAoPAGARoSUSoIMPUESTOSo?o [05:58] HipopotamoConPrisa
Tri.6319 Economiaɦurillo˿COMOoSEoDENOMINANoLOSoCOSTESoENoLOSoQUEoINCURRENoLOSoCONTRIBUYENTESoPARAoPAGARoSUSoIMPUESTOSo?o
[05:58] HipopotamoConPrisa 1 Pista: ****** ** ************ Valor pregunta : 15094 Puntos [05:58] HipopotamoConPrisa
1 Pista: ****** ** ************ Valor pregunta : 15094 Puntos
[05:58] HipopotamoConPrisa 2 Pista: cos*** ** ************ 30 segundos y 15094 Puntos [05:58] HipopotamoConPrisa
2 Pista: cos*** ** ************ 30 segundos y 15094 Puntos
[05:59] HipopotamoConPrisa 3 Pista: cos*e* *e *u***i*ie**o 15 segundos y 15094 Puntos [05:59] HipopotamoConPrisa
3 Pista: cos*e* *e *u***i*ie**o 15 segundos y 15094 Puntos
[05:59] HipopotamoConPrisa Tiempo! La respuesta es -> costes�e�umplimiento <- [05:59] HipopotamoConPrisa
Tiempo! La respuesta es -> costes�e�umplimiento <-
[05:59] HipopotamoConPrisa R᮫ing SEMANA: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1787305 #5: siva- 1210919 #6: Hipopotamo\Insufrible 977408 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [05:59] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1787305 #5: siva- 1210919 #6: Hipopotamo\Insufrible 977408 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[05:59] HipopotamoConPrisa Tri.17025 CienciaɐEDROC˿LOSdINCASdLLEVABANdSUSdCUENTASdMEDIANTEdCUERDASdCONdNUDOSdLLAMADAS..d?d [05:59] HipopotamoConPrisa
Tri.17025 CienciaɐEDROC˿LOSdINCASdLLEVABANdSUSdCUENTASdMEDIANTEdCUERDASdCONdNUDOSdLLAMADAS..d?d
[05:59] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 10786 Puntos [05:59] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 10786 Puntos
[05:59] Oveja-DelMonton esstan destrozando israel [05:59] Oveja-DelMonton
esstan destrozando israel
[05:59] HipopotamoConPrisa 2 Pista: qui** 30 segundos y 10786 Puntos [05:59] HipopotamoConPrisa
2 Pista: qui** 30 segundos y 10786 Puntos
[06:00] HipopotamoConPrisa 3 Pista: qui*u 15 segundos y 10786 Puntos [06:00] HipopotamoConPrisa
3 Pista: qui*u 15 segundos y 10786 Puntos
[06:00] HipopotamoConPrisa Tiempo! La respuesta es -> quipu <- [06:00] HipopotamoConPrisa
Tiempo! La respuesta es -> quipu <-
[06:00] HipopotamoConPrisa We feature over 50,000 Q&A ! [06:00] HipopotamoConPrisa
We feature over 50,000 Q&A !
[06:00] HipopotamoConPrisa Tri.10319 Geografiaɓebosin˿Enwqu郰1sislalsewencuentralelfvolcᮃ01wKilauea?s?s [06:00] HipopotamoConPrisa
Tri.10319 Geografiaɓebosin˿Enwqu郰1sislalsewencuentralelfvolcᮃ01wKilauea?s?s
[06:00] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 16657 Puntos [06:00] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 16657 Puntos
[06:00] Oveja-DelMonton da gusto ver como iran [06:00] Oveja-DelMonton
da gusto ver como iran
[06:00] HipopotamoConPrisa 2 Pista: haw** 30 segundos y 16657 Puntos [06:00] HipopotamoConPrisa
2 Pista: haw** 30 segundos y 16657 Puntos
[06:00] Oveja-DelMonton no se doblega [06:00] Oveja-DelMonton
no se doblega
[06:00] HipopotamoConPrisa 3 Pista: hawai 15 segundos y 16657 Puntos [06:00] HipopotamoConPrisa
3 Pista: hawai 15 segundos y 16657 Puntos
[06:01] HipopotamoConPrisa Tiempo! La respuesta es -> hawai <- [06:01] HipopotamoConPrisa
Tiempo! La respuesta es -> hawai <-
[06:01] HipopotamoConPrisa Tri.3250 LiteraturaɔeLaRaNhA˿Autorhdeo"extramuros"e?e [06:01] HipopotamoConPrisa
Tri.3250 LiteraturaɔeLaRaNhA˿Autorhdeo"extramuros"e?e
[06:01] HipopotamoConPrisa 1 Pista: ******* ***** ******* Valor pregunta : 14135 Puntos [06:01] HipopotamoConPrisa
1 Pista: ******* ***** ******* Valor pregunta : 14135 Puntos
[06:01] HipopotamoConPrisa 2 Pista: arm**** ***** ******* 30 segundos y 14135 Puntos [06:01] HipopotamoConPrisa
2 Pista: arm**** ***** ******* 30 segundos y 14135 Puntos
[06:01] HipopotamoConPrisa 3 Pista: arma**o *o*e* *a*i*a* 15 segundos y 14135 Puntos [06:01] HipopotamoConPrisa
3 Pista: arma**o *o*e* *a*i*a* 15 segundos y 14135 Puntos
[06:02] HipopotamoConPrisa Tiempo! La respuesta es -> armando�opez�alinas <- [06:02] HipopotamoConPrisa
Tiempo! La respuesta es -> armando�opez�alinas <-
[06:02] HipopotamoConPrisa Tri.55 Fisica-QuimicaɔeLaRaNhA˅lectr󮩣a:o߅ntelectr󮩣a,oparaeidentificarmelevalormdeeunaeresistencia,oelecolormmarrontequivaleealen�mero...o?o [06:02] HipopotamoConPrisa
Tri.55 Fisica-QuimicaɔeLaRaNhA˅lectr󮩣a:o߅ntelectr󮩣a,oparaeidentificarmelevalormdeeunaeresistencia,oelecolormmarrontequivaleealen�mero...o?o
[06:02] HipopotamoConPrisa 1 Pista: * Valor pregunta : 22934 Puntos [06:02] HipopotamoConPrisa
1 Pista: * Valor pregunta : 22934 Puntos
[06:02] Oveja\Suave 1 [06:02] Oveja\Suave
1
[06:02] HipopotamoConPrisa 2 Pista: 1 30 segundos y 22934 Puntos [06:02] HipopotamoConPrisa
2 Pista: 1 30 segundos y 22934 Puntos
[06:02] HipopotamoConPrisa �Oveja\Suave acert󡡠La respuesta era: "1" y contest󠥮 �5.141 segundos. Se lleva: �2934�12 puntos [06:02] HipopotamoConPrisa
�Oveja\Suave acert󡡠La respuesta era: "1" y contest󠥮 �5.141 segundos. Se lleva: �2934�12 puntos
[06:02] HipopotamoConPrisa ACTION awards Oveja\Suave with a +v for having over 15000 points [06:02] HipopotamoConPrisa
ACTION awards Oveja\Suave with a +v for having over 15000 points
[06:02] HipopotamoConPrisa Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 186673, SEMANA: 1810239 y MES: 1810239 [06:02] HipopotamoConPrisa
Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 186673, SEMANA: 1810239 y MES: 1810239
[06:02] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [06:02] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[06:02] HipopotamoConPrisa Tri.204 InformaticaɌucky_LuK˿CUANTOSdCONTACTOSdTIENENdLOSdMODULOSdDEdMEMORIAdDIMMd?d [06:02] HipopotamoConPrisa
Tri.204 InformaticaɌucky_LuK˿CUANTOSdCONTACTOSdTIENENdLOSdMODULOSdDEdMEMORIAdDIMMd?d
[06:02] HipopotamoConPrisa 1 Pista: *** Valor pregunta : 11762 Puntos [06:02] HipopotamoConPrisa
1 Pista: *** Valor pregunta : 11762 Puntos
[06:02] Oveja\Suave Dos [06:02] Oveja\Suave
Dos
[06:02] Oveja\Suave Uno [06:02] Oveja\Suave
Uno
[06:03] HipopotamoConPrisa 2 Pista: 168 30 segundos y 11762 Puntos [06:03] HipopotamoConPrisa
2 Pista: 168 30 segundos y 11762 Puntos
[06:03] Oveja\Suave 🤨 [06:03] Oveja\Suave
🤨
[06:03] Oveja-DelMonton israel le hizo mucho danio a palestina [06:03] Oveja-DelMonton
israel le hizo mucho danio a palestina
[06:03] HipopotamoConPrisa 3 Pista: 168 15 segundos y 11762 Puntos [06:03] HipopotamoConPrisa
3 Pista: 168 15 segundos y 11762 Puntos
[06:03] Hipopotamo\Insufrible 168 [06:03] Hipopotamo\Insufrible
168
[06:03] HipopotamoConPrisa �Increible!! Hipopotamo\Insufrible contest󺠃04"168" en �4.141 segundos, y ha ganado �1762�12 puntos [06:03] HipopotamoConPrisa
�Increible!! Hipopotamo\Insufrible contest󺠃04"168" en �4.141 segundos, y ha ganado �1762�12 puntos
[06:03] HipopotamoConPrisa ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points [06:03] HipopotamoConPrisa
ACTION awards Hipopotamo\Insufrible with a +v for having over 15000 points
[06:03] HipopotamoConPrisa Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 110367, SEMANA: 989170 y MES: 989170 [06:03] HipopotamoConPrisa
Hipopotamo\Insufrible has acertado 1 seguidas!! Puntos HOY: 110367, SEMANA: 989170 y MES: 989170
[06:03] Oveja-DelMonton y ahora israel esta siendo destrozada [06:03] Oveja-DelMonton
y ahora israel esta siendo destrozada
[06:03] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [06:03] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[06:03] HipopotamoConPrisa Tri.13458 LiteraturaɔeLaRaNhA˿Autorkdec"galindez"h?h [06:03] HipopotamoConPrisa
Tri.13458 LiteraturaɔeLaRaNhA˿Autorkdec"galindez"h?h
[06:03] HipopotamoConPrisa 1 Pista: ****** ******* ********* Valor pregunta : 5282 Puntos [06:03] HipopotamoConPrisa
1 Pista: ****** ******* ********* Valor pregunta : 5282 Puntos
[06:03] HipopotamoConPrisa 2 Pista: man*** ******* ********* 30 segundos y 5282 Puntos [06:03] HipopotamoConPrisa
2 Pista: man*** ******* ********* 30 segundos y 5282 Puntos
[06:03] Oveja-DelMonton palestina va a ser liberada [06:03] Oveja-DelMonton
palestina va a ser liberada
[06:03] Oveja-DelMonton del opresor [06:03] Oveja-DelMonton
del opresor
[06:04] HipopotamoConPrisa 3 Pista: manue* *a**ue* *o**a**a* 15 segundos y 5282 Puntos [06:04] HipopotamoConPrisa
3 Pista: manue* *a**ue* *o**a**a* 15 segundos y 5282 Puntos
[06:04] HipopotamoConPrisa Tiempo! La respuesta es -> manuel�azquez�ontalban <- [06:04] HipopotamoConPrisa
Tiempo! La respuesta es -> manuel�azquez�ontalban <-
[06:04] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [06:04] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[06:04] HipopotamoConPrisa Tri.20080 Cienciaɳtephenwo˿Aiqu郰1iequivalent3ipieshentmedidandealongitudb(entletras)?i?i [06:04] HipopotamoConPrisa
Tri.20080 Cienciaɳtephenwo˿Aiqu郰1iequivalent3ipieshentmedidandealongitudb(entletras)?i?i
[06:04] HipopotamoConPrisa 1 Pista: *** ***** Valor pregunta : 5776 Puntos [06:04] HipopotamoConPrisa
1 Pista: *** ***** Valor pregunta : 5776 Puntos
[06:04] Oveja-DelMonton y el nuevo israel sera argentina [06:04] Oveja-DelMonton
y el nuevo israel sera argentina
[06:04] Oveja-DelMonton por eso andan muy amigos los de israel de argentina [06:04] Oveja-DelMonton
por eso andan muy amigos los de israel de argentina
[06:04] HipopotamoConPrisa 2 Pista: una ***** 30 segundos y 5776 Puntos [06:04] HipopotamoConPrisa
2 Pista: una ***** 30 segundos y 5776 Puntos
[06:04] Oveja-DelMonton se van a volver a mover , pero ahora a america [06:04] Oveja-DelMonton
se van a volver a mover , pero ahora a america
[06:04] HipopotamoConPrisa 3 Pista: una *a**a 15 segundos y 5776 Puntos [06:04] HipopotamoConPrisa
3 Pista: una *a**a 15 segundos y 5776 Puntos
[06:05] HipopotamoConPrisa Tiempo! La respuesta es -> una�arda <- [06:05] HipopotamoConPrisa
Tiempo! La respuesta es -> una�arda <-
[06:05] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [06:05] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[06:05] HipopotamoConPrisa Tri.14205 MusicaɞLorien^˿DeoqueomusicohsonllosaLP'sa"Ommadawn",x"Amarok",x"Incantations",x"Crises",x"FiveoMilesaOut",x"Platinum",x"HergestqRidge"xyk"Islands"xentreomuchosaotros"x?x [06:05] HipopotamoConPrisa
Tri.14205 MusicaɞLorien^˿DeoqueomusicohsonllosaLP'sa"Ommadawn",x"Amarok",x"Incantations",x"Crises",x"FiveoMilesaOut",x"Platinum",x"HergestqRidge"xyk"Islands"xentreomuchosaotros"x?x
[06:05] HipopotamoConPrisa 1 Pista: **** ******** Valor pregunta : 24941 Puntos [06:05] HipopotamoConPrisa
1 Pista: **** ******** Valor pregunta : 24941 Puntos
[06:05] HipopotamoConPrisa 2 Pista: mik* ******** 30 segundos y 24941 Puntos [06:05] HipopotamoConPrisa
2 Pista: mik* ******** 30 segundos y 24941 Puntos
[06:05] HipopotamoConPrisa 3 Pista: mike o***ie** 15 segundos y 24941 Puntos [06:05] HipopotamoConPrisa
3 Pista: mike o***ie** 15 segundos y 24941 Puntos
[06:06] HipopotamoConPrisa Tiempo! La respuesta es -> mike�ldfield <- [06:06] HipopotamoConPrisa
Tiempo! La respuesta es -> mike�ldfield <-
[06:06] HipopotamoConPrisa For The Competitive Edge type !pingme [06:06] HipopotamoConPrisa
For The Competitive Edge type !pingme
[06:06] HipopotamoConPrisa Tri.1512 Historiaɴjmm.com˿Arqueolog�fߑu郰1fllamativasxpiezasxromanasx(siglovIV),fprodecentesxdelamunicipiovdexOntur,fpodemosxverwenbelaMuseovArqueol󧩣ovdexAlbacete?f?f [06:06] HipopotamoConPrisa
Tri.1512 Historiaɴjmm.com˿Arqueolog�fߑu郰1fllamativasxpiezasxromanasx(siglovIV),fprodecentesxdelamunicipiovdexOntur,fpodemosxverwenbelaMuseovArqueol󧩣ovdexAlbacete?f?f
[06:06] HipopotamoConPrisa 1 Pista: **񪪪* Valor pregunta : 23029 Puntos [06:06] HipopotamoConPrisa
1 Pista: **񪪪* Valor pregunta : 23029 Puntos
[06:06] HipopotamoConPrisa 2 Pista: Mu񪪪* 30 segundos y 23029 Puntos [06:06] HipopotamoConPrisa
2 Pista: Mu񪪪* 30 segundos y 23029 Puntos
[06:06] HipopotamoConPrisa 3 Pista: Mu񥪡* 15 segundos y 23029 Puntos [06:06] HipopotamoConPrisa
3 Pista: Mu񥪡* 15 segundos y 23029 Puntos
[06:07] HipopotamoConPrisa Tiempo! La respuesta es -> Mu񥣡s <- [06:07] HipopotamoConPrisa
Tiempo! La respuesta es -> Mu񥣡s <-
[06:07] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [06:07] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[06:07] HipopotamoConPrisa Tri.19119 Cineɴarra˄irectorufrancesedempeliculasecomo"CapitanaConan"(1996)"Lavvidavymnadavm᳢(1989)?p?p [06:07] HipopotamoConPrisa
Tri.19119 Cineɴarra˄irectorufrancesedempeliculasecomo"CapitanaConan"(1996)"Lavvidavymnadavm᳢(1989)?p?p
[06:07] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 13546 Puntos [06:07] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 13546 Puntos
[06:07] HipopotamoConPrisa 2 Pista: tav****** 30 segundos y 13546 Puntos [06:07] HipopotamoConPrisa
2 Pista: tav****** 30 segundos y 13546 Puntos
[06:07] HipopotamoConPrisa 3 Pista: tave**ie* 15 segundos y 13546 Puntos [06:07] HipopotamoConPrisa
3 Pista: tave**ie* 15 segundos y 13546 Puntos
[06:07] HipopotamoConPrisa Tiempo! La respuesta es -> tavernier <- [06:07] HipopotamoConPrisa
Tiempo! La respuesta es -> tavernier <-
[06:08] HipopotamoConPrisa R᮫ing MES: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1810239 #5: siva- 1210919 #6: Hipopotamo\Insufrible 989170 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [06:08] HipopotamoConPrisa
R᮫ing MES: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1810239 #5: siva- 1210919 #6: Hipopotamo\Insufrible 989170 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[06:08] HipopotamoConPrisa Tri.9821 Cienciaɤassler˿C󭯃01csetllamanlansuperficietplana,ysuavementetinclinada,yquetdesdetlashvertienteshmonta񯳡s,yenlazanconzellfondocdetunzvalletocdepresi󮿃01y?y [06:08] HipopotamoConPrisa
Tri.9821 Cienciaɤassler˿C󭯃01csetllamanlansuperficietplana,ysuavementetinclinada,yquetdesdetlashvertienteshmonta񯳡s,yenlazanconzellfondocdetunzvalletocdepresi󮿃01y?y
[06:08] HipopotamoConPrisa 1 Pista: ****** Pregunta de BONUS : 25000 Puntos [06:08] HipopotamoConPrisa
1 Pista: ****** Pregunta de BONUS : 25000 Puntos
[06:08] HipopotamoConPrisa 2 Pista: gla*** 30 segundos y 25000 Puntos [06:08] HipopotamoConPrisa
2 Pista: gla*** 30 segundos y 25000 Puntos
[06:08] HipopotamoConPrisa 3 Pista: gla*i* 15 segundos y 25000 Puntos [06:08] HipopotamoConPrisa
3 Pista: gla*i* 15 segundos y 25000 Puntos
[06:08] HipopotamoConPrisa Tiempo! La respuesta es -> glacis <- [06:08] HipopotamoConPrisa
Tiempo! La respuesta es -> glacis <-
[06:09] HipopotamoConPrisa Please refrain from using Extreme Bad Language [06:09] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[06:09] HipopotamoConPrisa Tri.14236 Cienciaɳtephenwo˿Cuᬃ01qesylalunidadmdersuperficiermḩmalennelqsistemalinglesymetrico?f?f [06:09] HipopotamoConPrisa
Tri.14236 Cienciaɳtephenwo˿Cuᬃ01qesylalunidadmdersuperficiermḩmalennelqsistemalinglesymetrico?f?f
[06:09] HipopotamoConPrisa 1 Pista: ***** ******** Pregunta de BONUS : 100000 Puntos [06:09] HipopotamoConPrisa
1 Pista: ***** ******** Pregunta de BONUS : 100000 Puntos
[06:09] HipopotamoConPrisa 2 Pista: mil** ******** 30 segundos y 100000 Puntos [06:09] HipopotamoConPrisa
2 Pista: mil** ******** 30 segundos y 100000 Puntos
[06:09] HipopotamoConPrisa 3 Pista: mil*a *ua**a*a 15 segundos y 100000 Puntos [06:09] HipopotamoConPrisa
3 Pista: mil*a *ua**a*a 15 segundos y 100000 Puntos
[06:09] HipopotamoConPrisa Tiempo! La respuesta es -> milla�uadrada <- [06:09] HipopotamoConPrisa
Tiempo! La respuesta es -> milla�uadrada <-
[06:09] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [06:09] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[06:09] HipopotamoConPrisa Tri.12518 Cineɴovarich˿CINCOjAяSjDESPUESjDEj"ORLANDO",jSALLYjPOTTERjREALIZOjUNAjPELICULAjDEjCORTEjMUSICAL.jENjCOLABORACIONjCONjELjBAILARINjPABLOjVERONjCUALjESjSUjTITULOj?j [06:09] HipopotamoConPrisa
Tri.12518 Cineɴovarich˿CINCOjAяSjDESPUESjDEj"ORLANDO",jSALLYjPOTTERjREALIZOjUNAjPELICULAjDEjCORTEjMUSICAL.jENjCOLABORACIONjCONjELjBAILARINjPABLOjVERONjCUALjESjSUjTITULOj?j
[06:09] HipopotamoConPrisa 1 Pista: ******* ** ***** Valor pregunta : 23108 Puntos [06:09] HipopotamoConPrisa
1 Pista: ******* ** ***** Valor pregunta : 23108 Puntos
[06:10] HipopotamoConPrisa 2 Pista: lec**** ** ***** 30 segundos y 23108 Puntos [06:10] HipopotamoConPrisa
2 Pista: lec**** ** ***** 30 segundos y 23108 Puntos
[06:10] HipopotamoConPrisa 3 Pista: lec*io* *e *a**o 15 segundos y 23108 Puntos [06:10] HipopotamoConPrisa
3 Pista: lec*io* *e *a**o 15 segundos y 23108 Puntos
[06:10] HipopotamoConPrisa Tiempo! La respuesta es -> leccion�e�ango <- [06:10] HipopotamoConPrisa
Tiempo! La respuesta es -> leccion�e�ango <-
[06:10] HipopotamoConPrisa This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [06:10] HipopotamoConPrisa
This WEEKS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[06:10] HipopotamoConPrisa Tri.20740 InformaticaɖaKaMiLKa˿Cualkeraaelkprocesadorwdeetextosem᳃01efamosobantesedeelaallegadaadeeMicrosoftgWordk?q [06:10] HipopotamoConPrisa
Tri.20740 InformaticaɖaKaMiLKa˿Cualkeraaelkprocesadorwdeetextosem᳃01efamosobantesedeelaallegadaadeeMicrosoftgWordk?q
[06:10] HipopotamoConPrisa 1 Pista: *********** Valor pregunta : 23223 Puntos [06:10] HipopotamoConPrisa
1 Pista: *********** Valor pregunta : 23223 Puntos
[06:11] HipopotamoConPrisa 2 Pista: wor******** 30 segundos y 23223 Puntos [06:11] HipopotamoConPrisa
2 Pista: wor******** 30 segundos y 23223 Puntos
[06:11] HipopotamoConPrisa 3 Pista: wor**e**e** 15 segundos y 23223 Puntos [06:11] HipopotamoConPrisa
3 Pista: wor**e**e** 15 segundos y 23223 Puntos
[06:11] HipopotamoConPrisa Tiempo! La respuesta es -> wordperfect <- [06:11] HipopotamoConPrisa
Tiempo! La respuesta es -> wordperfect <-
[06:11] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [06:11] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[06:11] HipopotamoConPrisa Tri.956 Fisica-Quimicaɤassler˿C󭯃01nsesllamahelmᣩdo-鳴erbpoli鮩concuyahf󲭵lahesnC25H34O4?e?e [06:11] HipopotamoConPrisa
Tri.956 Fisica-Quimicaɤassler˿C󭯃01nsesllamahelmᣩdo-鳴erbpoli鮩concuyahf󲭵lahesnC25H34O4?e?e
[06:11] HipopotamoConPrisa 1 Pista: ****** Pregunta de BONUS : 100000 Puntos [06:11] HipopotamoConPrisa
1 Pista: ****** Pregunta de BONUS : 100000 Puntos
[06:11] Oveja-DelMonton es hermoso iran [06:11] Oveja-DelMonton
es hermoso iran
[06:12] HipopotamoConPrisa 2 Pista: Bix*** 30 segundos y 100000 Puntos [06:12] HipopotamoConPrisa
2 Pista: Bix*** 30 segundos y 100000 Puntos
[06:12] HipopotamoConPrisa 3 Pista: Bixi*a 15 segundos y 100000 Puntos [06:12] HipopotamoConPrisa
3 Pista: Bixi*a 15 segundos y 100000 Puntos
[06:12] Hipopotamo\Insufrible Bixita [06:12] Hipopotamo\Insufrible
Bixita
[06:12] HipopotamoConPrisa Tiempo! La respuesta es -> Bixina <- [06:12] HipopotamoConPrisa
Tiempo! La respuesta es -> Bixina <-
[06:12] HipopotamoConPrisa This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604 [06:12] HipopotamoConPrisa
This MONTHS Top 11-20: - #11: HETEROFLEXIBLE 339385 #12: KaZuMa_KiRyU 338987 #13: GaSpAriNa 263345 #14: Oveja-DelMonton 239638 #15: VoRk 152884 #16: ViajeroDeTiempo21 116913 #17: wilby 100799 #18: Botones 58004 #19: gonsi 38799 #20: Tuberculo 24604
[06:12] HipopotamoConPrisa Tri.17936 PersonajesɗILDone˿(Filosofia)wquegfamosoyfilosofoydatahdelosigloyIVwd.C.w?w [06:12] HipopotamoConPrisa
Tri.17936 PersonajesɗILDone˿(Filosofia)wquegfamosoyfilosofoydatahdelosigloyIVwd.C.w?w
[06:12] HipopotamoConPrisa 1 Pista: *** ******* Valor pregunta : 15993 Puntos [06:12] HipopotamoConPrisa
1 Pista: *** ******* Valor pregunta : 15993 Puntos
[06:13] HipopotamoConPrisa 2 Pista: san ******* 30 segundos y 15993 Puntos [06:13] HipopotamoConPrisa
2 Pista: san ******* 30 segundos y 15993 Puntos
[06:13] HipopotamoConPrisa 3 Pista: san a*u**i* 15 segundos y 15993 Puntos [06:13] HipopotamoConPrisa
3 Pista: san a*u**i* 15 segundos y 15993 Puntos
[06:13] HipopotamoConPrisa Tiempo! La respuesta es -> san�gustin <- [06:13] HipopotamoConPrisa
Tiempo! La respuesta es -> san�gustin <-
[06:13] HipopotamoConPrisa R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516 [06:13] HipopotamoConPrisa
R᮫ing �ltima SEMANA: #1: Lince{Torpe 10195486 #2: Hipopotamo\Especial 5939773 #3: Mosca{ConInquietud 2670516
[06:13] HipopotamoConPrisa Tri.8439 Personajesɨowlita˿ComozselllamabacelyotrozhermanozartistacdelGustavxKlimt?j?j [06:13] HipopotamoConPrisa
Tri.8439 Personajesɨowlita˿ComozselllamabacelyotrozhermanozartistacdelGustavxKlimt?j?j
[06:13] HipopotamoConPrisa 1 Pista: ***** ***** Valor pregunta : 21667 Puntos [06:13] HipopotamoConPrisa
1 Pista: ***** ***** Valor pregunta : 21667 Puntos
[06:13] HipopotamoConPrisa 2 Pista: ern** ***** 30 segundos y 21667 Puntos [06:13] HipopotamoConPrisa
2 Pista: ern** ***** 30 segundos y 21667 Puntos
[06:14] HipopotamoConPrisa 3 Pista: ern** **i** 15 segundos y 21667 Puntos [06:14] HipopotamoConPrisa
3 Pista: ern** **i** 15 segundos y 21667 Puntos
[06:14] HipopotamoConPrisa Tiempo! La respuesta es -> ernst�limt <- [06:14] HipopotamoConPrisa
Tiempo! La respuesta es -> ernst�limt <-
[06:14] HipopotamoConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [06:14] HipopotamoConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[06:14] HipopotamoConPrisa Tri.5646 Idiomasɔhe_Bes˿Aleman-Espa񯬃01pKotelett?w?w [06:14] HipopotamoConPrisa
Tri.5646 Idiomasɔhe_Bes˿Aleman-Espa񯬃01pKotelett?w?w
[06:14] HipopotamoConPrisa 1 Pista: ******* ** ***** Valor pregunta : 7947 Puntos [06:14] HipopotamoConPrisa
1 Pista: ******* ** ***** Valor pregunta : 7947 Puntos
[06:14] HipopotamoConPrisa 2 Pista: chu**** ** ***** 30 segundos y 7947 Puntos [06:14] HipopotamoConPrisa
2 Pista: chu**** ** ***** 30 segundos y 7947 Puntos
[06:15] HipopotamoConPrisa 3 Pista: chu*e*a *e *e**o 15 segundos y 7947 Puntos [06:15] HipopotamoConPrisa
3 Pista: chu*e*a *e *e**o 15 segundos y 7947 Puntos
[06:15] HipopotamoConPrisa Tiempo! La respuesta es -> chuleta�e�erdo <- [06:15] HipopotamoConPrisa
Tiempo! La respuesta es -> chuleta�e�erdo <-
[06:15] HipopotamoConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [06:15] HipopotamoConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[06:15] HipopotamoConPrisa Tri.14729 DeporteɍARdeJAVA˿ENoQUɃ01oLIGAoJUEGANoLOSoEQUIPOSoDEoLOSo"MINNESOTAoTIMBERWOLVES"oYoLOSo"MEMPHISoGRIZZLIES"?o?o [06:15] HipopotamoConPrisa
Tri.14729 DeporteɍARdeJAVA˿ENoQUɃ01oLIGAoJUEGANoLOSoEQUIPOSoDEoLOSo"MINNESOTAoTIMBERWOLVES"oYoLOSo"MEMPHISoGRIZZLIES"?o?o
[06:15] HipopotamoConPrisa 1 Pista: *** Valor pregunta : 21422 Puntos [06:15] HipopotamoConPrisa
1 Pista: *** Valor pregunta : 21422 Puntos
[06:15] HipopotamoConPrisa 2 Pista: nba 30 segundos y 21422 Puntos [06:15] HipopotamoConPrisa
2 Pista: nba 30 segundos y 21422 Puntos
[06:15] Oveja\Suave Nba [06:15] Oveja\Suave
Nba
[06:15] Hipopotamo\Insufrible Nba [06:15] Hipopotamo\Insufrible
Nba
[06:15] HipopotamoConPrisa �Eso es Oveja\Suave!! Dijiste: "Nba" y ello te ha valido: �1422�12 puntos [06:15] HipopotamoConPrisa
�Eso es Oveja\Suave!! Dijiste: "Nba" y ello te ha valido: �1422�12 puntos
[06:15] HipopotamoConPrisa ACTION awards Oveja\Suave with a +v for having over 15000 points [06:15] HipopotamoConPrisa
ACTION awards Oveja\Suave with a +v for having over 15000 points
[06:15] HipopotamoConPrisa Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 208095, SEMANA: 1831661 y MES: 1831661 [06:15] HipopotamoConPrisa
Oveja\Suave has acertado 1 seguidas!! Puntos HOY: 208095, SEMANA: 1831661 y MES: 1831661
[06:16] HipopotamoConPrisa R᮫ing SEMANA: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1831661 #5: siva- 1210919 #6: Hipopotamo\Insufrible 989170 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [06:16] HipopotamoConPrisa
R᮫ing SEMANA: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1831661 #5: siva- 1210919 #6: Hipopotamo\Insufrible 989170 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[06:16] HipopotamoConPrisa Tri.10215 MitologiaɄUBLINERS˿ComotsegllamabakelchijotdegCronosbyzReak?x [06:16] HipopotamoConPrisa
Tri.10215 MitologiaɄUBLINERS˿ComotsegllamabakelchijotdegCronosbyzReak?x
[06:16] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 13090 Puntos [06:16] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 13090 Puntos
[06:16] HipopotamoConPrisa 2 Pista: had** 30 segundos y 13090 Puntos [06:16] HipopotamoConPrisa
2 Pista: had** 30 segundos y 13090 Puntos
[06:16] HipopotamoConPrisa 3 Pista: hade* 15 segundos y 13090 Puntos [06:16] HipopotamoConPrisa
3 Pista: hade* 15 segundos y 13090 Puntos
[06:16] Hipopotamo\Insufrible Hade [06:16] Hipopotamo\Insufrible
Hade
[06:16] HipopotamoConPrisa Tiempo! La respuesta es -> hades <- [06:16] HipopotamoConPrisa
Tiempo! La respuesta es -> hades <-
[06:16] HipopotamoConPrisa We feature over 50,000 Q&A ! [06:16] HipopotamoConPrisa
We feature over 50,000 Q&A !
[06:16] HipopotamoConPrisa Tri.10819 LiteraturaɔeLaRaNhA˿Autortdec"lagespa񡃰1ginmovil"f?f [06:16] HipopotamoConPrisa
Tri.10819 LiteraturaɔeLaRaNhA˿Autortdec"lagespa񡃰1ginmovil"f?f
[06:16] HipopotamoConPrisa 1 Pista: ******* ******* Valor pregunta : 6320 Puntos [06:16] HipopotamoConPrisa
1 Pista: ******* ******* Valor pregunta : 6320 Puntos
[06:17] HipopotamoConPrisa 2 Pista: ign**** ******* 30 segundos y 6320 Puntos [06:17] HipopotamoConPrisa
2 Pista: ign**** ******* 30 segundos y 6320 Puntos
[06:17] HipopotamoConPrisa 3 Pista: igna*io a**e*oa 15 segundos y 6320 Puntos [06:17] HipopotamoConPrisa
3 Pista: igna*io a**e*oa 15 segundos y 6320 Puntos
[06:17] HipopotamoConPrisa Tiempo! La respuesta es -> ignacio�ldecoa <- [06:17] HipopotamoConPrisa
Tiempo! La respuesta es -> ignacio�ldecoa <-
[06:17] HipopotamoConPrisa Tri.18683 LiteraturaɍARdeJAVAˑUɃ01zAUTORAzESPAяLAz(1947)zESCRIBIӃ01z"LAzVIDAzOCULTA"z?z [06:17] HipopotamoConPrisa
Tri.18683 LiteraturaɍARdeJAVAˑUɃ01zAUTORAzESPAяLAz(1947)zESCRIBIӃ01z"LAzVIDAzOCULTA"z?z
[06:17] HipopotamoConPrisa 1 Pista: ******* ********* Valor pregunta : 9665 Puntos [06:17] HipopotamoConPrisa
1 Pista: ******* ********* Valor pregunta : 9665 Puntos
[06:18] HipopotamoConPrisa 2 Pista: sol**** ********* 30 segundos y 9665 Puntos [06:18] HipopotamoConPrisa
2 Pista: sol**** ********* 30 segundos y 9665 Puntos
[06:18] HipopotamoConPrisa 3 Pista: sole*a* *ue**o*a* 15 segundos y 9665 Puntos [06:18] HipopotamoConPrisa
3 Pista: sole*a* *ue**o*a* 15 segundos y 9665 Puntos
[06:18] HipopotamoConPrisa Tiempo! La respuesta es -> soledad�uertolas <- [06:18] HipopotamoConPrisa
Tiempo! La respuesta es -> soledad�uertolas <-
[06:18] HipopotamoConPrisa Tri.15216 MiscelaneaɔeLaRaNhA˿Caballoaalquiladoa?p [06:18] HipopotamoConPrisa
Tri.15216 MiscelaneaɔeLaRaNhA˿Caballoaalquiladoa?p
[06:18] HipopotamoConPrisa 1 Pista: ***** ******* Valor pregunta : 15366 Puntos [06:18] HipopotamoConPrisa
1 Pista: ***** ******* Valor pregunta : 15366 Puntos
[06:19] HipopotamoConPrisa 2 Pista: nun** ******* 30 segundos y 15366 Puntos [06:19] HipopotamoConPrisa
2 Pista: nun** ******* 30 segundos y 15366 Puntos
[06:19] HipopotamoConPrisa 3 Pista: nun*a *a**a*o 15 segundos y 15366 Puntos [06:19] HipopotamoConPrisa
3 Pista: nun*a *a**a*o 15 segundos y 15366 Puntos
[06:19] HipopotamoConPrisa Tiempo! La respuesta es -> nunca�ansado <- [06:19] HipopotamoConPrisa
Tiempo! La respuesta es -> nunca�ansado <-
[06:19] HipopotamoConPrisa Please remember this is a FREE service, Please do not complain [06:19] HipopotamoConPrisa
Please remember this is a FREE service, Please do not complain
[06:19] HipopotamoConPrisa Tri.11744 LiteraturaɔeLaRaNhA˿Autorfdeo"dueloyeneeloparaiso"c?c [06:19] HipopotamoConPrisa
Tri.11744 LiteraturaɔeLaRaNhA˿Autorfdeo"dueloyeneeloparaiso"c?c
[06:19] HipopotamoConPrisa 1 Pista: **** ********* Valor pregunta : 13268 Puntos [06:19] HipopotamoConPrisa
1 Pista: **** ********* Valor pregunta : 13268 Puntos
[06:19] HipopotamoConPrisa 2 Pista: jua* ********* 30 segundos y 13268 Puntos [06:19] HipopotamoConPrisa
2 Pista: jua* ********* 30 segundos y 13268 Puntos
[06:20] HipopotamoConPrisa 3 Pista: jua* *o**i*o*o 15 segundos y 13268 Puntos [06:20] HipopotamoConPrisa
3 Pista: jua* *o**i*o*o 15 segundos y 13268 Puntos
[06:20] HipopotamoConPrisa Tiempo! La respuesta es -> juan�oytisolo <- [06:20] HipopotamoConPrisa
Tiempo! La respuesta es -> juan�oytisolo <-
[06:20] HipopotamoConPrisa R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898 [06:20] HipopotamoConPrisa
R᮫ing �ltimo MES: #1: Lince{Torpe 30671411 #2: Oveja-DelMonton 23569079 #3: Hipopotamo\Especial 16976126 #4: Mosca{ConInquietud 14420182 #5: Karen 13500898
[06:20] HipopotamoConPrisa Tri.14760 GastronomiaɊoTaKe-˿yCuᬃ01uesgelucolormdeluplatoc'chipironesgenlsuttinta'?y?y [06:20] HipopotamoConPrisa
Tri.14760 GastronomiaɊoTaKe-˿yCuᬃ01uesgelucolormdeluplatoc'chipironesgenlsuttinta'?y?y
[06:20] HipopotamoConPrisa 1 Pista: ***** Valor pregunta : 14057 Puntos [06:20] HipopotamoConPrisa
1 Pista: ***** Valor pregunta : 14057 Puntos
[06:20] HipopotamoConPrisa 2 Pista: neg** 30 segundos y 14057 Puntos [06:20] HipopotamoConPrisa
2 Pista: neg** 30 segundos y 14057 Puntos
[06:21] HipopotamoConPrisa 3 Pista: neg*o 15 segundos y 14057 Puntos [06:21] HipopotamoConPrisa
3 Pista: neg*o 15 segundos y 14057 Puntos
[06:21] HipopotamoConPrisa Tiempo! La respuesta es -> negro <- [06:21] HipopotamoConPrisa
Tiempo! La respuesta es -> negro <-
[06:21] HipopotamoConPrisa If you think a Q&A is wrong, please call an OP [06:21] HipopotamoConPrisa
If you think a Q&A is wrong, please call an OP
[06:21] HipopotamoConPrisa Tri.16559 Cienciaɴjmm.comːeque񯃰1zaparatozimprescindiblezenmelectr󮩣ahparahmedirjresistencias,svoltajes,sintensidades....s?s [06:21] HipopotamoConPrisa
Tri.16559 Cienciaɴjmm.comːeque񯃰1zaparatozimprescindiblezenmelectr󮩣ahparahmedirjresistencias,svoltajes,sintensidades....s?s
[06:21] HipopotamoConPrisa 1 Pista: ********* Valor pregunta : 7513 Puntos [06:21] HipopotamoConPrisa
1 Pista: ********* Valor pregunta : 7513 Puntos
[06:21] HipopotamoConPrisa 2 Pista: pol****** 30 segundos y 7513 Puntos [06:21] HipopotamoConPrisa
2 Pista: pol****** 30 segundos y 7513 Puntos
[06:22] HipopotamoConPrisa 3 Pista: poli*e**o 15 segundos y 7513 Puntos [06:22] HipopotamoConPrisa
3 Pista: poli*e**o 15 segundos y 7513 Puntos
[06:22] HipopotamoConPrisa Tiempo! La respuesta es -> polimetro <- [06:22] HipopotamoConPrisa
Tiempo! La respuesta es -> polimetro <-
[06:22] HipopotamoConPrisa R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226 [06:22] HipopotamoConPrisa
R᮫ing por D́: - Domingo: Mosca{ConInquietud 3057578 Lunes: Hipopotamo\Especial 1099384 Martes: Hipopotamo\Especial 3056297 Miercoles: Lince{Torpe 1733612 Jueves: Mosca{ConInquietud 4912954 Viernes: Mosca{ConInquietud 2405096 Sᢡdo: Hipopotamo\Especial 1635226
[06:22] HipopotamoConPrisa Tri.9486 Geografiaɓebosin˿Enqqu郰1yislafsejencuentrafFongafale,yCapitalxdejTuvalu?y?y [06:22] HipopotamoConPrisa
Tri.9486 Geografiaɓebosin˿Enqqu郰1yislafsejencuentrafFongafale,yCapitalxdejTuvalu?y?y
[06:22] HipopotamoConPrisa 1 Pista: ******** Valor pregunta : 8476 Puntos [06:22] HipopotamoConPrisa
1 Pista: ******** Valor pregunta : 8476 Puntos
[06:22] HipopotamoConPrisa 2 Pista: fun***** 30 segundos y 8476 Puntos [06:22] HipopotamoConPrisa
2 Pista: fun***** 30 segundos y 8476 Puntos
[06:22] HipopotamoConPrisa 3 Pista: funa*u*i 15 segundos y 8476 Puntos [06:22] HipopotamoConPrisa
3 Pista: funa*u*i 15 segundos y 8476 Puntos
[06:23] HipopotamoConPrisa Tiempo! La respuesta es -> funafuti <- [06:23] HipopotamoConPrisa
Tiempo! La respuesta es -> funafuti <-
[06:23] HipopotamoConPrisa For The Competitive Edge type !pingme [06:23] HipopotamoConPrisa
For The Competitive Edge type !pingme
[06:23] HipopotamoConPrisa Tri.1532 GastronomiaɃanon˿Cualifueeeliprimeracafeeinstantaneoe?m [06:23] HipopotamoConPrisa
Tri.1532 GastronomiaɃanon˿Cualifueeeliprimeracafeeinstantaneoe?m
[06:23] HipopotamoConPrisa 1 Pista: ******* Valor pregunta : 14546 Puntos [06:23] HipopotamoConPrisa
1 Pista: ******* Valor pregunta : 14546 Puntos
[06:23] HipopotamoConPrisa 2 Pista: Nes**** 30 segundos y 14546 Puntos [06:23] HipopotamoConPrisa
2 Pista: Nes**** 30 segundos y 14546 Puntos
[06:23] HipopotamoConPrisa 3 Pista: Nes*a*e 15 segundos y 14546 Puntos [06:23] HipopotamoConPrisa
3 Pista: Nes*a*e 15 segundos y 14546 Puntos
[06:24] HipopotamoConPrisa Tiempo! La respuesta es -> Nescafe <- [06:24] HipopotamoConPrisa
Tiempo! La respuesta es -> Nescafe <-
[06:24] HipopotamoConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [06:24] HipopotamoConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[06:24] HipopotamoConPrisa Tri.6960 Deporteɚytox˿CualjesoeljnombrefdeflaucarreraudefcaballosofundadauporoeljcondefinglesodefDerbyl?t [06:24] HipopotamoConPrisa
Tri.6960 Deporteɚytox˿CualjesoeljnombrefdeflaucarreraudefcaballosofundadauporoeljcondefinglesodefDerbyl?t
[06:24] HipopotamoConPrisa 1 Pista: ***** ** ***** Valor pregunta : 8200 Puntos [06:24] HipopotamoConPrisa
1 Pista: ***** ** ***** Valor pregunta : 8200 Puntos
[06:24] HipopotamoConPrisa 2 Pista: der** ** ***** 30 segundos y 8200 Puntos [06:24] HipopotamoConPrisa
2 Pista: der** ** ***** 30 segundos y 8200 Puntos
[06:24] HipopotamoConPrisa 3 Pista: der** *e e**o* 15 segundos y 8200 Puntos [06:24] HipopotamoConPrisa
3 Pista: der** *e e**o* 15 segundos y 8200 Puntos
[06:25] HipopotamoConPrisa Tiempo! La respuesta es -> derby�e�psom <- [06:25] HipopotamoConPrisa
Tiempo! La respuesta es -> derby�e�psom <-
[06:25] HipopotamoConPrisa R᮫ing MES: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1831661 #5: siva- 1210919 #6: Hipopotamo\Insufrible 989170 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861 [06:25] HipopotamoConPrisa
R᮫ing MES: - #1: Hipopotamo\Especial 13515338 #2: Mosca{ConInquietud 12486913 #3: Lince{Torpe 5706583 #4: Oveja\Suave 1831661 #5: siva- 1210919 #6: Hipopotamo\Insufrible 989170 #7: Ketzy 610128 #8: Sirena__ 563174 #9: kitana_- 534436 #10: Javyxd 431861
[06:25] HipopotamoConPrisa Tri.8478 ArteɌunera˿(Diccionario)zFusteadealaxcolumnax?z [06:25] HipopotamoConPrisa
Tri.8478 ArteɌunera˿(Diccionario)zFusteadealaxcolumnax?z
[06:25] HipopotamoConPrisa 1 Pista: ****** Pregunta de BONUS : 200000 Puntos [06:25] HipopotamoConPrisa
1 Pista: ****** Pregunta de BONUS : 200000 Puntos
[06:25] HipopotamoConPrisa 2 Pista: esc*** 30 segundos y 200000 Puntos [06:25] HipopotamoConPrisa
2 Pista: esc*** 30 segundos y 200000 Puntos
[06:25] HipopotamoConPrisa 3 Pista: esca*o 15 segundos y 200000 Puntos [06:25] HipopotamoConPrisa
3 Pista: esca*o 15 segundos y 200000 Puntos
[06:26] HipopotamoConPrisa Tiempo! La respuesta es -> escapo <- [06:26] HipopotamoConPrisa
Tiempo! La respuesta es -> escapo <-
[06:26] HipopotamoConPrisa Please refrain from using Extreme Bad Language [06:26] HipopotamoConPrisa
Please refrain from using Extreme Bad Language
[06:26] HipopotamoConPrisa Tri.16728 Deporteɨupper˿(NBA)SEGUNhANDREShMONTES,ߑUIENhEShAMERICANhGRAFFITI?h?h [06:26] HipopotamoConPrisa
Tri.16728 Deporteɨupper˿(NBA)SEGUNhANDREShMONTES,ߑUIENhEShAMERICANhGRAFFITI?h?h
[06:26] HipopotamoConPrisa 1 Pista: ******* ********** Pregunta de BONUS : 25000 Puntos [06:26] HipopotamoConPrisa
1 Pista: ******* ********** Pregunta de BONUS : 25000 Puntos
[06:26] HipopotamoConPrisa 2 Pista: pre**** ********** 30 segundos y 25000 Puntos [06:26] HipopotamoConPrisa
2 Pista: pre**** ********** 30 segundos y 25000 Puntos
[06:26] HipopotamoConPrisa 3 Pista: pre**a* **o*a*o*i* 15 segundos y 25000 Puntos [06:26] HipopotamoConPrisa
3 Pista: pre**a* **o*a*o*i* 15 segundos y 25000 Puntos
[06:26] HipopotamoConPrisa Tiempo! La respuesta es -> predrag�tojakovic <- [06:26] HipopotamoConPrisa
Tiempo! La respuesta es -> predrag�tojakovic <-
[06:27] HipopotamoConPrisa This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa [06:27] HipopotamoConPrisa
This is #Mexico, I am your host HipopotamoConPrisa, running HipopotamoConPrisa
[06:27] HipopotamoConPrisa Tri.9591 Politicaɡnghara˿Ahqui鮃01casesin󃰱hNathurancGodsepenc1948h?h [06:27] HipopotamoConPrisa
Tri.9591 Politicaɡnghara˿Ahqui鮃01casesin󃰱hNathurancGodsepenc1948h?h
[06:27] HipopotamoConPrisa 1 Pista: ****** Valor pregunta : 23163 Puntos [06:27] HipopotamoConPrisa
1 Pista: ****** Valor pregunta : 23163 Puntos
[06:27] HipopotamoConPrisa 2 Pista: gan*** 30 segundos y 23163 Puntos [06:27] HipopotamoConPrisa
2 Pista: gan*** 30 segundos y 23163 Puntos
[06:27] HipopotamoConPrisa 3 Pista: gan**i 15 segundos y 23163 Puntos [06:27] HipopotamoConPrisa
3 Pista: gan**i 15 segundos y 23163 Puntos
[06:27] HipopotamoConPrisa Tiempo! La respuesta es -> gandhi <- [06:27] HipopotamoConPrisa
Tiempo! La respuesta es -> gandhi <-
[06:27] HipopotamoConPrisa Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar [06:27] HipopotamoConPrisa
Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar
Reportar Volver Historia anterior Historia siguiente
0
| Compartir en: