Historia de #mexico 04/03/2026 03:16 3 visitas

Hour Alias Mensaje Mensaje
[03:16] Oveja{ConPrisa !jugaar [03:16] Oveja{ConPrisa
!jugaar
[03:16] Caracol_ConBravura Una sola a [03:16] Caracol_ConBravura
Una sola a
[03:17] Caracol_ConBravura Escribiste mal Oveja{ConPrisa [03:17] Caracol_ConBravura
Escribiste mal Oveja{ConPrisa
[03:17] Oveja{ConPrisa 3psicologia [03:17] Oveja{ConPrisa
3psicologia
[03:17] Caracol_ConBravura Vas alli [03:17] Caracol_ConBravura
Vas alli
[03:17] Oveja{ConPrisa gracias [03:17] Oveja{ConPrisa
gracias
[03:17] Caracol_ConBravura ^^ [03:17] Caracol_ConBravura
^^
[03:17] Oveja{ConPrisa °jugar [03:17] Oveja{ConPrisa
°jugar
[03:17] Caracol_ConBravura !jugar [03:17] Caracol_ConBravura
!jugar
[03:17] Avestruz_ConPrisa EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!! [03:17] Avestruz_ConPrisa
EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!!
[03:17] Caracol_ConBravura ^^ [03:17] Caracol_ConBravura
^^
[03:18] Oveja{ConPrisa cómo has estado kitana? [03:18] Oveja{ConPrisa
cómo has estado kitana?
[03:18] Avestruz_ConPrisa R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516 [03:18] Avestruz_ConPrisa
R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516
[03:18] Avestruz_ConPrisa Tri.11910 MusicaɌOCUTUS˿LaucantantesdesCapercailliessesllama...l?l [03:18] Avestruz_ConPrisa
Tri.11910 MusicaɌOCUTUS˿LaucantantesdesCapercailliessesllama...l?l
[03:18] Avestruz_ConPrisa 1 Pista: ***** ******** Valor pregunta : 9680 Puntos [03:18] Avestruz_ConPrisa
1 Pista: ***** ******** Valor pregunta : 9680 Puntos
[03:18] Caracol_ConBravura Fino [03:18] Caracol_ConBravura
Fino
[03:18] Avestruz_ConPrisa 2 Pista: kar** ******** 30 segundos y 9680 Puntos [03:18] Avestruz_ConPrisa
2 Pista: kar** ******** 30 segundos y 9680 Puntos
[03:18] Avestruz_ConPrisa 3 Pista: kare* *a**e*o* 15 segundos y 9680 Puntos [03:18] Avestruz_ConPrisa
3 Pista: kare* *a**e*o* 15 segundos y 9680 Puntos
[03:18] Avestruz_ConPrisa Tiempo! La respuesta es -> karen�atheson <- [03:18] Avestruz_ConPrisa
Tiempo! La respuesta es -> karen�atheson <-
[03:19] Avestruz_ConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:19] Avestruz_ConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:19] Avestruz_ConPrisa Tri.16970 Cancionesɤassler˿Dewqu郰1bgrupojesllapcanci󮃰1l"bUnderiPressurew"b?"b?b [03:19] Avestruz_ConPrisa
Tri.16970 Cancionesɤassler˿Dewqu郰1bgrupojesllapcanci󮃰1l"bUnderiPressurew"b?"b?b
[03:19] Avestruz_ConPrisa 1 Pista: ***** Valor pregunta : 16471 Puntos [03:19] Avestruz_ConPrisa
1 Pista: ***** Valor pregunta : 16471 Puntos
[03:19] Avestruz_ConPrisa 2 Pista: que** 30 segundos y 16471 Puntos [03:19] Avestruz_ConPrisa
2 Pista: que** 30 segundos y 16471 Puntos
[03:19] Oveja{ConPrisa queen [03:19] Oveja{ConPrisa
queen
[03:19] Avestruz_ConPrisa �Increible!! Oveja{ConPrisa contest󺠃04"queen" en �3.047 segundos, y ha ganado �6471�12 puntos [03:19] Avestruz_ConPrisa
�Increible!! Oveja{ConPrisa contest󺠃04"queen" en �3.047 segundos, y ha ganado �6471�12 puntos
[03:19] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:19] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:19] Avestruz_ConPrisa Oveja{ConPrisa has acertado 1 seguidas!! Puntos HOY: 16471, SEMANA: 1581235 y MES: 1581235 [03:19] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 1 seguidas!! Puntos HOY: 16471, SEMANA: 1581235 y MES: 1581235
[03:19] Avestruz_ConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:19] Avestruz_ConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:19] Avestruz_ConPrisa Tri.8118 Cotilleo-TVɍARLANARE˿ENeQUEeSERIEeSUePROTAGONISTAeMOVIAeSUeNARIZePARAeHACEReMAGIA?e?e [03:19] Avestruz_ConPrisa
Tri.8118 Cotilleo-TVɍARLANARE˿ENeQUEeSERIEeSUePROTAGONISTAeMOVIAeSUeNARIZePARAeHACEReMAGIA?e?e
[03:19] Avestruz_ConPrisa 1 Pista: ********* Valor pregunta : 12937 Puntos [03:19] Avestruz_ConPrisa
1 Pista: ********* Valor pregunta : 12937 Puntos
[03:19] Avestruz_ConPrisa 2 Pista: emb****** 30 segundos y 12937 Puntos [03:19] Avestruz_ConPrisa
2 Pista: emb****** 30 segundos y 12937 Puntos
[03:19] Oveja{ConPrisa hechizada [03:19] Oveja{ConPrisa
hechizada
[03:20] Avestruz_ConPrisa 3 Pista: emb*u*a*a 15 segundos y 12937 Puntos [03:20] Avestruz_ConPrisa
3 Pista: emb*u*a*a 15 segundos y 12937 Puntos
[03:20] Oveja{ConPrisa embrujada [03:20] Oveja{ConPrisa
embrujada
[03:20] Avestruz_ConPrisa �Est᳠que lo tiras Oveja{ConPrisa!! ߃󭯠supiste que "embrujada" era la respuesta? Venga, �2937�12 puntos suben a tu marcador [03:20] Avestruz_ConPrisa
�Est᳠que lo tiras Oveja{ConPrisa!! ߃󭯠supiste que "embrujada" era la respuesta? Venga, �2937�12 puntos suben a tu marcador
[03:20] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:20] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:20] Avestruz_ConPrisa Oveja{ConPrisa has acertado 2 seguidas!! Puntos HOY: 29408, SEMANA: 1594172 y MES: 1594172 [03:20] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 2 seguidas!! Puntos HOY: 29408, SEMANA: 1594172 y MES: 1594172
[03:20] Avestruz_ConPrisa R᮫ing SEMANA: - #1: Gallina\Elocuente 6831927 #2: Danielitto 4093466 #3: Oveja{ConPrisa 1594172 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [03:20] Avestruz_ConPrisa
R᮫ing SEMANA: - #1: Gallina\Elocuente 6831927 #2: Danielitto 4093466 #3: Oveja{ConPrisa 1594172 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[03:20] Avestruz_ConPrisa Tri.9113 Arteɖivianne˿ESCUELAoPICTӒICAoAoLAoQUEoPERTENECIOoJANoVANoEYCKo(S.oXV)o?o [03:20] Avestruz_ConPrisa
Tri.9113 Arteɖivianne˿ESCUELAoPICTӒICAoAoLAoQUEoPERTENECIOoJANoVANoEYCKo(S.oXV)o?o
[03:20] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 5107 Puntos [03:20] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 5107 Puntos
[03:20] Avestruz_ConPrisa 2 Pista: fla***** 30 segundos y 5107 Puntos [03:20] Avestruz_ConPrisa
2 Pista: fla***** 30 segundos y 5107 Puntos
[03:20] Avestruz_ConPrisa 3 Pista: fla*e**a 15 segundos y 5107 Puntos [03:20] Avestruz_ConPrisa
3 Pista: fla*e**a 15 segundos y 5107 Puntos
[03:21] Avestruz_ConPrisa �Oveja{ConPrisa acert󡡠La respuesta era: "flamenca" y contest󠥮 �1.547 segundos. Se lleva: �107�12 puntos [03:21] Avestruz_ConPrisa
�Oveja{ConPrisa acert󡡠La respuesta era: "flamenca" y contest󠥮 �1.547 segundos. Se lleva: �107�12 puntos
[03:21] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:21] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:21] Avestruz_ConPrisa Oveja{ConPrisa has acertado 3 seguidas!! Puntos HOY: 34515, SEMANA: 1599279 y MES: 1599279 [03:21] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 3 seguidas!! Puntos HOY: 34515, SEMANA: 1599279 y MES: 1599279
[03:21] Oveja{ConPrisa flamenca [03:21] Oveja{ConPrisa
flamenca
[03:21] Avestruz_ConPrisa We feature over 50,000 Q&A ! [03:21] Avestruz_ConPrisa
We feature over 50,000 Q&A !
[03:21] Avestruz_ConPrisa Tri.14504 Cotilleo-TVɣalce˿Eniqu郰1glocalidadjestabarhaciendojlarmiliplarempanadillardemMartesnyi13g?g [03:21] Avestruz_ConPrisa
Tri.14504 Cotilleo-TVɣalce˿Eniqu郰1glocalidadjestabarhaciendojlarmiliplarempanadillardemMartesnyi13g?g
[03:21] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 8228 Puntos [03:21] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 8228 Puntos
[03:21] Avestruz_ConPrisa 2 Pista: mos***** 30 segundos y 8228 Puntos [03:21] Avestruz_ConPrisa
2 Pista: mos***** 30 segundos y 8228 Puntos
[03:21] Avestruz_ConPrisa �Bingo!! Oveja{ConPrisa dio la respuesta: "mostoles" en �2.766 segundos e incrementa sus ganancias con �228�12 puntos [03:21] Avestruz_ConPrisa
�Bingo!! Oveja{ConPrisa dio la respuesta: "mostoles" en �2.766 segundos e incrementa sus ganancias con �228�12 puntos
[03:21] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:21] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:21] Avestruz_ConPrisa Oveja{ConPrisa has acertado 4 seguidas!! Puntos HOY: 42743, SEMANA: 1607507 y MES: 1607507 [03:21] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 4 seguidas!! Puntos HOY: 42743, SEMANA: 1607507 y MES: 1607507
[03:21] Oveja{ConPrisa mostoles [03:21] Oveja{ConPrisa
mostoles
[03:21] Avestruz_ConPrisa Tri.16759 Idiomasɓebosin˿Diccionario-Cuᬃ01xdellascsiguientescpalabrascestჰ1rcorrectamentelescrita:respeler,rpibote,rprevisivo,raxfisiar?r?r [03:21] Avestruz_ConPrisa
Tri.16759 Idiomasɓebosin˿Diccionario-Cuᬃ01xdellascsiguientescpalabrascestჰ1rcorrectamentelescrita:respeler,rpibote,rprevisivo,raxfisiar?r?r
[03:21] Avestruz_ConPrisa 1 Pista: ********* Valor pregunta : 5155 Puntos [03:21] Avestruz_ConPrisa
1 Pista: ********* Valor pregunta : 5155 Puntos
[03:22] Avestruz_ConPrisa 2 Pista: pre****** 30 segundos y 5155 Puntos [03:22] Avestruz_ConPrisa
2 Pista: pre****** 30 segundos y 5155 Puntos
[03:22] Oveja{ConPrisa previsivo [03:22] Oveja{ConPrisa
previsivo
[03:22] Avestruz_ConPrisa �e nota que sabes mucho de esto Oveja{ConPrisa! Tu respuesta "previsivo" es correcta y ganas �155�12 puntos [03:22] Avestruz_ConPrisa
�e nota que sabes mucho de esto Oveja{ConPrisa! Tu respuesta "previsivo" es correcta y ganas �155�12 puntos
[03:22] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:22] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:22] Avestruz_ConPrisa Oveja{ConPrisa has acertado 5 seguidas!! Puntos HOY: 47898, SEMANA: 1612662 y MES: 1612662 [03:22] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 5 seguidas!! Puntos HOY: 47898, SEMANA: 1612662 y MES: 1612662
[03:22] Gallina\Elocuente [Mandril}Letal] buenas noxes! [03:22] Gallina\Elocuente
[Mandril}Letal] buenas noxes!
[03:22] Avestruz_ConPrisa Tri.4754 Medicina-SaludɍARdeJAVA˄OLORmESPASMӄICOmDELmHIPOGASTRIO,mPORmENCIMAmYmPORmDETR�mDELmPUBIS;mQUEmPUEDEmINDICARmLAmPRESENCIAmDEmUNAmCISTITIS,mC�CULOSmVESICALES,mTUMORmVESICAL,mHIPERTROFIAmPROST�ICA,mAS̓01mCOMOmENFERMEDADESmDEmLOSmӒGANOSmSEXUALES.m?m [03:22] Avestruz_ConPrisa
Tri.4754 Medicina-SaludɍARdeJAVA˄OLORmESPASMӄICOmDELmHIPOGASTRIO,mPORmENCIMAmYmPORmDETR�mDELmPUBIS;mQUEmPUEDEmINDICARmLAmPRESENCIAmDEmUNAmCISTITIS,mC�CULOSmVESICALES,mTUMORmVESICAL,mHIPERTROFIAmPROST�ICA,mAS̓01mCOMOmENFERMEDADESmDEmLOSmӒGANOSmSEXUALES.m?m
[03:22] Avestruz_ConPrisa 1 Pista: ******** ******* Valor pregunta : 15716 Puntos [03:22] Avestruz_ConPrisa
1 Pista: ******** ******* Valor pregunta : 15716 Puntos
[03:22] Avestruz_ConPrisa 2 Pista: cal***** ******* 30 segundos y 15716 Puntos [03:22] Avestruz_ConPrisa
2 Pista: cal***** ******* 30 segundos y 15716 Puntos
[03:22] Mandril}Letal buenas noches Gallina\Elocuente [03:22] Mandril}Letal
buenas noches Gallina\Elocuente
[03:22] Avestruz_ConPrisa 3 Pista: cala***e *e*i*a* 15 segundos y 15716 Puntos [03:22] Avestruz_ConPrisa
3 Pista: cala***e *e*i*a* 15 segundos y 15716 Puntos
[03:23] Oveja{ConPrisa calculos renales [03:23] Oveja{ConPrisa
calculos renales
[03:23] Cocodrilo{Suave Oveja{ConPrisa hola saludos [03:23] Cocodrilo{Suave
Oveja{ConPrisa hola saludos
[03:23] Avestruz_ConPrisa Tiempo! La respuesta es -> calambre�esical <- [03:23] Avestruz_ConPrisa
Tiempo! La respuesta es -> calambre�esical <-
[03:23] Gallina\Elocuente gracias :)) [03:23] Gallina\Elocuente
gracias :))
[03:23] Cocodrilo{Suave Mandril}Letal saludos saludos [03:23] Cocodrilo{Suave
Mandril}Letal saludos saludos
[03:23] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [03:23] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[03:23] Avestruz_ConPrisa Tri.8254 Biologiaɋyla˿Aldondemvierten,llosnporocanales,llasnenzimasnproteoliticosndurantemlawmudawendlosnArtropodos?l?l [03:23] Avestruz_ConPrisa
Tri.8254 Biologiaɋyla˿Aldondemvierten,llosnporocanales,llasnenzimasnproteoliticosndurantemlawmudawendlosnArtropodos?l?l
[03:23] Avestruz_ConPrisa 1 Pista: ************ ***** Valor pregunta : 16870 Puntos [03:23] Avestruz_ConPrisa
1 Pista: ************ ***** Valor pregunta : 16870 Puntos
[03:23] Caracol_ConBravura Mandril}Letal senoritoooooooooooooooo feliz navidad xD [03:23] Caracol_ConBravura
Mandril}Letal senoritoooooooooooooooo feliz navidad xD
[03:23] Mandril}Letal saludos, Cocodrilo{Suave [03:23] Mandril}Letal
saludos, Cocodrilo{Suave
[03:23] Avestruz_ConPrisa 2 Pista: end********* ***** 30 segundos y 16870 Puntos [03:23] Avestruz_ConPrisa
2 Pista: end********* ***** 30 segundos y 16870 Puntos
[03:23] Mandril}Letal feliz san valentin, Caracol_ConBravura [03:23] Mandril}Letal
feliz san valentin, Caracol_ConBravura
[03:23] Oveja{ConPrisa espacio exuvial [03:23] Oveja{ConPrisa
espacio exuvial
[03:23] Avestruz_ConPrisa 3 Pista: endo*u*i*u*a *ie*a 15 segundos y 16870 Puntos [03:23] Avestruz_ConPrisa
3 Pista: endo*u*i*u*a *ie*a 15 segundos y 16870 Puntos
[03:23] Mandril}Letal buenas noches Caracol_ConBravura [03:23] Mandril}Letal
buenas noches Caracol_ConBravura
[03:24] Avestruz_ConPrisa Tiempo! La respuesta es -> endocuticula�ieja <- [03:24] Avestruz_ConPrisa
Tiempo! La respuesta es -> endocuticula�ieja <-
[03:24] Avestruz_ConPrisa R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898 [03:24] Avestruz_ConPrisa
R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898
[03:24] Avestruz_ConPrisa Tri.5352 Cancionesɢoquer˿Dezquezgruposesllaxcancioni"b20bdezabrilh"b?b [03:24] Avestruz_ConPrisa
Tri.5352 Cancionesɢoquer˿Dezquezgruposesllaxcancioni"b20bdezabrilh"b?b
[03:24] Avestruz_ConPrisa 1 Pista: ****** ****** Valor pregunta : 20358 Puntos [03:24] Avestruz_ConPrisa
1 Pista: ****** ****** Valor pregunta : 20358 Puntos
[03:24] Avestruz_ConPrisa 2 Pista: cel*** ****** 30 segundos y 20358 Puntos [03:24] Avestruz_ConPrisa
2 Pista: cel*** ****** 30 segundos y 20358 Puntos
[03:24] Oveja{ConPrisa celtas cortos [03:24] Oveja{ConPrisa
celtas cortos
[03:24] Avestruz_ConPrisa �emuestra lo que sabes Oveja{ConPrisa! Has respondido "celtas cortos" correctamente y eso te da: �0358�12 puntos [03:24] Avestruz_ConPrisa
�emuestra lo que sabes Oveja{ConPrisa! Has respondido "celtas cortos" correctamente y eso te da: �0358�12 puntos
[03:24] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:24] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:24] Avestruz_ConPrisa Oveja{ConPrisa has acertado 6 seguidas!! Puntos HOY: 68256, SEMANA: 1633020 y MES: 1633020 [03:24] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 6 seguidas!! Puntos HOY: 68256, SEMANA: 1633020 y MES: 1633020
[03:24] Avestruz_ConPrisa If you think a Q&A is wrong, please call an OP [03:24] Avestruz_ConPrisa
If you think a Q&A is wrong, please call an OP
[03:24] Avestruz_ConPrisa Tri.20850 Historiaɘti˿Cualeswfueronqloswacorazadoswm᳃01wgrandeswdelomundo?n?n [03:24] Avestruz_ConPrisa
Tri.20850 Historiaɘti˿Cualeswfueronqloswacorazadoswm᳃01wgrandeswdelomundo?n?n
[03:24] Avestruz_ConPrisa 1 Pista: ****** * ******* Valor pregunta : 11867 Puntos [03:24] Avestruz_ConPrisa
1 Pista: ****** * ******* Valor pregunta : 11867 Puntos
[03:24] Avestruz_ConPrisa 2 Pista: yam*** * ******* 30 segundos y 11867 Puntos [03:24] Avestruz_ConPrisa
2 Pista: yam*** * ******* 30 segundos y 11867 Puntos
[03:25] Avestruz_ConPrisa 3 Pista: yama*o * *u**a*i 15 segundos y 11867 Puntos [03:25] Avestruz_ConPrisa
3 Pista: yama*o * *u**a*i 15 segundos y 11867 Puntos
[03:25] Avestruz_ConPrisa Tiempo! La respuesta es -> yamato��ushasi <- [03:25] Avestruz_ConPrisa
Tiempo! La respuesta es -> yamato��ushasi <-
[03:25] Avestruz_ConPrisa R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226 [03:25] Avestruz_ConPrisa
R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226
[03:25] Avestruz_ConPrisa Tri.1726 Informaticaɤassler˿Cuᬃ01ceseelcprogramahdewtextonm᳃01esencillonparahmacintosh?y?y [03:25] Avestruz_ConPrisa
Tri.1726 Informaticaɤassler˿Cuᬃ01ceseelcprogramahdewtextonm᳃01esencillonparahmacintosh?y?y
[03:25] Avestruz_ConPrisa 1 Pista: ********** Pregunta de BONUS : 50000 Puntos [03:25] Avestruz_ConPrisa
1 Pista: ********** Pregunta de BONUS : 50000 Puntos
[03:25] Avestruz_ConPrisa 2 Pista: Sim******* 30 segundos y 50000 Puntos [03:25] Avestruz_ConPrisa
2 Pista: Sim******* 30 segundos y 50000 Puntos
[03:26] Avestruz_ConPrisa 3 Pista: Sim**e*e** 15 segundos y 50000 Puntos [03:26] Avestruz_ConPrisa
3 Pista: Sim**e*e** 15 segundos y 50000 Puntos
[03:26] Avestruz_ConPrisa Tiempo! La respuesta es -> Simpletext <- [03:26] Avestruz_ConPrisa
Tiempo! La respuesta es -> Simpletext <-
[03:26] Avestruz_ConPrisa For The Competitive Edge type !pingme [03:26] Avestruz_ConPrisa
For The Competitive Edge type !pingme
[03:26] Avestruz_ConPrisa Tri.2222 MiscelaneaɔeLaRaNhA˿Comerxconnfuerzavyamascarxconnganasj,quejlopquejnopsejhicierejhoya?k [03:26] Avestruz_ConPrisa
Tri.2222 MiscelaneaɔeLaRaNhA˿Comerxconnfuerzavyamascarxconnganasj,quejlopquejnopsejhicierejhoya?k
[03:26] Avestruz_ConPrisa 1 Pista: *** ****** **񪪪 Valor pregunta : 16574 Puntos [03:26] Avestruz_ConPrisa
1 Pista: *** ****** **񪪪 Valor pregunta : 16574 Puntos
[03:26] Avestruz_ConPrisa 2 Pista: ahi ****** **񪪪 30 segundos y 16574 Puntos [03:26] Avestruz_ConPrisa
2 Pista: ahi ****** **񪪪 30 segundos y 16574 Puntos
[03:27] Avestruz_ConPrisa 3 Pista: ahi e**a*a *a񡪡 15 segundos y 16574 Puntos [03:27] Avestruz_ConPrisa
3 Pista: ahi e**a*a *a񡪡 15 segundos y 16574 Puntos
[03:27] Avestruz_ConPrisa Tiempo! La respuesta es -> ahi�stara�a񡮡 <- [03:27] Avestruz_ConPrisa
Tiempo! La respuesta es -> ahi�stara�a񡮡 <-
[03:27] Oveja{ConPrisa ahi estara mañana [03:27] Oveja{ConPrisa
ahi estara mañana
[03:27] Avestruz_ConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:27] Avestruz_ConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:27] Avestruz_ConPrisa Tri.19457 Miscelaneaɥldanasˁviaci󮃰1c-qControles:qQuedparteddeltavionccontrolaelaeprofundidad?q?q [03:27] Avestruz_ConPrisa
Tri.19457 Miscelaneaɥldanasˁviaci󮃰1c-qControles:qQuedparteddeltavionccontrolaelaeprofundidad?q?q
[03:27] Avestruz_ConPrisa 1 Pista: ***** ** *********** Valor pregunta : 17272 Puntos [03:27] Avestruz_ConPrisa
1 Pista: ***** ** *********** Valor pregunta : 17272 Puntos
[03:27] Avestruz_ConPrisa 2 Pista: tim** ** *********** 30 segundos y 17272 Puntos [03:27] Avestruz_ConPrisa
2 Pista: tim** ** *********** 30 segundos y 17272 Puntos
[03:27] Avestruz_ConPrisa �Increible!! Oveja{ConPrisa contest󺠃04"timon de profundidad" en �4.719 segundos, y ha ganado �7272�12 puntos [03:27] Avestruz_ConPrisa
�Increible!! Oveja{ConPrisa contest󺠃04"timon de profundidad" en �4.719 segundos, y ha ganado �7272�12 puntos
[03:27] Oveja{ConPrisa timon de profundidad [03:27] Oveja{ConPrisa
timon de profundidad
[03:27] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:27] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:27] Avestruz_ConPrisa Oveja{ConPrisa has acertado 7 seguidas!! Puntos HOY: 85528, SEMANA: 1650292 y MES: 1650292 [03:27] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 7 seguidas!! Puntos HOY: 85528, SEMANA: 1650292 y MES: 1650292
[03:28] Avestruz_ConPrisa R᮫ing MES: - #1: Gallina\Elocuente 6831927 #2: Danielitto 4093466 #3: Oveja{ConPrisa 1633020 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [03:28] Avestruz_ConPrisa
R᮫ing MES: - #1: Gallina\Elocuente 6831927 #2: Danielitto 4093466 #3: Oveja{ConPrisa 1633020 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[03:28] Avestruz_ConPrisa Tri.15080 Informaticaɐax˿ComoiseillamanglosxhabitantesxbuenosxdelhjuegoiCreaturesx?n [03:28] Avestruz_ConPrisa
Tri.15080 Informaticaɐax˿ComoiseillamanglosxhabitantesxbuenosxdelhjuegoiCreaturesx?n
[03:28] Avestruz_ConPrisa 1 Pista: ***** Valor pregunta : 15706 Puntos [03:28] Avestruz_ConPrisa
1 Pista: ***** Valor pregunta : 15706 Puntos
[03:28] Avestruz_ConPrisa 2 Pista: nor** 30 segundos y 15706 Puntos [03:28] Avestruz_ConPrisa
2 Pista: nor** 30 segundos y 15706 Puntos
[03:28] Oveja{ConPrisa norma [03:28] Oveja{ConPrisa
norma
[03:28] Avestruz_ConPrisa 3 Pista: nor** 15 segundos y 15706 Puntos [03:28] Avestruz_ConPrisa
3 Pista: nor** 15 segundos y 15706 Puntos
[03:28] Oveja{ConPrisa norte [03:28] Oveja{ConPrisa
norte
[03:28] Avestruz_ConPrisa Tiempo! La respuesta es -> norns <- [03:28] Avestruz_ConPrisa
Tiempo! La respuesta es -> norns <-
[03:28] Avestruz_ConPrisa Please refrain from using Extreme Bad Language [03:28] Avestruz_ConPrisa
Please refrain from using Extreme Bad Language
[03:28] Avestruz_ConPrisa Tri.18102 Personajesɓebosin˿Citas-Qui鮃01ydijo:l"Lasvreligiones,lcomotlasvluci鲮agas,lnecesitanydeqoscuridadbparaxbrillar"?l?l [03:28] Avestruz_ConPrisa
Tri.18102 Personajesɓebosin˿Citas-Qui鮃01ydijo:l"Lasvreligiones,lcomotlasvluci鲮agas,lnecesitanydeqoscuridadbparaxbrillar"?l?l
[03:28] Avestruz_ConPrisa 1 Pista: ************ Valor pregunta : 16549 Puntos [03:28] Avestruz_ConPrisa
1 Pista: ************ Valor pregunta : 16549 Puntos
[03:29] Avestruz_ConPrisa 2 Pista: sch********* 30 segundos y 16549 Puntos [03:29] Avestruz_ConPrisa
2 Pista: sch********* 30 segundos y 16549 Puntos
[03:29] Avestruz_ConPrisa 3 Pista: scho*e**aue* 15 segundos y 16549 Puntos [03:29] Avestruz_ConPrisa
3 Pista: scho*e**aue* 15 segundos y 16549 Puntos
[03:29] Avestruz_ConPrisa Tiempo! La respuesta es -> schopenhauer <- [03:29] Avestruz_ConPrisa
Tiempo! La respuesta es -> schopenhauer <-
[03:29] Avestruz_ConPrisa This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa [03:29] Avestruz_ConPrisa
This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa
[03:29] Avestruz_ConPrisa Tri.8080 CienciaɍarcaAcme˿"oxүai+oyүby=o1o"oesllaiecuacionideauna...?"o?o [03:29] Avestruz_ConPrisa
Tri.8080 CienciaɍarcaAcme˿"oxүai+oyүby=o1o"oesllaiecuacionideauna...?"o?o
[03:29] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 6924 Puntos [03:29] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 6924 Puntos
[03:30] Avestruz_ConPrisa 2 Pista: eli*** 30 segundos y 6924 Puntos [03:30] Avestruz_ConPrisa
2 Pista: eli*** 30 segundos y 6924 Puntos
[03:30] Avestruz_ConPrisa 3 Pista: eli**e 15 segundos y 6924 Puntos [03:30] Avestruz_ConPrisa
3 Pista: eli**e 15 segundos y 6924 Puntos
[03:30] Avestruz_ConPrisa Tiempo! La respuesta es -> elipse <- [03:30] Avestruz_ConPrisa
Tiempo! La respuesta es -> elipse <-
[03:30] Avestruz_ConPrisa This WEEKS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0 [03:30] Avestruz_ConPrisa
This WEEKS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0
[03:30] Avestruz_ConPrisa Tri.13375 Miscelaneaɓebosin˿C󭯃01xsenlenllamadalsnaturalsdenManchuria?s?s [03:30] Avestruz_ConPrisa
Tri.13375 Miscelaneaɓebosin˿C󭯃01xsenlenllamadalsnaturalsdenManchuria?s?s
[03:30] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 5982 Puntos [03:30] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 5982 Puntos
[03:31] Avestruz_ConPrisa 2 Pista: man*** 30 segundos y 5982 Puntos [03:31] Avestruz_ConPrisa
2 Pista: man*** 30 segundos y 5982 Puntos
[03:31] Oveja{ConPrisa menchu [03:31] Oveja{ConPrisa
menchu
[03:31] Oveja{ConPrisa manchu [03:31] Oveja{ConPrisa
manchu
[03:31] Avestruz_ConPrisa �Oveja{ConPrisa acert󡡠La respuesta era: "manchu" y contest󠥮 �9.484 segundos. Se lleva: �982�12 puntos [03:31] Avestruz_ConPrisa
�Oveja{ConPrisa acert󡡠La respuesta era: "manchu" y contest󠥮 �9.484 segundos. Se lleva: �982�12 puntos
[03:31] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:31] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:31] Avestruz_ConPrisa Oveja{ConPrisa has acertado 8 seguidas!! Puntos HOY: 91510, SEMANA: 1656274 y MES: 1656274 [03:31] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 8 seguidas!! Puntos HOY: 91510, SEMANA: 1656274 y MES: 1656274
[03:31] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [03:31] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[03:31] Avestruz_ConPrisa Tri.16218 CienciaɐEDROC˿CUANTOdVALEdUNAdSARDINAdYdMEDIAdAdPESETAdYdMEDIAdLAdSARDINAdYdMEDIAd?d?d [03:31] Avestruz_ConPrisa
Tri.16218 CienciaɐEDROC˿CUANTOdVALEdUNAdSARDINAdYdMEDIAdAdPESETAdYdMEDIAdLAdSARDINAdYdMEDIAd?d?d
[03:31] Avestruz_ConPrisa 1 Pista: ****** * ***** Valor pregunta : 9027 Puntos [03:31] Avestruz_ConPrisa
1 Pista: ****** * ***** Valor pregunta : 9027 Puntos
[03:31] Avestruz_ConPrisa 2 Pista: pes*** * ***** 30 segundos y 9027 Puntos [03:31] Avestruz_ConPrisa
2 Pista: pes*** * ***** 30 segundos y 9027 Puntos
[03:32] Avestruz_ConPrisa 3 Pista: pese*a * *e*ia 15 segundos y 9027 Puntos [03:32] Avestruz_ConPrisa
3 Pista: pese*a * *e*ia 15 segundos y 9027 Puntos
[03:32] Oveja{ConPrisa peseta y media [03:32] Oveja{ConPrisa
peseta y media
[03:32] Avestruz_ConPrisa �emuestra lo que sabes Oveja{ConPrisa! Has respondido "peseta y media" correctamente y eso te da: �027�12 puntos [03:32] Avestruz_ConPrisa
�emuestra lo que sabes Oveja{ConPrisa! Has respondido "peseta y media" correctamente y eso te da: �027�12 puntos
[03:32] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:32] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:32] Avestruz_ConPrisa Oveja{ConPrisa has acertado 9 seguidas!! Puntos HOY: 100537, SEMANA: 1665301 y MES: 1665301 [03:32] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 9 seguidas!! Puntos HOY: 100537, SEMANA: 1665301 y MES: 1665301
[03:32] Caracol_ConBravura PESETA [03:32] Caracol_ConBravura
PESETA
[03:32] Avestruz_ConPrisa This MONTHS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0 [03:32] Avestruz_ConPrisa
This MONTHS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0
[03:32] Avestruz_ConPrisa Tri.10181 DeporteɔDI˿CUALbESbELbNOMBREbDEPORTIVObDEbJOSEbMARIAbGUTIERREZbFERNANDEZb?b [03:32] Avestruz_ConPrisa
Tri.10181 DeporteɔDI˿CUALbESbELbNOMBREbDEPORTIVObDEbJOSEbMARIAbGUTIERREZbFERNANDEZb?b
[03:32] Avestruz_ConPrisa 1 Pista: **** Valor pregunta : 10927 Puntos [03:32] Avestruz_ConPrisa
1 Pista: **** Valor pregunta : 10927 Puntos
[03:32] Avestruz_ConPrisa 2 Pista: gut* 30 segundos y 10927 Puntos [03:32] Avestruz_ConPrisa
2 Pista: gut* 30 segundos y 10927 Puntos
[03:32] Avestruz_ConPrisa �Bien Oveja{ConPrisa!! Tu respuesta: "guti" es correcta y ganas �0927�12 puntos [03:32] Avestruz_ConPrisa
�Bien Oveja{ConPrisa!! Tu respuesta: "guti" es correcta y ganas �0927�12 puntos
[03:32] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:32] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:32] Avestruz_ConPrisa Oveja{ConPrisa has acertado 10 seguidas!! Puntos HOY: 111464, SEMANA: 1676228 y MES: 1676228 [03:32] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 10 seguidas!! Puntos HOY: 111464, SEMANA: 1676228 y MES: 1676228
[03:32] Avestruz_ConPrisa Bonus especial de 50000 Puntos para Oveja{ConPrisa por acertar 10 seguidas!!! [03:32] Avestruz_ConPrisa
Bonus especial de 50000 Puntos para Oveja{ConPrisa por acertar 10 seguidas!!!
[03:32] Oveja{ConPrisa guti [03:32] Oveja{ConPrisa
guti
[03:32] Avestruz_ConPrisa R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516 [03:32] Avestruz_ConPrisa
R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516
[03:32] Avestruz_ConPrisa Tri.9909 CineɅLCHUPAO˿(GRANDESpTRADUCCIONES)pTITULOpORIGINALpDEpELpINDOMABLEpWILLpHUNTINGp?p [03:32] Avestruz_ConPrisa
Tri.9909 CineɅLCHUPAO˿(GRANDESpTRADUCCIONES)pTITULOpORIGINALpDEpELpINDOMABLEpWILLpHUNTINGp?p
[03:32] Avestruz_ConPrisa 1 Pista: **** **** ******* Valor pregunta : 23685 Puntos [03:32] Avestruz_ConPrisa
1 Pista: **** **** ******* Valor pregunta : 23685 Puntos
[03:33] Avestruz_ConPrisa 2 Pista: goo* **** ******* 30 segundos y 23685 Puntos [03:33] Avestruz_ConPrisa
2 Pista: goo* **** ******* 30 segundos y 23685 Puntos
[03:33] Avestruz_ConPrisa 3 Pista: goo* *i** *u**i** 15 segundos y 23685 Puntos [03:33] Avestruz_ConPrisa
3 Pista: goo* *i** *u**i** 15 segundos y 23685 Puntos
[03:33] Avestruz_ConPrisa Tiempo! La respuesta es -> good�ill�unting <- [03:33] Avestruz_ConPrisa
Tiempo! La respuesta es -> good�ill�unting <-
[03:33] Avestruz_ConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:33] Avestruz_ConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:33] Avestruz_ConPrisa Tri.13968 CienciaɈdosO˿CUALtEStELtPLANETAtM�tPEQUEяtDELtSISTEMAtSOLARt?t [03:33] Avestruz_ConPrisa
Tri.13968 CienciaɈdosO˿CUALtEStELtPLANETAtM�tPEQUEяtDELtSISTEMAtSOLARt?t
[03:33] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 16485 Puntos [03:33] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 16485 Puntos
[03:33] Avestruz_ConPrisa 2 Pista: mer***** 30 segundos y 16485 Puntos [03:33] Avestruz_ConPrisa
2 Pista: mer***** 30 segundos y 16485 Puntos
[03:33] Oveja{ConPrisa mercurio [03:33] Oveja{ConPrisa
mercurio
[03:33] Avestruz_ConPrisa �Increible!! Oveja{ConPrisa contest󺠃04"mercurio" en �7.109 segundos, y ha ganado �6485�12 puntos [03:33] Avestruz_ConPrisa
�Increible!! Oveja{ConPrisa contest󺠃04"mercurio" en �7.109 segundos, y ha ganado �6485�12 puntos
[03:33] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:33] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:33] Avestruz_ConPrisa Oveja{ConPrisa has acertado 11 seguidas!! Puntos HOY: 177949, SEMANA: 1742713 y MES: 1742713 [03:33] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 11 seguidas!! Puntos HOY: 177949, SEMANA: 1742713 y MES: 1742713
[03:34] Avestruz_ConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:34] Avestruz_ConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:34] Avestruz_ConPrisa Tri.17031 Idiomasɐsico666ˡdverbiohdegdudal?a [03:34] Avestruz_ConPrisa
Tri.17031 Idiomasɐsico666ˡdverbiohdegdudal?a
[03:34] Avestruz_ConPrisa 1 Pista: ****** Pregunta de BONUS : 25000 Puntos [03:34] Avestruz_ConPrisa
1 Pista: ****** Pregunta de BONUS : 25000 Puntos
[03:34] Avestruz_ConPrisa 2 Pista: qui*** 30 segundos y 25000 Puntos [03:34] Avestruz_ConPrisa
2 Pista: qui*** 30 segundos y 25000 Puntos
[03:34] Avestruz_ConPrisa �Suma y sigue Oveja{ConPrisa!! La respuesta: "quizas" incrementa tu marcador en �5000�12 puntos [03:34] Avestruz_ConPrisa
�Suma y sigue Oveja{ConPrisa!! La respuesta: "quizas" incrementa tu marcador en �5000�12 puntos
[03:34] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:34] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:34] Avestruz_ConPrisa Oveja{ConPrisa has acertado 12 seguidas!! Puntos HOY: 202949, SEMANA: 1767713 y MES: 1767713 [03:34] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 12 seguidas!! Puntos HOY: 202949, SEMANA: 1767713 y MES: 1767713
[03:34] Oveja{ConPrisa quizas [03:34] Oveja{ConPrisa
quizas
[03:34] Avestruz_ConPrisa R᮫ing SEMANA: - #1: Gallina\Elocuente 6831927 #2: Danielitto 4093466 #3: Oveja{ConPrisa 1767713 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [03:34] Avestruz_ConPrisa
R᮫ing SEMANA: - #1: Gallina\Elocuente 6831927 #2: Danielitto 4093466 #3: Oveja{ConPrisa 1767713 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[03:34] Avestruz_ConPrisa Tri.2866 Biologiaɬusie˿C󭯃01xsegllamaeelagrupoxdeganimalesqvermiformesqconbcategor�01edegtipox?r?r [03:34] Avestruz_ConPrisa
Tri.2866 Biologiaɬusie˿C󭯃01xsegllamaeelagrupoxdeganimalesqvermiformesqconbcategor�01edegtipox?r?r
[03:34] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 20037 Puntos [03:34] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 20037 Puntos
[03:34] Avestruz_ConPrisa 2 Pista: ane***** 30 segundos y 20037 Puntos [03:34] Avestruz_ConPrisa
2 Pista: ane***** 30 segundos y 20037 Puntos
[03:35] Avestruz_ConPrisa 3 Pista: ane*i*o* 15 segundos y 20037 Puntos [03:35] Avestruz_ConPrisa
3 Pista: ane*i*o* 15 segundos y 20037 Puntos
[03:35] Gallina\Elocuente !Radio [03:35] Gallina\Elocuente
!Radio
[03:35] Libelula-ConPrisa 📻 [Radio Luna de Miel] | 🎧 DJ: Cocodrilo{Suave | 🎶 Musica variada | 🌍 México | 📩 Peticiones: ABIERTAS | 🌐 www.radiolunademiel.com [03:35] Libelula-ConPrisa
📻 [Radio Luna de Miel] | 🎧 DJ: Cocodrilo{Suave | 🎶 Musica variada | 🌍 México | 📩 Peticiones: ABIERTAS | 🌐 www.radiolunademiel.com
[03:35] Oveja{ConPrisa anelida [03:35] Oveja{ConPrisa
anelida
[03:35] Oveja{ConPrisa annelida [03:35] Oveja{ConPrisa
annelida
[03:35] Avestruz_ConPrisa Tiempo! La respuesta es -> anelidos <- [03:35] Avestruz_ConPrisa
Tiempo! La respuesta es -> anelidos <-
[03:35] Oveja{ConPrisa annelidos [03:35] Oveja{ConPrisa
annelidos
[03:35] Avestruz_ConPrisa We feature over 50,000 Q&A ! [03:35] Avestruz_ConPrisa
We feature over 50,000 Q&A !
[03:35] Avestruz_ConPrisa Tri.2459 Historiaɳtephenwo˿Enbqueypa�01useyconstruy󃰱deliprimerfavi󮃰1bazreacci󮿃01d?d [03:35] Avestruz_ConPrisa
Tri.2459 Historiaɳtephenwo˿Enbqueypa�01useyconstruy󃰱deliprimerfavi󮃰1bazreacci󮿃01d?d
[03:35] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 13202 Puntos [03:35] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 13202 Puntos
[03:35] Avestruz_ConPrisa 2 Pista: ale***** 30 segundos y 13202 Puntos [03:35] Avestruz_ConPrisa
2 Pista: ale***** 30 segundos y 13202 Puntos
[03:35] Avestruz_ConPrisa �Enhorabuena Oveja{ConPrisa!! Has contestado "alemania" y por ello has ganado �3202�12 puntos [03:35] Avestruz_ConPrisa
�Enhorabuena Oveja{ConPrisa!! Has contestado "alemania" y por ello has ganado �3202�12 puntos
[03:35] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:35] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:35] Avestruz_ConPrisa Oveja{ConPrisa has acertado 13 seguidas!! Puntos HOY: 216151, SEMANA: 1780915 y MES: 1780915 [03:35] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 13 seguidas!! Puntos HOY: 216151, SEMANA: 1780915 y MES: 1780915
[03:35] Oveja{ConPrisa alemania [03:35] Oveja{ConPrisa
alemania
[03:36] Avestruz_ConPrisa Tri.13175 CancionesɐSikoPaT˿Cualzesvlamprimeramcancionjespa񯬡mqueqsuperogenjventasvalz"vivamespa񡢃01yenjtodogelzmundo?"y?y [03:36] Avestruz_ConPrisa
Tri.13175 CancionesɐSikoPaT˿Cualzesvlamprimeramcancionjespa񯬡mqueqsuperogenjventasvalz"vivamespa񡢃01yenjtodogelzmundo?"y?y
[03:36] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 5146 Puntos [03:36] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 5146 Puntos
[03:36] Avestruz_ConPrisa 2 Pista: mac***** 30 segundos y 5146 Puntos [03:36] Avestruz_ConPrisa
2 Pista: mac***** 30 segundos y 5146 Puntos
[03:36] Avestruz_ConPrisa 3 Pista: maca*e*a 15 segundos y 5146 Puntos [03:36] Avestruz_ConPrisa
3 Pista: maca*e*a 15 segundos y 5146 Puntos
[03:36] Oveja{ConPrisa macarena [03:36] Oveja{ConPrisa
macarena
[03:36] Avestruz_ConPrisa �Increible!! Oveja{ConPrisa contest󺠃04"macarena" en �2.141 segundos, y ha ganado �146�12 puntos [03:36] Avestruz_ConPrisa
�Increible!! Oveja{ConPrisa contest󺠃04"macarena" en �2.141 segundos, y ha ganado �146�12 puntos
[03:36] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:36] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:36] Avestruz_ConPrisa Oveja{ConPrisa has acertado 14 seguidas!! Puntos HOY: 221297, SEMANA: 1786061 y MES: 1786061 [03:36] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 14 seguidas!! Puntos HOY: 221297, SEMANA: 1786061 y MES: 1786061
[03:36] Avestruz_ConPrisa Tri.19408 MitologiaɆrigotora˿Diosasacadiasqueprepresentaslaslaguaslsaladas?w?w [03:36] Avestruz_ConPrisa
Tri.19408 MitologiaɆrigotora˿Diosasacadiasqueprepresentaslaslaguaslsaladas?w?w
[03:36] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 8352 Puntos [03:36] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 8352 Puntos
[03:37] Cabra{Torpe me gusta mucho la fiesta [03:37] Cabra{Torpe
me gusta mucho la fiesta
[03:37] Avestruz_ConPrisa 2 Pista: tia*** 30 segundos y 8352 Puntos [03:37] Avestruz_ConPrisa
2 Pista: tia*** 30 segundos y 8352 Puntos
[03:37] Oveja{ConPrisa tiamat [03:37] Oveja{ConPrisa
tiamat
[03:37] Avestruz_ConPrisa �Ol頃04Oveja{ConPrisa!! Has contestado: "tiamat" en �8.719 segundos y sumas �352�12 puntos a tu marcador. �Sigue as� [03:37] Avestruz_ConPrisa
�Ol頃04Oveja{ConPrisa!! Has contestado: "tiamat" en �8.719 segundos y sumas �352�12 puntos a tu marcador. �Sigue as�
[03:37] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:37] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:37] Avestruz_ConPrisa Oveja{ConPrisa has acertado 15 seguidas!! Puntos HOY: 229649, SEMANA: 1794413 y MES: 1794413 [03:37] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 15 seguidas!! Puntos HOY: 229649, SEMANA: 1794413 y MES: 1794413
[03:37] Cabra{Torpe las senioras y las soda [03:37] Cabra{Torpe
las senioras y las soda
[03:37] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [03:37] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[03:37] Avestruz_ConPrisa Tri.6783 Gastronomiaɖarios˿Desd󮤥seshoriginariaqlaqlasa񡃰1q?m [03:37] Avestruz_ConPrisa
Tri.6783 Gastronomiaɖarios˿Desd󮤥seshoriginariaqlaqlasa񡃰1q?m
[03:37] Avestruz_ConPrisa 1 Pista: ** ****** Valor pregunta : 17965 Puntos [03:37] Avestruz_ConPrisa
1 Pista: ** ****** Valor pregunta : 17965 Puntos
[03:37] Oveja{ConPrisa de españa [03:37] Oveja{ConPrisa
de españa
[03:37] Avestruz_ConPrisa 2 Pista: de�***** 30 segundos y 17965 Puntos [03:37] Avestruz_ConPrisa
2 Pista: de�***** 30 segundos y 17965 Puntos
[03:37] Oveja{ConPrisa de italia [03:37] Oveja{ConPrisa
de italia
[03:37] Avestruz_ConPrisa �Bien Oveja{ConPrisa!! Tu respuesta: "de italia" es correcta y ganas �7965�12 puntos [03:37] Avestruz_ConPrisa
�Bien Oveja{ConPrisa!! Tu respuesta: "de italia" es correcta y ganas �7965�12 puntos
[03:37] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:37] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:37] Avestruz_ConPrisa Oveja{ConPrisa has acertado 16 seguidas!! Puntos HOY: 247614, SEMANA: 1812378 y MES: 1812378 [03:37] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 16 seguidas!! Puntos HOY: 247614, SEMANA: 1812378 y MES: 1812378
[03:37] Avestruz_ConPrisa R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898 [03:37] Avestruz_ConPrisa
R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898
[03:37] Avestruz_ConPrisa Tri.7314 Biologiaɂrightblade˿Comofsehllamanjlosuperrosuutilizadosuporjlosunazisudurantehlabiilguerrabmundialc?w?w [03:37] Avestruz_ConPrisa
Tri.7314 Biologiaɂrightblade˿Comofsehllamanjlosuperrosuutilizadosuporjlosunazisudurantehlabiilguerrabmundialc?w?w
[03:37] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 21319 Puntos [03:37] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 21319 Puntos
[03:38] Avestruz_ConPrisa 2 Pista: dob***** 30 segundos y 21319 Puntos [03:38] Avestruz_ConPrisa
2 Pista: dob***** 30 segundos y 21319 Puntos
[03:38] Oveja{ConPrisa pastores [03:38] Oveja{ConPrisa
pastores
[03:38] Avestruz_ConPrisa �Suma y sigue Oveja{ConPrisa!! La respuesta: "doberman" incrementa tu marcador en �1319�12 puntos [03:38] Avestruz_ConPrisa
�Suma y sigue Oveja{ConPrisa!! La respuesta: "doberman" incrementa tu marcador en �1319�12 puntos
[03:38] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:38] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:38] Avestruz_ConPrisa Oveja{ConPrisa has acertado 17 seguidas!! Puntos HOY: 268933, SEMANA: 1833697 y MES: 1833697 [03:38] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 17 seguidas!! Puntos HOY: 268933, SEMANA: 1833697 y MES: 1833697
[03:38] Oveja{ConPrisa doberman [03:38] Oveja{ConPrisa
doberman
[03:38] Avestruz_ConPrisa If you think a Q&A is wrong, please call an OP [03:38] Avestruz_ConPrisa
If you think a Q&A is wrong, please call an OP
[03:38] Avestruz_ConPrisa Tri.689 Fisica-Quimicaɐsico666˶elocidadudelhsonidoyenfelhaceroyel᳴icoy?r [03:38] Avestruz_ConPrisa
Tri.689 Fisica-Quimicaɐsico666˶elocidadudelhsonidoyenfelhaceroyel᳴icoy?r
[03:38] Avestruz_ConPrisa 1 Pista: **** ****** *** ******* Valor pregunta : 15132 Puntos [03:38] Avestruz_ConPrisa
1 Pista: **** ****** *** ******* Valor pregunta : 15132 Puntos
[03:38] Avestruz_ConPrisa 2 Pista: 500* ****** *** ******* 30 segundos y 15132 Puntos [03:38] Avestruz_ConPrisa
2 Pista: 500* ****** *** ******* 30 segundos y 15132 Puntos
[03:39] Avestruz_ConPrisa 3 Pista: 500* *e**o* *o* *e*u**o 15 segundos y 15132 Puntos [03:39] Avestruz_ConPrisa
3 Pista: 500* *e**o* *o* *e*u**o 15 segundos y 15132 Puntos
[03:39] Avestruz_ConPrisa Tiempo! La respuesta es -> 5000�etros�or�egundo <- [03:39] Avestruz_ConPrisa
Tiempo! La respuesta es -> 5000�etros�or�egundo <-
[03:39] Avestruz_ConPrisa R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226 [03:39] Avestruz_ConPrisa
R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226
[03:39] Avestruz_ConPrisa Tri.19057 MiscelaneaɄonNadieˍamᬃ01jmamᬃ01jenrelicoleshaymunrni񯃰1vquesmesllamay"marica".j-ߙjportqu郰1jnovlespegasthijo?j-Jo,jestqueses.....j?j [03:39] Avestruz_ConPrisa
Tri.19057 MiscelaneaɄonNadieˍamᬃ01jmamᬃ01jenrelicoleshaymunrni񯃰1vquesmesllamay"marica".j-ߙjportqu郰1jnovlespegasthijo?j-Jo,jestqueses.....j?j
[03:39] Avestruz_ConPrisa 1 Pista: *** ***** Valor pregunta : 5171 Puntos [03:39] Avestruz_ConPrisa
1 Pista: *** ***** Valor pregunta : 5171 Puntos
[03:39] Avestruz_ConPrisa 2 Pista: tan ***** 30 segundos y 5171 Puntos [03:39] Avestruz_ConPrisa
2 Pista: tan ***** 30 segundos y 5171 Puntos
[03:39] Oveja{ConPrisa 5000 tan lindo [03:39] Oveja{ConPrisa
5000 tan lindo
[03:39] Avestruz_ConPrisa 3 Pista: tan *ua*o 15 segundos y 5171 Puntos [03:39] Avestruz_ConPrisa
3 Pista: tan *ua*o 15 segundos y 5171 Puntos
[03:40] Oveja{ConPrisa tan guapo [03:40] Oveja{ConPrisa
tan guapo
[03:40] Avestruz_ConPrisa �Bingo!! Oveja{ConPrisa dio la respuesta: "tan guapo" en �9.125 segundos e incrementa sus ganancias con �171�12 puntos [03:40] Avestruz_ConPrisa
�Bingo!! Oveja{ConPrisa dio la respuesta: "tan guapo" en �9.125 segundos e incrementa sus ganancias con �171�12 puntos
[03:40] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:40] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:40] Avestruz_ConPrisa Oveja{ConPrisa has acertado 18 seguidas!! Puntos HOY: 274104, SEMANA: 1838868 y MES: 1838868 [03:40] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 18 seguidas!! Puntos HOY: 274104, SEMANA: 1838868 y MES: 1838868
[03:40] Avestruz_ConPrisa For The Competitive Edge type !pingme [03:40] Avestruz_ConPrisa
For The Competitive Edge type !pingme
[03:40] Avestruz_ConPrisa Tri.20868 Gastronomiaɬatribu˿DEtQUɃ01tPAIStEStORIGINARIAtLAtVARIEDADtMOKAtDELtCAFEt?t [03:40] Avestruz_ConPrisa
Tri.20868 Gastronomiaɬatribu˿DEtQUɃ01tPAIStEStORIGINARIAtLAtVARIEDADtMOKAtDELtCAFEt?t
[03:40] Avestruz_ConPrisa 1 Pista: ***** Valor pregunta : 18880 Puntos [03:40] Avestruz_ConPrisa
1 Pista: ***** Valor pregunta : 18880 Puntos
[03:40] Avestruz_ConPrisa �Absolutamente correcto Oveja{ConPrisa!! Acertaste "yemen" en �5.016 segundos y ganas �8880�12 puntos [03:40] Avestruz_ConPrisa
�Absolutamente correcto Oveja{ConPrisa!! Acertaste "yemen" en �5.016 segundos y ganas �8880�12 puntos
[03:40] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:40] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:40] Avestruz_ConPrisa Oveja{ConPrisa has acertado 19 seguidas!! Puntos HOY: 292984, SEMANA: 1857748 y MES: 1857748 [03:40] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 19 seguidas!! Puntos HOY: 292984, SEMANA: 1857748 y MES: 1857748
[03:40] Oveja{ConPrisa yemen [03:40] Oveja{ConPrisa
yemen
[03:40] Avestruz_ConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:40] Avestruz_ConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:40] Avestruz_ConPrisa Tri.14339 ArteɍARdeJAVA˿AhQUɃ01hMOVIMIENTOhART͓TICOhPERTENECIERONhLOShARQUITECTOS...hANTONIhGAUDͬhLUIShDOMȎECHhYhMONTANER,hHECTORhGUIMARD,hCHARLEShRENNIEhMACKINTOSHhYhVICTORhHORTA?h?h [03:40] Avestruz_ConPrisa
Tri.14339 ArteɍARdeJAVA˿AhQUɃ01hMOVIMIENTOhART͓TICOhPERTENECIERONhLOShARQUITECTOS...hANTONIhGAUDͬhLUIShDOMȎECHhYhMONTANER,hHECTORhGUIMARD,hCHARLEShRENNIEhMACKINTOSHhYhVICTORhHORTA?h?h
[03:40] Avestruz_ConPrisa 1 Pista: ********** Valor pregunta : 9999 Puntos [03:40] Avestruz_ConPrisa
1 Pista: ********** Valor pregunta : 9999 Puntos
[03:40] Avestruz_ConPrisa 2 Pista: mod******* 30 segundos y 9999 Puntos [03:40] Avestruz_ConPrisa
2 Pista: mod******* 30 segundos y 9999 Puntos
[03:41] Avestruz_ConPrisa �Muy bien Gallina\Elocuente!! Acertaste "modernismo" en tan s󬯠�8.078 segundos y por eso has ganado: �999�12 puntos [03:41] Avestruz_ConPrisa
�Muy bien Gallina\Elocuente!! Acertaste "modernismo" en tan s󬯠�8.078 segundos y por eso has ganado: �999�12 puntos
[03:41] Avestruz_ConPrisa Gallina\Elocuente has acertado 1 seguidas!! Puntos HOY: 9999, SEMANA: 6841926 y MES: 6841926 [03:41] Avestruz_ConPrisa
Gallina\Elocuente has acertado 1 seguidas!! Puntos HOY: 9999, SEMANA: 6841926 y MES: 6841926
[03:41] Gallina\Elocuente modernismo [03:41] Gallina\Elocuente
modernismo
[03:41] Avestruz_ConPrisa R᮫ing MES: - #1: Gallina\Elocuente 6831927 #2: Danielitto 4093466 #3: Oveja{ConPrisa 1857748 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [03:41] Avestruz_ConPrisa
R᮫ing MES: - #1: Gallina\Elocuente 6831927 #2: Danielitto 4093466 #3: Oveja{ConPrisa 1857748 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[03:41] Avestruz_ConPrisa Tri.13528 Idiomasɬusieːalabrasht飮icas:wSe񡬃01dquebloshaduaneroshponensensloshfardoshyagreconocidosh?w [03:41] Avestruz_ConPrisa
Tri.13528 Idiomasɬusieːalabrasht飮icas:wSe񡬃01dquebloshaduaneroshponensensloshfardoshyagreconocidosh?w
[03:41] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 6419 Puntos [03:41] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 6419 Puntos
[03:41] Avestruz_ConPrisa 2 Pista: mar***** 30 segundos y 6419 Puntos [03:41] Avestruz_ConPrisa
2 Pista: mar***** 30 segundos y 6419 Puntos
[03:41] Oveja{ConPrisa marchamos [03:41] Oveja{ConPrisa
marchamos
[03:41] Avestruz_ConPrisa 3 Pista: mar**a*o 15 segundos y 6419 Puntos [03:41] Avestruz_ConPrisa
3 Pista: mar**a*o 15 segundos y 6419 Puntos
[03:41] Avestruz_ConPrisa �Increible!! Oveja{ConPrisa contest󺠃04"marchamo" en �8.281 segundos, y ha ganado �419�12 puntos [03:41] Avestruz_ConPrisa
�Increible!! Oveja{ConPrisa contest󺠃04"marchamo" en �8.281 segundos, y ha ganado �419�12 puntos
[03:41] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:41] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:41] Avestruz_ConPrisa Oveja{ConPrisa has acertado 1 seguidas!! Puntos HOY: 299403, SEMANA: 1864167 y MES: 1864167 [03:41] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 1 seguidas!! Puntos HOY: 299403, SEMANA: 1864167 y MES: 1864167
[03:41] Oveja{ConPrisa marchamo [03:41] Oveja{ConPrisa
marchamo
[03:42] Avestruz_ConPrisa Please refrain from using Extreme Bad Language [03:42] Avestruz_ConPrisa
Please refrain from using Extreme Bad Language
[03:42] Avestruz_ConPrisa Tri.2706 MitologiaɄivah˿ENiLAiMITOLOGIAiEGIPCIAiREGIONiDONDEiIBANiLASiALMASiDEiLOSiMUERTOSiPARAiSERiSOMETIDOSiALiSUPREMOiJUICIOi?i [03:42] Avestruz_ConPrisa
Tri.2706 MitologiaɄivah˿ENiLAiMITOLOGIAiEGIPCIAiREGIONiDONDEiIBANiLASiALMASiDEiLOSiMUERTOSiPARAiSERiSOMETIDOSiALiSUPREMOiJUICIOi?i
[03:42] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 14835 Puntos [03:42] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 14835 Puntos
[03:42] Avestruz_ConPrisa 2 Pista: ame*** 30 segundos y 14835 Puntos [03:42] Avestruz_ConPrisa
2 Pista: ame*** 30 segundos y 14835 Puntos
[03:42] Oveja{ConPrisa duat [03:42] Oveja{ConPrisa
duat
[03:42] Avestruz_ConPrisa 3 Pista: ame**i 15 segundos y 14835 Puntos [03:42] Avestruz_ConPrisa
3 Pista: ame**i 15 segundos y 14835 Puntos
[03:42] Avestruz_ConPrisa �Absolutamente correcto Oveja{ConPrisa!! Acertaste "amenti" en �2.062 segundos y ganas �4835�12 puntos [03:42] Avestruz_ConPrisa
�Absolutamente correcto Oveja{ConPrisa!! Acertaste "amenti" en �2.062 segundos y ganas �4835�12 puntos
[03:42] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:42] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:42] Avestruz_ConPrisa Oveja{ConPrisa has acertado 2 seguidas!! Puntos HOY: 314238, SEMANA: 1879002 y MES: 1879002 [03:42] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 2 seguidas!! Puntos HOY: 314238, SEMANA: 1879002 y MES: 1879002
[03:42] Oveja{ConPrisa amenti [03:42] Oveja{ConPrisa
amenti
[03:43] Avestruz_ConPrisa This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa [03:43] Avestruz_ConPrisa
This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa
[03:43] Avestruz_ConPrisa Tri.11068 Fisica-QuimicaɁigua˿Cuᬃ01aeszelametalam᳃01zpesadop?u [03:43] Avestruz_ConPrisa
Tri.11068 Fisica-QuimicaɁigua˿Cuᬃ01aeszelametalam᳃01zpesadop?u
[03:43] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 14440 Puntos [03:43] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 14440 Puntos
[03:43] Oveja{ConPrisa osmio [03:43] Oveja{ConPrisa
osmio
[03:43] Avestruz_ConPrisa 2 Pista: iri*** 30 segundos y 14440 Puntos [03:43] Avestruz_ConPrisa
2 Pista: iri*** 30 segundos y 14440 Puntos
[03:43] Oveja{ConPrisa irido [03:43] Oveja{ConPrisa
irido
[03:43] Avestruz_ConPrisa 3 Pista: iri*io 15 segundos y 14440 Puntos [03:43] Avestruz_ConPrisa
3 Pista: iri*io 15 segundos y 14440 Puntos
[03:43] Avestruz_ConPrisa �emuestra lo que sabes Oveja{ConPrisa! Has respondido "iridio" correctamente y eso te da: �4440�12 puntos [03:43] Avestruz_ConPrisa
�emuestra lo que sabes Oveja{ConPrisa! Has respondido "iridio" correctamente y eso te da: �4440�12 puntos
[03:43] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:43] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:43] Avestruz_ConPrisa Oveja{ConPrisa has acertado 3 seguidas!! Puntos HOY: 328678, SEMANA: 1893442 y MES: 1893442 [03:43] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 3 seguidas!! Puntos HOY: 328678, SEMANA: 1893442 y MES: 1893442
[03:43] Oveja{ConPrisa iridio [03:43] Oveja{ConPrisa
iridio
[03:43] Caracol_ConBravura Iridio [03:43] Caracol_ConBravura
Iridio
[03:43] Libelula-ConPrisa ♪ Sonando: Paolo Dari - Paolo - O Sole Mio [Audio] [03:43] Libelula-ConPrisa
♪ Sonando: Paolo Dari - Paolo - O Sole Mio [Audio]
[03:43] Caracol_ConBravura !tema [03:43] Caracol_ConBravura
!tema
[03:43] Avestruz_ConPrisa This WEEKS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0 [03:43] Avestruz_ConPrisa
This WEEKS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0
[03:43] Avestruz_ConPrisa Tri.14098 Fisica-Quimicaɑuique˿Enunci󃰱ulasrleyesrdeglaielectr󬩳is...u?u [03:43] Avestruz_ConPrisa
Tri.14098 Fisica-Quimicaɑuique˿Enunci󃰱ulasrleyesrdeglaielectr󬩳is...u?u
[03:43] Avestruz_ConPrisa 1 Pista: ******* ******* Valor pregunta : 16041 Puntos [03:43] Avestruz_ConPrisa
1 Pista: ******* ******* Valor pregunta : 16041 Puntos
[03:43] Caracol_ConBravura ^^ [03:43] Caracol_ConBravura
^^
[03:44] Avestruz_ConPrisa 2 Pista: mic**** ******* 30 segundos y 16041 Puntos [03:44] Avestruz_ConPrisa
2 Pista: mic**** ******* 30 segundos y 16041 Puntos
[03:44] Avestruz_ConPrisa 3 Pista: mic*ae* *a*a*a* 15 segundos y 16041 Puntos [03:44] Avestruz_ConPrisa
3 Pista: mic*ae* *a*a*a* 15 segundos y 16041 Puntos
[03:44] Avestruz_ConPrisa �Oveja{ConPrisa acert󡡠La respuesta era: "michael faraday" y contest󠥮 �0.531 segundos. Se lleva: �6041�12 puntos [03:44] Avestruz_ConPrisa
�Oveja{ConPrisa acert󡡠La respuesta era: "michael faraday" y contest󠥮 �0.531 segundos. Se lleva: �6041�12 puntos
[03:44] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:44] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:44] Avestruz_ConPrisa Oveja{ConPrisa has acertado 4 seguidas!! Puntos HOY: 344719, SEMANA: 1909483 y MES: 1909483 [03:44] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 4 seguidas!! Puntos HOY: 344719, SEMANA: 1909483 y MES: 1909483
[03:44] Oveja{ConPrisa michael faraday [03:44] Oveja{ConPrisa
michael faraday
[03:44] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [03:44] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[03:44] Avestruz_ConPrisa Tri.19693 Eros-Sexɭ˿Hombrewquewsewvistewdewmujer...b?b [03:44] Avestruz_ConPrisa
Tri.19693 Eros-Sexɭ˿Hombrewquewsewvistewdewmujer...b?b
[03:44] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 5317 Puntos [03:44] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 5317 Puntos
[03:44] Avestruz_ConPrisa 2 Pista: tra***** 30 segundos y 5317 Puntos [03:44] Avestruz_ConPrisa
2 Pista: tra***** 30 segundos y 5317 Puntos
[03:45] Avestruz_ConPrisa �Suma y sigue Oveja{ConPrisa!! La respuesta: "travesti" incrementa tu marcador en �317�12 puntos [03:45] Avestruz_ConPrisa
�Suma y sigue Oveja{ConPrisa!! La respuesta: "travesti" incrementa tu marcador en �317�12 puntos
[03:45] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:45] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:45] Avestruz_ConPrisa Oveja{ConPrisa has acertado 5 seguidas!! Puntos HOY: 350036, SEMANA: 1914800 y MES: 1914800 [03:45] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 5 seguidas!! Puntos HOY: 350036, SEMANA: 1914800 y MES: 1914800
[03:45] Oveja{ConPrisa travesti [03:45] Oveja{ConPrisa
travesti
[03:45] Avestruz_ConPrisa This MONTHS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0 [03:45] Avestruz_ConPrisa
This MONTHS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0
[03:45] Avestruz_ConPrisa Tri.5740 Cineɬeoplus˿CuantosdOscarrrecibi󃰱flaqpel�laqBraveheartt?f [03:45] Avestruz_ConPrisa
Tri.5740 Cineɬeoplus˿CuantosdOscarrrecibi󃰱flaqpel�laqBraveheartt?f
[03:45] Avestruz_ConPrisa 1 Pista: ***** Valor pregunta : 24895 Puntos [03:45] Avestruz_ConPrisa
1 Pista: ***** Valor pregunta : 24895 Puntos
[03:45] Gallina\Elocuente cinco [03:45] Gallina\Elocuente
cinco
[03:45] Avestruz_ConPrisa �Increible!! Gallina\Elocuente contest󺠃04"cinco" en �1.954 segundos, y ha ganado �4895�12 puntos [03:45] Avestruz_ConPrisa
�Increible!! Gallina\Elocuente contest󺠃04"cinco" en �1.954 segundos, y ha ganado �4895�12 puntos
[03:45] Avestruz_ConPrisa Gallina\Elocuente has acertado 1 seguidas!! Puntos HOY: 34894, SEMANA: 6866821 y MES: 6866821 [03:45] Avestruz_ConPrisa
Gallina\Elocuente has acertado 1 seguidas!! Puntos HOY: 34894, SEMANA: 6866821 y MES: 6866821
[03:45] Oveja{ConPrisa cinco [03:45] Oveja{ConPrisa
cinco
[03:45] Avestruz_ConPrisa R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516 [03:45] Avestruz_ConPrisa
R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516
[03:45] Avestruz_ConPrisa Tri.18487 Historiaɂuzzati˿CONfQUEfNOMBREfSEfCONOCEfALfSIGLOfVfANTESfDEfNUESTRAfERAf?f [03:45] Avestruz_ConPrisa
Tri.18487 Historiaɂuzzati˿CONfQUEfNOMBREfSEfCONOCEfALfSIGLOfVfANTESfDEfNUESTRAfERAf?f
[03:45] Avestruz_ConPrisa 1 Pista: ***** ** ******** Valor pregunta : 24925 Puntos [03:45] Avestruz_ConPrisa
1 Pista: ***** ** ******** Valor pregunta : 24925 Puntos
[03:45] Avestruz_ConPrisa 2 Pista: sig** ** ******** 30 segundos y 24925 Puntos [03:45] Avestruz_ConPrisa
2 Pista: sig** ** ******** 30 segundos y 24925 Puntos
[03:45] Cabra{Torpe unas fiestas con senoras armadas [03:45] Cabra{Torpe
unas fiestas con senoras armadas
[03:46] Cabra{Torpe fiestas de las buenas [03:46] Cabra{Torpe
fiestas de las buenas
[03:46] Avestruz_ConPrisa 3 Pista: sig*o *e *e*i**e* 15 segundos y 24925 Puntos [03:46] Avestruz_ConPrisa
3 Pista: sig*o *e *e*i**e* 15 segundos y 24925 Puntos
[03:46] Oveja{ConPrisa siglo de pericles [03:46] Oveja{ConPrisa
siglo de pericles
[03:46] Avestruz_ConPrisa �Oveja{ConPrisa acert󡡠La respuesta era: "siglo de pericles" y contest󠥮 �1.156 segundos. Se lleva: �4925�12 puntos [03:46] Avestruz_ConPrisa
�Oveja{ConPrisa acert󡡠La respuesta era: "siglo de pericles" y contest󠥮 �1.156 segundos. Se lleva: �4925�12 puntos
[03:46] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:46] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:46] Avestruz_ConPrisa Oveja{ConPrisa has acertado 1 seguidas!! Puntos HOY: 374961, SEMANA: 1939725 y MES: 1939725 [03:46] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 1 seguidas!! Puntos HOY: 374961, SEMANA: 1939725 y MES: 1939725
[03:46] Gallina\Elocuente siglo de periques [03:46] Gallina\Elocuente
siglo de periques
[03:46] Avestruz_ConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:46] Avestruz_ConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:46] Avestruz_ConPrisa Tri.8881 Geografiaɓebosin˿Cuᬃ01aeszelanombreaoriginaladeaPalestina?q?q [03:46] Avestruz_ConPrisa
Tri.8881 Geografiaɓebosin˿Cuᬃ01aeszelanombreaoriginaladeaPalestina?q?q
[03:46] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 6088 Puntos [03:46] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 6088 Puntos
[03:46] Oveja{ConPrisa jerusalen [03:46] Oveja{ConPrisa
jerusalen
[03:46] Avestruz_ConPrisa 2 Pista: fal***** 30 segundos y 6088 Puntos [03:46] Avestruz_ConPrisa
2 Pista: fal***** 30 segundos y 6088 Puntos
[03:46] Cabra{Torpe amo la vida de la fiesta [03:46] Cabra{Torpe
amo la vida de la fiesta
[03:46] Oveja{ConPrisa canaan [03:46] Oveja{ConPrisa
canaan
[03:46] Avestruz_ConPrisa 3 Pista: fala**i* 15 segundos y 6088 Puntos [03:46] Avestruz_ConPrisa
3 Pista: fala**i* 15 segundos y 6088 Puntos
[03:46] Cabra{Torpe la fiesta debe seguir el ciclo de la vida con señoras y mucha soda [03:46] Cabra{Torpe
la fiesta debe seguir el ciclo de la vida con señoras y mucha soda
[03:47] Avestruz_ConPrisa Tiempo! La respuesta es -> falastin <- [03:47] Avestruz_ConPrisa
Tiempo! La respuesta es -> falastin <-
[03:47] Cabra{Torpe las señoras van a la fiesta [03:47] Cabra{Torpe
las señoras van a la fiesta
[03:47] Avestruz_ConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:47] Avestruz_ConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:47] Avestruz_ConPrisa Tri.16943 MiscelaneaɔeLaRaNhA˿Elgqueiasierreiyarumosu?z [03:47] Avestruz_ConPrisa
Tri.16943 MiscelaneaɔeLaRaNhA˿Elgqueiasierreiyarumosu?z
[03:47] Avestruz_ConPrisa 1 Pista: *** ******* *** ******** Valor pregunta : 23333 Puntos [03:47] Avestruz_ConPrisa
1 Pista: *** ******* *** ******** Valor pregunta : 23333 Puntos
[03:47] Avestruz_ConPrisa 2 Pista: que ******* *** ******** 30 segundos y 23333 Puntos [03:47] Avestruz_ConPrisa
2 Pista: que ******* *** ******** 30 segundos y 23333 Puntos
[03:47] Cabra{Torpe todos vamos a la fiesta [03:47] Cabra{Torpe
todos vamos a la fiesta
[03:47] Cabra{Torpe porque nos gusta ver a las señoras tomando soda [03:47] Cabra{Torpe
porque nos gusta ver a las señoras tomando soda
[03:47] Avestruz_ConPrisa 3 Pista: que a*ua**e *a* *o**i*a* 15 segundos y 23333 Puntos [03:47] Avestruz_ConPrisa
3 Pista: que a*ua**e *a* *o**i*a* 15 segundos y 23333 Puntos
[03:47] Avestruz_ConPrisa Tiempo! La respuesta es -> que�guante�as�ormigas <- [03:47] Avestruz_ConPrisa
Tiempo! La respuesta es -> que�guante�as�ormigas <-
[03:48] Avestruz_ConPrisa R᮫ing SEMANA: - #1: Gallina\Elocuente 6866821 #2: Danielitto 4093466 #3: Oveja{ConPrisa 1939725 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [03:48] Avestruz_ConPrisa
R᮫ing SEMANA: - #1: Gallina\Elocuente 6866821 #2: Danielitto 4093466 #3: Oveja{ConPrisa 1939725 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[03:48] Avestruz_ConPrisa Tri.6479 Cineɴovarich˿ENrQUErPELICULArELEANORrPOWELLrLErDECIArArCHARLTONrHESTON:r"UNrBUENrPIANOrSOLOrSErSABErQUErESrBUENOrCUANDOrHArSIDOrTOCADOr?r [03:48] Avestruz_ConPrisa
Tri.6479 Cineɴovarich˿ENrQUErPELICULArELEANORrPOWELLrLErDECIArArCHARLTONrHESTON:r"UNrBUENrPIANOrSOLOrSErSABErQUErESrBUENOrCUANDOrHArSIDOrTOCADOr?r
[03:48] Avestruz_ConPrisa 1 Pista: ****** **** ** ********* Valor pregunta : 10892 Puntos [03:48] Avestruz_ConPrisa
1 Pista: ****** **** ** ********* Valor pregunta : 10892 Puntos
[03:48] Caracol_ConBravura Con hielito [03:48] Caracol_ConBravura
Con hielito
[03:48] Cabra{Torpe si y armadas [03:48] Cabra{Torpe
si y armadas
[03:48] Avestruz_ConPrisa 2 Pista: cua*** **** ** ********* 30 segundos y 10892 Puntos [03:48] Avestruz_ConPrisa
2 Pista: cua*** **** ** ********* 30 segundos y 10892 Puntos
[03:48] Caracol_ConBravura Que es eso [03:48] Caracol_ConBravura
Que es eso
[03:48] Cabra{Torpe señoras armadas en las fiestas [03:48] Cabra{Torpe
señoras armadas en las fiestas
[03:48] Caracol_ConBravura Cej [03:48] Caracol_ConBravura
Cej
[03:48] Caracol_ConBravura ^^ [03:48] Caracol_ConBravura
^^
[03:48] Cabra{Torpe vivan las armas , vivan las fiestas y viva la soda [03:48] Cabra{Torpe
vivan las armas , vivan las fiestas y viva la soda
[03:48] Avestruz_ConPrisa 3 Pista: cua**o *u*e *a *a*a*u**a 15 segundos y 10892 Puntos [03:48] Avestruz_ConPrisa
3 Pista: cua**o *u*e *a *a*a*u**a 15 segundos y 10892 Puntos
[03:48] Caracol_ConBravura Se te fue la olla [03:48] Caracol_ConBravura
Se te fue la olla
[03:48] Caracol_ConBravura Ya [03:48] Caracol_ConBravura
Ya
[03:48] Caracol_ConBravura Osea con pistola ^^ [03:48] Caracol_ConBravura
Osea con pistola ^^
[03:48] Avestruz_ConPrisa Tiempo! La respuesta es -> cuando�uge�a�arabunta <- [03:48] Avestruz_ConPrisa
Tiempo! La respuesta es -> cuando�uge�a�arabunta <-
[03:48] Caracol_ConBravura Ais no [03:48] Caracol_ConBravura
Ais no
[03:49] Cabra{Torpe jjajajajajaja [03:49] Cabra{Torpe
jjajajajajaja
[03:49] Avestruz_ConPrisa We feature over 50,000 Q&A ! [03:49] Avestruz_ConPrisa
We feature over 50,000 Q&A !
[03:49] Avestruz_ConPrisa Tri.12073 Musicaɨelvetis˿EnzquemdiscondemThemDoorszaparecem"Riderszonzthemstorm"s?s [03:49] Avestruz_ConPrisa
Tri.12073 Musicaɨelvetis˿EnzquemdiscondemThemDoorszaparecem"Riderszonzthemstorm"s?s
[03:49] Avestruz_ConPrisa 1 Pista: *. *. ***** Valor pregunta : 5489 Puntos [03:49] Avestruz_ConPrisa
1 Pista: *. *. ***** Valor pregunta : 5489 Puntos
[03:49] Cabra{Torpe con buen rifle [03:49] Cabra{Torpe
con buen rifle
[03:49] Avestruz_ConPrisa 2 Pista: l.�. ***** 30 segundos y 5489 Puntos [03:49] Avestruz_ConPrisa
2 Pista: l.�. ***** 30 segundos y 5489 Puntos
[03:49] Cabra{Torpe uun fusil semiautomatico [03:49] Cabra{Torpe
uun fusil semiautomatico
[03:49] Oveja{ConPrisa la woman [03:49] Oveja{ConPrisa
la woman
[03:49] Cabra{Torpe de esos para la fiesta [03:49] Cabra{Torpe
de esos para la fiesta
[03:49] Avestruz_ConPrisa 3 Pista: l.�. *o*a* 15 segundos y 5489 Puntos [03:49] Avestruz_ConPrisa
3 Pista: l.�. *o*a* 15 segundos y 5489 Puntos
[03:49] Cabra{Torpe para amanecer tomando soda [03:49] Cabra{Torpe
para amanecer tomando soda
[03:49] Avestruz_ConPrisa Tiempo! La respuesta es -> l.�.�oman <- [03:49] Avestruz_ConPrisa
Tiempo! La respuesta es -> l.�.�oman <-
[03:50] Avestruz_ConPrisa Tri.4209 Politicaɞlaura˿CUALlERAlELlSEGUNDOlAPELLIDOlDElCARREROlBLANCO?l?l [03:50] Avestruz_ConPrisa
Tri.4209 Politicaɞlaura˿CUALlERAlELlSEGUNDOlAPELLIDOlDElCARREROlBLANCO?l?l
[03:50] Avestruz_ConPrisa 1 Pista: ****** Pregunta de BONUS : 100000 Puntos [03:50] Avestruz_ConPrisa
1 Pista: ****** Pregunta de BONUS : 100000 Puntos
[03:50] Avestruz_ConPrisa 2 Pista: bla*** 30 segundos y 100000 Puntos [03:50] Avestruz_ConPrisa
2 Pista: bla*** 30 segundos y 100000 Puntos
[03:50] Avestruz_ConPrisa �e nota que sabes mucho de esto Oveja{ConPrisa! Tu respuesta "blanco" es correcta y ganas �00000�12 puntos [03:50] Avestruz_ConPrisa
�e nota que sabes mucho de esto Oveja{ConPrisa! Tu respuesta "blanco" es correcta y ganas �00000�12 puntos
[03:50] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:50] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:50] Avestruz_ConPrisa Oveja{ConPrisa has acertado 2 seguidas!! Puntos HOY: 474961, SEMANA: 2039725 y MES: 2039725 [03:50] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 2 seguidas!! Puntos HOY: 474961, SEMANA: 2039725 y MES: 2039725
[03:50] Oveja{ConPrisa blanco [03:50] Oveja{ConPrisa
blanco
[03:50] Avestruz_ConPrisa Tri.9338 LiteraturaɁlkaid˿AsQUEsDRAMATURGOsCONTEMPORANEOsDEBEMOSs"PELOsDEsTORMENTA"?s?s [03:50] Avestruz_ConPrisa
Tri.9338 LiteraturaɁlkaid˿AsQUEsDRAMATURGOsCONTEMPORANEOsDEBEMOSs"PELOsDEsTORMENTA"?s?s
[03:50] Avestruz_ConPrisa 1 Pista: ********* ***** Valor pregunta : 19200 Puntos [03:50] Avestruz_ConPrisa
1 Pista: ********* ***** Valor pregunta : 19200 Puntos
[03:50] Cabra{Torpe habias ido a la fiesta? [03:50] Cabra{Torpe
habias ido a la fiesta?
[03:50] Cabra{Torpe siempre hay buenas fiestas con señoras armadas [03:50] Cabra{Torpe
siempre hay buenas fiestas con señoras armadas
[03:50] Avestruz_ConPrisa 2 Pista: fra****** ***** 30 segundos y 19200 Puntos [03:50] Avestruz_ConPrisa
2 Pista: fra****** ***** 30 segundos y 19200 Puntos
[03:51] Oveja{ConPrisa francisco nieva [03:51] Oveja{ConPrisa
francisco nieva
[03:51] Avestruz_ConPrisa �Absolutamente correcto Oveja{ConPrisa!! Acertaste "francisco nieva" en �1.875 segundos y ganas �9200�12 puntos [03:51] Avestruz_ConPrisa
�Absolutamente correcto Oveja{ConPrisa!! Acertaste "francisco nieva" en �1.875 segundos y ganas �9200�12 puntos
[03:51] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:51] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:51] Avestruz_ConPrisa Oveja{ConPrisa has acertado 3 seguidas!! Puntos HOY: 494161, SEMANA: 2058925 y MES: 2058925 [03:51] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 3 seguidas!! Puntos HOY: 494161, SEMANA: 2058925 y MES: 2058925
[03:51] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [03:51] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[03:51] Avestruz_ConPrisa Tri.20884 Fisica-Quimicaɴoyo˿ArquekelementojcorrespondekelzsimbolojIr?r [03:51] Avestruz_ConPrisa
Tri.20884 Fisica-Quimicaɴoyo˿ArquekelementojcorrespondekelzsimbolojIr?r
[03:51] Avestruz_ConPrisa 1 Pista: **** Valor pregunta : 18278 Puntos [03:51] Avestruz_ConPrisa
1 Pista: **** Valor pregunta : 18278 Puntos
[03:51] Oveja{ConPrisa yodo [03:51] Oveja{ConPrisa
yodo
[03:51] Avestruz_ConPrisa �Oveja{ConPrisa acert󡡠La respuesta era: "yodo" y contest󠥮 �.391 segundos. Se lleva: �8278�12 puntos [03:51] Avestruz_ConPrisa
�Oveja{ConPrisa acert󡡠La respuesta era: "yodo" y contest󠥮 �.391 segundos. Se lleva: �8278�12 puntos
[03:51] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:51] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:51] Avestruz_ConPrisa Oveja{ConPrisa has acertado 4 seguidas!! Puntos HOY: 512439, SEMANA: 2077203 y MES: 2077203 [03:51] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 4 seguidas!! Puntos HOY: 512439, SEMANA: 2077203 y MES: 2077203
[03:51] Avestruz_ConPrisa R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898 [03:51] Avestruz_ConPrisa
R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898
[03:51] Avestruz_ConPrisa Tri.9877 LiteraturaɍARdeJAVAˑUɃ01bAUTORbALEM�b(1749-1832)bESCRIBIӃ01b"bBALADAbDELbREYbDEbTHULE".b?b [03:51] Avestruz_ConPrisa
Tri.9877 LiteraturaɍARdeJAVAˑUɃ01bAUTORbALEM�b(1749-1832)bESCRIBIӃ01b"bBALADAbDELbREYbDEbTHULE".b?b
[03:51] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 14066 Puntos [03:51] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 14066 Puntos
[03:51] Avestruz_ConPrisa 2 Pista: goe*** 30 segundos y 14066 Puntos [03:51] Avestruz_ConPrisa
2 Pista: goe*** 30 segundos y 14066 Puntos
[03:52] Avestruz_ConPrisa �Est᳠que lo tiras Oveja{ConPrisa!! ߃󭯠supiste que "goethe" era la respuesta? Venga, �4066�12 puntos suben a tu marcador [03:52] Avestruz_ConPrisa
�Est᳠que lo tiras Oveja{ConPrisa!! ߃󭯠supiste que "goethe" era la respuesta? Venga, �4066�12 puntos suben a tu marcador
[03:52] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:52] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:52] Avestruz_ConPrisa Oveja{ConPrisa has acertado 5 seguidas!! Puntos HOY: 526505, SEMANA: 2091269 y MES: 2091269 [03:52] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 5 seguidas!! Puntos HOY: 526505, SEMANA: 2091269 y MES: 2091269
[03:52] Oveja{ConPrisa goethe [03:52] Oveja{ConPrisa
goethe
[03:52] Avestruz_ConPrisa If you think a Q&A is wrong, please call an OP [03:52] Avestruz_ConPrisa
If you think a Q&A is wrong, please call an OP
[03:52] Avestruz_ConPrisa Tri.13509 LiteraturaɍARdeJAVAˑUɃ01fESCRITORfFRANCɓf(1867-1905)fESfELfAUTORfDEf"VIDASfIMAGINARIAS"?f?f [03:52] Avestruz_ConPrisa
Tri.13509 LiteraturaɍARdeJAVAˑUɃ01fESCRITORfFRANCɓf(1867-1905)fESfELfAUTORfDEf"VIDASfIMAGINARIAS"?f?f
[03:52] Avestruz_ConPrisa 1 Pista: ****** ****** Valor pregunta : 12211 Puntos [03:52] Avestruz_ConPrisa
1 Pista: ****** ****** Valor pregunta : 12211 Puntos
[03:52] Avestruz_ConPrisa 2 Pista: mar*** ****** 30 segundos y 12211 Puntos [03:52] Avestruz_ConPrisa
2 Pista: mar*** ****** 30 segundos y 12211 Puntos
[03:52] Oveja{ConPrisa marcel schwob [03:52] Oveja{ConPrisa
marcel schwob
[03:52] Avestruz_ConPrisa �Suma y sigue Oveja{ConPrisa!! La respuesta: "marcel schwob" incrementa tu marcador en �2211�12 puntos [03:52] Avestruz_ConPrisa
�Suma y sigue Oveja{ConPrisa!! La respuesta: "marcel schwob" incrementa tu marcador en �2211�12 puntos
[03:52] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:52] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:52] Avestruz_ConPrisa Oveja{ConPrisa has acertado 6 seguidas!! Puntos HOY: 538716, SEMANA: 2103480 y MES: 2103480 [03:52] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 6 seguidas!! Puntos HOY: 538716, SEMANA: 2103480 y MES: 2103480
[03:52] Avestruz_ConPrisa R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226 [03:52] Avestruz_ConPrisa
R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226
[03:52] Avestruz_ConPrisa Tri.8002 MitologiaɄeannus˿Atlasisostienemlaybovedaydelwuniversozperozquemsignificaysubnombre?w?w [03:52] Avestruz_ConPrisa
Tri.8002 MitologiaɄeannus˿Atlasisostienemlaybovedaydelwuniversozperozquemsignificaysubnombre?w?w
[03:52] Avestruz_ConPrisa 1 Pista: ** *** ***** Valor pregunta : 15407 Puntos [03:52] Avestruz_ConPrisa
1 Pista: ** *** ***** Valor pregunta : 15407 Puntos
[03:53] Avestruz_ConPrisa 2 Pista: el�** ***** 30 segundos y 15407 Puntos [03:53] Avestruz_ConPrisa
2 Pista: el�** ***** 30 segundos y 15407 Puntos
[03:53] Avestruz_ConPrisa 3 Pista: el�ue *a**a 15 segundos y 15407 Puntos [03:53] Avestruz_ConPrisa
3 Pista: el�ue *a**a 15 segundos y 15407 Puntos
[03:53] Avestruz_ConPrisa Tiempo! La respuesta es -> el�ue�arga <- [03:53] Avestruz_ConPrisa
Tiempo! La respuesta es -> el�ue�arga <-
[03:53] Avestruz_ConPrisa For The Competitive Edge type !pingme [03:53] Avestruz_ConPrisa
For The Competitive Edge type !pingme
[03:53] Avestruz_ConPrisa Tri.14509 Cancionesɬa˿Deqquienkeskelkdiscoj"Endorama"e?e [03:53] Avestruz_ConPrisa
Tri.14509 Cancionesɬa˿Deqquienkeskelkdiscoj"Endorama"e?e
[03:53] Avestruz_ConPrisa 1 Pista: ********* Valor pregunta : 14620 Puntos [03:53] Avestruz_ConPrisa
1 Pista: ********* Valor pregunta : 14620 Puntos
[03:53] Oveja{ConPrisa aespa [03:53] Oveja{ConPrisa
aespa
[03:54] Avestruz_ConPrisa 2 Pista: mot****** 30 segundos y 14620 Puntos [03:54] Avestruz_ConPrisa
2 Pista: mot****** 30 segundos y 14620 Puntos
[03:54] Avestruz_ConPrisa 3 Pista: moto**ea* 15 segundos y 14620 Puntos [03:54] Avestruz_ConPrisa
3 Pista: moto**ea* 15 segundos y 14620 Puntos
[03:54] Avestruz_ConPrisa Tiempo! La respuesta es -> motorhead <- [03:54] Avestruz_ConPrisa
Tiempo! La respuesta es -> motorhead <-
[03:54] Avestruz_ConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:54] Avestruz_ConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:54] Avestruz_ConPrisa Tri.9827 Medicina-Saludɤuende1˿Glandulashcausanteshdeodeterminadosholoreshcorporales.....a?a [03:54] Avestruz_ConPrisa
Tri.9827 Medicina-Saludɤuende1˿Glandulashcausanteshdeodeterminadosholoreshcorporales.....a?a
[03:54] Avestruz_ConPrisa 1 Pista: ********* ********* Valor pregunta : 8092 Puntos [03:54] Avestruz_ConPrisa
1 Pista: ********* ********* Valor pregunta : 8092 Puntos
[03:54] Avestruz_ConPrisa 2 Pista: gla****** ********* 30 segundos y 8092 Puntos [03:54] Avestruz_ConPrisa
2 Pista: gla****** ********* 30 segundos y 8092 Puntos
[03:55] Oveja{ConPrisa glandulas sudoriparas [03:55] Oveja{ConPrisa
glandulas sudoriparas
[03:55] Avestruz_ConPrisa 3 Pista: gla**u*a* a*o**i*a* 15 segundos y 8092 Puntos [03:55] Avestruz_ConPrisa
3 Pista: gla**u*a* a*o**i*a* 15 segundos y 8092 Puntos
[03:55] Avestruz_ConPrisa Tiempo! La respuesta es -> glandulas�pocrinas <- [03:55] Avestruz_ConPrisa
Tiempo! La respuesta es -> glandulas�pocrinas <-
[03:55] Avestruz_ConPrisa R᮫ing MES: - #1: Gallina\Elocuente 6866821 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2103480 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [03:55] Avestruz_ConPrisa
R᮫ing MES: - #1: Gallina\Elocuente 6866821 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2103480 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[03:55] Avestruz_ConPrisa Tri.20271 Personajesɪoam˿Afqui鮃01cencarg󃰱fManuellIfdebPortugallquebencontrasebunatrutatmar�mathaciatlatIndia?f?f [03:55] Avestruz_ConPrisa
Tri.20271 Personajesɪoam˿Afqui鮃01cencarg󃰱fManuellIfdebPortugallquebencontrasebunatrutatmar�mathaciatlatIndia?f?f
[03:55] Avestruz_ConPrisa 1 Pista: ***** ** **** Valor pregunta : 10359 Puntos [03:55] Avestruz_ConPrisa
1 Pista: ***** ** **** Valor pregunta : 10359 Puntos
[03:55] Avestruz_ConPrisa 2 Pista: vas** ** **** 30 segundos y 10359 Puntos [03:55] Avestruz_ConPrisa
2 Pista: vas** ** **** 30 segundos y 10359 Puntos
[03:56] Gallina\Elocuente vasco de gama [03:56] Gallina\Elocuente
vasco de gama
[03:56] Avestruz_ConPrisa 3 Pista: vas*o *a *a*a 15 segundos y 10359 Puntos [03:56] Avestruz_ConPrisa
3 Pista: vas*o *a *a*a 15 segundos y 10359 Puntos
[03:56] Gallina\Elocuente vasco de gama [03:56] Gallina\Elocuente
vasco de gama
[03:56] Avestruz_ConPrisa Tiempo! La respuesta es -> vasco�a�ama <- [03:56] Avestruz_ConPrisa
Tiempo! La respuesta es -> vasco�a�ama <-
[03:56] Avestruz_ConPrisa Please refrain from using Extreme Bad Language [03:56] Avestruz_ConPrisa
Please refrain from using Extreme Bad Language
[03:56] Avestruz_ConPrisa Tri.3508 BiologiaɎisko˿Cualveslelvprincipalvefectomdeplawkinetinawenxlaslhojasldepvegetalesl?k [03:56] Avestruz_ConPrisa
Tri.3508 BiologiaɎisko˿Cualveslelvprincipalvefectomdeplawkinetinawenxlaslhojasldepvegetalesl?k
[03:56] Avestruz_ConPrisa 1 Pista: ******* ** ********* ** ********** Valor pregunta : 5346 Puntos [03:56] Avestruz_ConPrisa
1 Pista: ******* ** ********* ** ********** Valor pregunta : 5346 Puntos
[03:56] Avestruz_ConPrisa 2 Pista: aum**** ** ********* ** ********** 30 segundos y 5346 Puntos [03:56] Avestruz_ConPrisa
2 Pista: aum**** ** ********* ** ********** 30 segundos y 5346 Puntos
[03:57] Avestruz_ConPrisa 3 Pista: aume**a *a *e*e**io* *e **o*o*i*a* 15 segundos y 5346 Puntos [03:57] Avestruz_ConPrisa
3 Pista: aume**a *a *e*e**io* *e **o*o*i*a* 15 segundos y 5346 Puntos
[03:57] Cabra{Torpe se buscan mujeres armadas que quieran ir a una fiesta con soda [03:57] Cabra{Torpe
se buscan mujeres armadas que quieran ir a una fiesta con soda
[03:57] Oveja{ConPrisa retraso de la senescencia [03:57] Oveja{ConPrisa
retraso de la senescencia
[03:57] Avestruz_ConPrisa Tiempo! La respuesta es -> aumenta�a�etencion�e�lorofilas <- [03:57] Avestruz_ConPrisa
Tiempo! La respuesta es -> aumenta�a�etencion�e�lorofilas <-
[03:57] Avestruz_ConPrisa This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa [03:57] Avestruz_ConPrisa
This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa
[03:57] Avestruz_ConPrisa Tri.8201 Arteɬusie˿Encqu郰1esalaidelqmuseoddedElqPradodestᮃ01cLasaMeninas?e?e [03:57] Avestruz_ConPrisa
Tri.8201 Arteɬusie˿Encqu郰1esalaidelqmuseoddedElqPradodestᮃ01cLasaMeninas?e?e
[03:57] Avestruz_ConPrisa 1 Pista: ** ** **** **** Valor pregunta : 10478 Puntos [03:57] Avestruz_ConPrisa
1 Pista: ** ** **** **** Valor pregunta : 10478 Puntos
[03:57] Gallina\Elocuente [Cabra{Torpe] basta ya de armas :( [03:57] Gallina\Elocuente
[Cabra{Torpe] basta ya de armas :(
[03:57] Cabra{Torpe si llegan al por mayor, mejor [03:57] Cabra{Torpe
si llegan al por mayor, mejor
[03:57] Caracol_ConBravura ACTION busca el electrochock cej. [03:57] Caracol_ConBravura
ACTION busca el electrochock cej.
[03:57] Cabra{Torpe jajajaja !!! ok [03:57] Cabra{Torpe
jajajaja !!! ok
[03:57] Avestruz_ConPrisa 2 Pista: en�* **** **** 30 segundos y 10478 Puntos [03:57] Avestruz_ConPrisa
2 Pista: en�* **** **** 30 segundos y 10478 Puntos
[03:57] Caracol_ConBravura Ais [03:57] Caracol_ConBravura
Ais
[03:57] Cabra{Torpe estas mujeres están mas armadas !!! hasta los dientes [03:57] Cabra{Torpe
estas mujeres están mas armadas !!! hasta los dientes
[03:57] Avestruz_ConPrisa 3 Pista: en�a *a*a *o*e 15 segundos y 10478 Puntos [03:57] Avestruz_ConPrisa
3 Pista: en�a *a*a *o*e 15 segundos y 10478 Puntos
[03:57] Oveja{ConPrisa en la sala doce [03:57] Oveja{ConPrisa
en la sala doce
[03:57] Avestruz_ConPrisa �Bien Oveja{ConPrisa!! Tu respuesta: "en la sala doce" es correcta y ganas �0478�12 puntos [03:57] Avestruz_ConPrisa
�Bien Oveja{ConPrisa!! Tu respuesta: "en la sala doce" es correcta y ganas �0478�12 puntos
[03:57] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:57] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:57] Avestruz_ConPrisa Oveja{ConPrisa has acertado 7 seguidas!! Puntos HOY: 549194, SEMANA: 2113958 y MES: 2113958 [03:57] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 7 seguidas!! Puntos HOY: 549194, SEMANA: 2113958 y MES: 2113958
[03:58] Avestruz_ConPrisa This WEEKS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0 [03:58] Avestruz_ConPrisa
This WEEKS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0
[03:58] Avestruz_ConPrisa Tri.4899 GeografiaɍARdeJAVAːARAeLLEGAReALePAC͆ICOeDESDEeELeMAReCARIBEeTENDREMOSeQUEeCRUZAReEL...e?e [03:58] Avestruz_ConPrisa
Tri.4899 GeografiaɍARdeJAVAːARAeLLEGAReALePAC͆ICOeDESDEeELeMAReCARIBEeTENDREMOSeQUEeCRUZAReEL...e?e
[03:58] Avestruz_ConPrisa 1 Pista: ***** ** ****** Pregunta de BONUS : 50000 Puntos [03:58] Avestruz_ConPrisa
1 Pista: ***** ** ****** Pregunta de BONUS : 50000 Puntos
[03:58] Avestruz_ConPrisa 2 Pista: can** ** ****** 30 segundos y 50000 Puntos [03:58] Avestruz_ConPrisa
2 Pista: can** ** ****** 30 segundos y 50000 Puntos
[03:58] Avestruz_ConPrisa �Increible!! Oveja{ConPrisa contest󺠃04"canal de panama" en �6.812 segundos, y ha ganado �0000�12 puntos [03:58] Avestruz_ConPrisa
�Increible!! Oveja{ConPrisa contest󺠃04"canal de panama" en �6.812 segundos, y ha ganado �0000�12 puntos
[03:58] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:58] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:58] Avestruz_ConPrisa Oveja{ConPrisa has acertado 8 seguidas!! Puntos HOY: 599194, SEMANA: 2163958 y MES: 2163958 [03:58] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 8 seguidas!! Puntos HOY: 599194, SEMANA: 2163958 y MES: 2163958
[03:58] Oveja{ConPrisa canal de panama [03:58] Oveja{ConPrisa
canal de panama
[03:58] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [03:58] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[03:58] Avestruz_ConPrisa Tri.11769 LiteraturaɍARdeJAVAˑUɃ01iAUTORiMEXICANOi(1581-1639)iESCRIBIӃ01i"iLAiCUEVAiDEiSALAMANCA"i.(DEiESPECT�ULO)i?i [03:58] Avestruz_ConPrisa
Tri.11769 LiteraturaɍARdeJAVAˑUɃ01iAUTORiMEXICANOi(1581-1639)iESCRIBIӃ01i"iLAiCUEVAiDEiSALAMANCA"i.(DEiESPECT�ULO)i?i
[03:58] Avestruz_ConPrisa 1 Pista: **** **** ** ******* Valor pregunta : 22876 Puntos [03:58] Avestruz_ConPrisa
1 Pista: **** **** ** ******* Valor pregunta : 22876 Puntos
[03:58] Avestruz_ConPrisa 2 Pista: jua* **** ** ******* 30 segundos y 22876 Puntos [03:58] Avestruz_ConPrisa
2 Pista: jua* **** ** ******* 30 segundos y 22876 Puntos
[03:59] Avestruz_ConPrisa �Muy bien Oveja{ConPrisa!! Acertaste "juan ruiz de alarcon" en tan s󬯠�4 segundos y por eso has ganado: �2876�12 puntos [03:59] Avestruz_ConPrisa
�Muy bien Oveja{ConPrisa!! Acertaste "juan ruiz de alarcon" en tan s󬯠�4 segundos y por eso has ganado: �2876�12 puntos
[03:59] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:59] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:59] Avestruz_ConPrisa Oveja{ConPrisa has acertado 9 seguidas!! Puntos HOY: 622070, SEMANA: 2186834 y MES: 2186834 [03:59] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 9 seguidas!! Puntos HOY: 622070, SEMANA: 2186834 y MES: 2186834
[03:59] Oveja{ConPrisa juan ruiz de alarcon [03:59] Oveja{ConPrisa
juan ruiz de alarcon
[03:59] Avestruz_ConPrisa This MONTHS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0 [03:59] Avestruz_ConPrisa
This MONTHS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0
[03:59] Avestruz_ConPrisa Tri.16747 Medicina-SaludɁWELETE˿ELuTONOMETROuMIDEuLAŃ01u?u [03:59] Avestruz_ConPrisa
Tri.16747 Medicina-SaludɁWELETE˿ELuTONOMETROuMIDEuLAŃ01u?u
[03:59] Avestruz_ConPrisa 1 Pista: ******* ****** Pregunta de BONUS : 100000 Puntos [03:59] Avestruz_ConPrisa
1 Pista: ******* ****** Pregunta de BONUS : 100000 Puntos
[03:59] Avestruz_ConPrisa 2 Pista: pre**** ****** 30 segundos y 100000 Puntos [03:59] Avestruz_ConPrisa
2 Pista: pre**** ****** 30 segundos y 100000 Puntos
[03:59] Avestruz_ConPrisa 3 Pista: pre*io* o*u*a* 15 segundos y 100000 Puntos [03:59] Avestruz_ConPrisa
3 Pista: pre*io* o*u*a* 15 segundos y 100000 Puntos
[03:59] Oveja{ConPrisa presion ocular [03:59] Oveja{ConPrisa
presion ocular
[03:59] Avestruz_ConPrisa �Est᳠que lo tiras Oveja{ConPrisa!! ߃󭯠supiste que "presion ocular" era la respuesta? Venga, �00000�12 puntos suben a tu marcador [03:59] Avestruz_ConPrisa
�Est᳠que lo tiras Oveja{ConPrisa!! ߃󭯠supiste que "presion ocular" era la respuesta? Venga, �00000�12 puntos suben a tu marcador
[03:59] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [03:59] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[03:59] Avestruz_ConPrisa Oveja{ConPrisa has acertado 10 seguidas!! Puntos HOY: 722070, SEMANA: 2286834 y MES: 2286834 [03:59] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 10 seguidas!! Puntos HOY: 722070, SEMANA: 2286834 y MES: 2286834
[03:59] Avestruz_ConPrisa Bonus especial de 50000 Puntos para Oveja{ConPrisa por acertar 10 seguidas!!! [03:59] Avestruz_ConPrisa
Bonus especial de 50000 Puntos para Oveja{ConPrisa por acertar 10 seguidas!!!
[04:00] Avestruz_ConPrisa R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516 [04:00] Avestruz_ConPrisa
R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516
[04:00] Avestruz_ConPrisa Tri.5434 Mitologiaɉsis^˿ConiquefanimalkerayrepresentadoqelkdioslegipcioqAnubisl?e [04:00] Avestruz_ConPrisa
Tri.5434 Mitologiaɉsis^˿ConiquefanimalkerayrepresentadoqelkdioslegipcioqAnubisl?e
[04:00] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 17865 Puntos [04:00] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 17865 Puntos
[04:00] Avestruz_ConPrisa 2 Pista: cha*** 30 segundos y 17865 Puntos [04:00] Avestruz_ConPrisa
2 Pista: cha*** 30 segundos y 17865 Puntos
[04:00] Avestruz_ConPrisa �Bingo!! Oveja{ConPrisa dio la respuesta: "chacal" en �8.547 segundos e incrementa sus ganancias con �7865�12 puntos [04:00] Avestruz_ConPrisa
�Bingo!! Oveja{ConPrisa dio la respuesta: "chacal" en �8.547 segundos e incrementa sus ganancias con �7865�12 puntos
[04:00] Oveja{ConPrisa chacal [04:00] Oveja{ConPrisa
chacal
[04:00] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [04:00] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[04:00] Avestruz_ConPrisa Oveja{ConPrisa has acertado 11 seguidas!! Puntos HOY: 789935, SEMANA: 2354699 y MES: 2354699 [04:00] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 11 seguidas!! Puntos HOY: 789935, SEMANA: 2354699 y MES: 2354699
[04:00] Avestruz_ConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [04:00] Avestruz_ConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[04:00] Avestruz_ConPrisa Tri.13454 Personajesɑuim˿C󭯃01hsetllamabajelzmaridohdetlajescritorajgallegajRosaliajdetCastro,cquientlajpusohentcontactohcontB飱uer,cyccontlajquettuvoh6chijosc?c [04:00] Avestruz_ConPrisa
Tri.13454 Personajesɑuim˿C󭯃01hsetllamabajelzmaridohdetlajescritorajgallegajRosaliajdetCastro,cquientlajpusohentcontactohcontB飱uer,cyccontlajquettuvoh6chijosc?c
[04:00] Avestruz_ConPrisa 1 Pista: ****** ******* Valor pregunta : 16441 Puntos [04:00] Avestruz_ConPrisa
1 Pista: ****** ******* Valor pregunta : 16441 Puntos
[04:00] Avestruz_ConPrisa 2 Pista: man*** ******* 30 segundos y 16441 Puntos [04:00] Avestruz_ConPrisa
2 Pista: man*** ******* 30 segundos y 16441 Puntos
[04:01] Avestruz_ConPrisa 3 Pista: manue* *u**uia 15 segundos y 16441 Puntos [04:01] Avestruz_ConPrisa
3 Pista: manue* *u**uia 15 segundos y 16441 Puntos
[04:01] Avestruz_ConPrisa �Ol頃04Gallina\Elocuente!! Has contestado: "manuel murguia" en �1.766 segundos y sumas �6441�12 puntos a tu marcador. �Sigue as� [04:01] Avestruz_ConPrisa
�Ol頃04Gallina\Elocuente!! Has contestado: "manuel murguia" en �1.766 segundos y sumas �6441�12 puntos a tu marcador. �Sigue as�
[04:01] Avestruz_ConPrisa Gallina\Elocuente has acertado 1 seguidas!! Puntos HOY: 51335, SEMANA: 6883262 y MES: 6883262 [04:01] Avestruz_ConPrisa
Gallina\Elocuente has acertado 1 seguidas!! Puntos HOY: 51335, SEMANA: 6883262 y MES: 6883262
[04:01] Gallina\Elocuente manuel murguia [04:01] Gallina\Elocuente
manuel murguia
[04:01] Avestruz_ConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [04:01] Avestruz_ConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[04:01] Avestruz_ConPrisa Tri.2601 IdiomasɎAPINE˿Definiciones:mCALZADOmDEmTELAmCONmSUELAmDEmESPARTOmTRENZADOm?m [04:01] Avestruz_ConPrisa
Tri.2601 IdiomasɎAPINE˿Definiciones:mCALZADOmDEmTELAmCONmSUELAmDEmESPARTOmTRENZADOm?m
[04:01] Avestruz_ConPrisa 1 Pista: ********* Valor pregunta : 12352 Puntos [04:01] Avestruz_ConPrisa
1 Pista: ********* Valor pregunta : 12352 Puntos
[04:01] Avestruz_ConPrisa 2 Pista: alp****** 30 segundos y 12352 Puntos [04:01] Avestruz_ConPrisa
2 Pista: alp****** 30 segundos y 12352 Puntos
[04:01] Oveja{ConPrisa alpargata [04:01] Oveja{ConPrisa
alpargata
[04:01] Avestruz_ConPrisa �e nota que sabes mucho de esto Oveja{ConPrisa! Tu respuesta "alpargata" es correcta y ganas �2352�12 puntos [04:01] Avestruz_ConPrisa
�e nota que sabes mucho de esto Oveja{ConPrisa! Tu respuesta "alpargata" es correcta y ganas �2352�12 puntos
[04:01] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [04:01] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[04:01] Avestruz_ConPrisa Oveja{ConPrisa has acertado 1 seguidas!! Puntos HOY: 802287, SEMANA: 2367051 y MES: 2367051 [04:01] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 1 seguidas!! Puntos HOY: 802287, SEMANA: 2367051 y MES: 2367051
[04:01] Gallina\Elocuente alpargata [04:01] Gallina\Elocuente
alpargata
[04:01] Avestruz_ConPrisa R᮫ing SEMANA: - #1: Gallina\Elocuente 6883262 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2367051 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [04:01] Avestruz_ConPrisa
R᮫ing SEMANA: - #1: Gallina\Elocuente 6883262 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2367051 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[04:01] Avestruz_ConPrisa Tri.12859 Cotilleo-TVɖivian˿Enbqu郰1yciudadeseepublicawTheeTimes?y?y [04:01] Avestruz_ConPrisa
Tri.12859 Cotilleo-TVɖivian˿Enbqu郰1yciudadeseepublicawTheeTimes?y?y
[04:01] Avestruz_ConPrisa 1 Pista: ******* Valor pregunta : 6964 Puntos [04:01] Avestruz_ConPrisa
1 Pista: ******* Valor pregunta : 6964 Puntos
[04:02] Avestruz_ConPrisa 2 Pista: lon**** 30 segundos y 6964 Puntos [04:02] Avestruz_ConPrisa
2 Pista: lon**** 30 segundos y 6964 Puntos
[04:02] Gallina\Elocuente londres [04:02] Gallina\Elocuente
londres
[04:02] Avestruz_ConPrisa �Increible!! Gallina\Elocuente contest󺠃04"londres" en �1.781 segundos, y ha ganado �964�12 puntos [04:02] Avestruz_ConPrisa
�Increible!! Gallina\Elocuente contest󺠃04"londres" en �1.781 segundos, y ha ganado �964�12 puntos
[04:02] Avestruz_ConPrisa Gallina\Elocuente has acertado 1 seguidas!! Puntos HOY: 58299, SEMANA: 6890226 y MES: 6890226 [04:02] Avestruz_ConPrisa
Gallina\Elocuente has acertado 1 seguidas!! Puntos HOY: 58299, SEMANA: 6890226 y MES: 6890226
[04:02] Oveja{ConPrisa londres [04:02] Oveja{ConPrisa
londres
[04:02] Avestruz_ConPrisa We feature over 50,000 Q&A ! [04:02] Avestruz_ConPrisa
We feature over 50,000 Q&A !
[04:02] Avestruz_ConPrisa Tri.20157 GeografiaɅl_Zurdo˿Enequ郰1rpa�01lestჰ1rela"PasohdelaCatalᮢ?r?r [04:02] Avestruz_ConPrisa
Tri.20157 GeografiaɅl_Zurdo˿Enequ郰1rpa�01lestჰ1rela"PasohdelaCatalᮢ?r?r
[04:02] Avestruz_ConPrisa 1 Pista: ******* Valor pregunta : 19198 Puntos [04:02] Avestruz_ConPrisa
1 Pista: ******* Valor pregunta : 19198 Puntos
[04:02] Oveja{ConPrisa ya debo irme  que la pasen bien [04:02] Oveja{ConPrisa
ya debo irme  que la pasen bien
[04:02] Avestruz_ConPrisa 2 Pista: uru**** 30 segundos y 19198 Puntos [04:02] Avestruz_ConPrisa
2 Pista: uru**** 30 segundos y 19198 Puntos
[04:02] Avestruz_ConPrisa �Bingo!! Gallina\Elocuente dio la respuesta: "uruguay" en �2.391 segundos e incrementa sus ganancias con �9198�12 puntos [04:02] Avestruz_ConPrisa
�Bingo!! Gallina\Elocuente dio la respuesta: "uruguay" en �2.391 segundos e incrementa sus ganancias con �9198�12 puntos
[04:02] Avestruz_ConPrisa Gallina\Elocuente has acertado 2 seguidas!! Puntos HOY: 77497, SEMANA: 6909424 y MES: 6909424 [04:02] Avestruz_ConPrisa
Gallina\Elocuente has acertado 2 seguidas!! Puntos HOY: 77497, SEMANA: 6909424 y MES: 6909424
[04:02] Gallina\Elocuente uruguay [04:02] Gallina\Elocuente
uruguay
[04:02] Oveja{ConPrisa uruguay [04:02] Oveja{ConPrisa
uruguay
[04:02] Avestruz_ConPrisa Tri.8122 Idiomasɓebosin˿Diccionario-C󭯃01vsewlewllamapaplapmentirapdisfrazadapconkartificio?f?f [04:02] Avestruz_ConPrisa
Tri.8122 Idiomasɓebosin˿Diccionario-C󭯃01vsewlewllamapaplapmentirapdisfrazadapconkartificio?f?f
[04:02] Avestruz_ConPrisa 1 Pista: ******* Valor pregunta : 13846 Puntos [04:02] Avestruz_ConPrisa
1 Pista: ******* Valor pregunta : 13846 Puntos
[04:03] Avestruz_ConPrisa 2 Pista: emb**** 30 segundos y 13846 Puntos [04:03] Avestruz_ConPrisa
2 Pista: emb**** 30 segundos y 13846 Puntos
[04:03] Avestruz_ConPrisa �Enhorabuena Oveja{ConPrisa!! Has contestado "embuste" y por ello has ganado �3846�12 puntos [04:03] Avestruz_ConPrisa
�Enhorabuena Oveja{ConPrisa!! Has contestado "embuste" y por ello has ganado �3846�12 puntos
[04:03] Avestruz_ConPrisa ACTION awards Oveja{ConPrisa with a +v for having over 15000 points [04:03] Avestruz_ConPrisa
ACTION awards Oveja{ConPrisa with a +v for having over 15000 points
[04:03] Avestruz_ConPrisa Oveja{ConPrisa has acertado 1 seguidas!! Puntos HOY: 816133, SEMANA: 2380897 y MES: 2380897 [04:03] Avestruz_ConPrisa
Oveja{ConPrisa has acertado 1 seguidas!! Puntos HOY: 816133, SEMANA: 2380897 y MES: 2380897
[04:03] Oveja{ConPrisa embuste [04:03] Oveja{ConPrisa
embuste
[04:03] Avestruz_ConPrisa Tri.11154 Fisica-QuimicaɃort˿Comoyseallamanxlasgl�asgqueaunenxpuntosgdeaigualapresi󮃰1x?s [04:03] Avestruz_ConPrisa
Tri.11154 Fisica-QuimicaɃort˿Comoyseallamanxlasgl�asgqueaunenxpuntosgdeaigualapresi󮃰1x?s
[04:03] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 23817 Puntos [04:03] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 23817 Puntos
[04:03] Avestruz_ConPrisa 2 Pista: iso***** 30 segundos y 23817 Puntos [04:03] Avestruz_ConPrisa
2 Pista: iso***** 30 segundos y 23817 Puntos
[04:03] Avestruz_ConPrisa 3 Pista: iso*a*a* 15 segundos y 23817 Puntos [04:03] Avestruz_ConPrisa
3 Pista: iso*a*a* 15 segundos y 23817 Puntos
[04:04] Avestruz_ConPrisa Tiempo! La respuesta es -> isobaras <- [04:04] Avestruz_ConPrisa
Tiempo! La respuesta es -> isobaras <-
[04:04] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [04:04] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[04:04] Avestruz_ConPrisa Tri.8884 Cotilleo-TVɃarPEnTer˿Degqui鮃01reraphermanogStevenrenrlapserieg"Dinast�w?w [04:04] Avestruz_ConPrisa
Tri.8884 Cotilleo-TVɃarPEnTer˿Degqui鮃01reraphermanogStevenrenrlapserieg"Dinast�w?w
[04:04] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 7502 Puntos [04:04] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 7502 Puntos
[04:04] Avestruz_ConPrisa 2 Pista: fal*** 30 segundos y 7502 Puntos [04:04] Avestruz_ConPrisa
2 Pista: fal*** 30 segundos y 7502 Puntos
[04:04] Avestruz_ConPrisa 3 Pista: fal*o* 15 segundos y 7502 Puntos [04:04] Avestruz_ConPrisa
3 Pista: fal*o* 15 segundos y 7502 Puntos
[04:04] Gallina\Elocuente falcon [04:04] Gallina\Elocuente
falcon
[04:05] Avestruz_ConPrisa Tiempo! La respuesta es -> fallon <- [04:05] Avestruz_ConPrisa
Tiempo! La respuesta es -> fallon <-
[04:05] Avestruz_ConPrisa R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898 [04:05] Avestruz_ConPrisa
R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898
[04:05] Avestruz_ConPrisa Tri.19766 Miscelaneaɴamzarian˿Colocaci󮃰1xdezplantaseenxfilaseparalelas,fdezmododquezlasedezcadalfilalcorrespondanxalfmedioddezlosehuecosedezlalfilalinmediatal?f [04:05] Avestruz_ConPrisa
Tri.19766 Miscelaneaɴamzarian˿Colocaci󮃰1xdezplantaseenxfilaseparalelas,fdezmododquezlasedezcadalfilalcorrespondanxalfmedioddezlosehuecosedezlalfilalinmediatal?f
[04:05] Avestruz_ConPrisa 1 Pista: *********** Valor pregunta : 7893 Puntos [04:05] Avestruz_ConPrisa
1 Pista: *********** Valor pregunta : 7893 Puntos
[04:05] Avestruz_ConPrisa 2 Pista: tre******** 30 segundos y 7893 Puntos [04:05] Avestruz_ConPrisa
2 Pista: tre******** 30 segundos y 7893 Puntos
[04:05] Gallina\Elocuente tresbolillo [04:05] Gallina\Elocuente
tresbolillo
[04:05] Avestruz_ConPrisa �Gallina\Elocuente acert󡡠La respuesta era: "tresbolillo" y contest󠥮 �9.625 segundos. Se lleva: �893�12 puntos [04:05] Avestruz_ConPrisa
�Gallina\Elocuente acert󡡠La respuesta era: "tresbolillo" y contest󠥮 �9.625 segundos. Se lleva: �893�12 puntos
[04:05] Avestruz_ConPrisa Gallina\Elocuente has acertado 1 seguidas!! Puntos HOY: 85390, SEMANA: 6917317 y MES: 6917317 [04:05] Avestruz_ConPrisa
Gallina\Elocuente has acertado 1 seguidas!! Puntos HOY: 85390, SEMANA: 6917317 y MES: 6917317
[04:05] Avestruz_ConPrisa If you think a Q&A is wrong, please call an OP [04:05] Avestruz_ConPrisa
If you think a Q&A is wrong, please call an OP
[04:05] Avestruz_ConPrisa Tri.7107 Medicina-Saludɲaziel9˿COMOmSEmLLAMAmELmMIEDOmAmIRmAmLAmESCUELAm?m [04:05] Avestruz_ConPrisa
Tri.7107 Medicina-Saludɲaziel9˿COMOmSEmLLAMAmELmMIEDOmAmIRmAmLAmESCUELAm?m
[04:05] Avestruz_ConPrisa 1 Pista: ***************** Valor pregunta : 20137 Puntos [04:05] Avestruz_ConPrisa
1 Pista: ***************** Valor pregunta : 20137 Puntos
[04:06] Avestruz_ConPrisa 2 Pista: did************** 30 segundos y 20137 Puntos [04:06] Avestruz_ConPrisa
2 Pista: did************** 30 segundos y 20137 Puntos
[04:06] Avestruz_ConPrisa 3 Pista: dida**a*ei*o*o*ia 15 segundos y 20137 Puntos [04:06] Avestruz_ConPrisa
3 Pista: dida**a*ei*o*o*ia 15 segundos y 20137 Puntos
[04:06] Avestruz_ConPrisa Tiempo! La respuesta es -> didaskaleinofobia <- [04:06] Avestruz_ConPrisa
Tiempo! La respuesta es -> didaskaleinofobia <-
[04:06] Avestruz_ConPrisa R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226 [04:06] Avestruz_ConPrisa
R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226
[04:06] Avestruz_ConPrisa Tri.10767 Historiaɴjmm.com˿Ennqu郰1gguerrazsetutilizaronnpormprimerazvezggaseswvenenosos?g?g [04:06] Avestruz_ConPrisa
Tri.10767 Historiaɴjmm.com˿Ennqu郰1gguerrazsetutilizaronnpormprimerazvezggaseswvenenosos?g?g
[04:06] Avestruz_ConPrisa 1 Pista: * ****** ******* Valor pregunta : 10464 Puntos [04:06] Avestruz_ConPrisa
1 Pista: * ****** ******* Valor pregunta : 10464 Puntos
[04:07] Avestruz_ConPrisa 2 Pista: i�***** ******* 30 segundos y 10464 Puntos [04:07] Avestruz_ConPrisa
2 Pista: i�***** ******* 30 segundos y 10464 Puntos
[04:07] Avestruz_ConPrisa 3 Pista: i�ue**a *u**ia* 15 segundos y 10464 Puntos [04:07] Avestruz_ConPrisa
3 Pista: i�ue**a *u**ia* 15 segundos y 10464 Puntos
[04:07] Avestruz_ConPrisa Tiempo! La respuesta es -> i�uerra�undial <- [04:07] Avestruz_ConPrisa
Tiempo! La respuesta es -> i�uerra�undial <-
[04:07] Avestruz_ConPrisa For The Competitive Edge type !pingme [04:07] Avestruz_ConPrisa
For The Competitive Edge type !pingme
[04:07] Avestruz_ConPrisa Tri.1120 IdiomasɄassler˿Cuᬃ01weseelwsin󮩭oedeslasepalabraseDERROCHEzDILAPIDACIONz󃰱zPRODIGALIDAD?z?z [04:07] Avestruz_ConPrisa
Tri.1120 IdiomasɄassler˿Cuᬃ01weseelwsin󮩭oedeslasepalabraseDERROCHEzDILAPIDACIONz󃰱zPRODIGALIDAD?z?z
[04:07] Avestruz_ConPrisa 1 Pista: *********** Valor pregunta : 11454 Puntos [04:07] Avestruz_ConPrisa
1 Pista: *********** Valor pregunta : 11454 Puntos
[04:07] Avestruz_ConPrisa 2 Pista: Des******** 30 segundos y 11454 Puntos [04:07] Avestruz_ConPrisa
2 Pista: Des******** 30 segundos y 11454 Puntos
[04:08] Avestruz_ConPrisa 3 Pista: Des*i**a**o 15 segundos y 11454 Puntos [04:08] Avestruz_ConPrisa
3 Pista: Des*i**a**o 15 segundos y 11454 Puntos
[04:08] Avestruz_ConPrisa Tiempo! La respuesta es -> Despilfarro <- [04:08] Avestruz_ConPrisa
Tiempo! La respuesta es -> Despilfarro <-
[04:08] Avestruz_ConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [04:08] Avestruz_ConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[04:08] Avestruz_ConPrisa Tri.14682 Eros-Sexɒachy˿Amorpazlazimagencdensigmismo,wconcexcitacioncsexualaproducidazporplazadmiracioncdelapropioncuerpon?w [04:08] Avestruz_ConPrisa
Tri.14682 Eros-Sexɒachy˿Amorpazlazimagencdensigmismo,wconcexcitacioncsexualaproducidazporplazadmiracioncdelapropioncuerpon?w
[04:08] Avestruz_ConPrisa 1 Pista: ********** Valor pregunta : 14864 Puntos [04:08] Avestruz_ConPrisa
1 Pista: ********** Valor pregunta : 14864 Puntos
[04:08] Avestruz_ConPrisa 2 Pista: nar******* 30 segundos y 14864 Puntos [04:08] Avestruz_ConPrisa
2 Pista: nar******* 30 segundos y 14864 Puntos
[04:09] Avestruz_ConPrisa 3 Pista: nar*i*i**o 15 segundos y 14864 Puntos [04:09] Avestruz_ConPrisa
3 Pista: nar*i*i**o 15 segundos y 14864 Puntos
[04:09] Gallina\Elocuente narcisismo [04:09] Gallina\Elocuente
narcisismo
[04:09] Avestruz_ConPrisa �Absolutamente correcto Gallina\Elocuente!! Acertaste "narcisismo" en �3.891 segundos y ganas �4864�12 puntos [04:09] Avestruz_ConPrisa
�Absolutamente correcto Gallina\Elocuente!! Acertaste "narcisismo" en �3.891 segundos y ganas �4864�12 puntos
[04:09] Avestruz_ConPrisa Gallina\Elocuente has acertado 2 seguidas!! Puntos HOY: 100254, SEMANA: 6932181 y MES: 6932181 [04:09] Avestruz_ConPrisa
Gallina\Elocuente has acertado 2 seguidas!! Puntos HOY: 100254, SEMANA: 6932181 y MES: 6932181
[04:09] Avestruz_ConPrisa R᮫ing MES: - #1: Gallina\Elocuente 6917317 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [04:09] Avestruz_ConPrisa
R᮫ing MES: - #1: Gallina\Elocuente 6917317 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 531253 #5: Alii 491671 #6: Caracol_ConBravura 428330 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[04:09] Avestruz_ConPrisa Tri.12229 Musicaɐsico666ˤelquelnovelaudelWilliamgBurroughsrsali󃰱bporkprimerauvezbelst鲭inovheavyvmetals?b [04:09] Avestruz_ConPrisa
Tri.12229 Musicaɐsico666ˤelquelnovelaudelWilliamgBurroughsrsali󃰱bporkprimerauvezbelst鲭inovheavyvmetals?b
[04:09] Avestruz_ConPrisa 1 Pista: ** ******* ****** Valor pregunta : 16334 Puntos [04:09] Avestruz_ConPrisa
1 Pista: ** ******* ****** Valor pregunta : 16334 Puntos
[04:09] Avestruz_ConPrisa 2 Pista: la�****** ****** 30 segundos y 16334 Puntos [04:09] Avestruz_ConPrisa
2 Pista: la�****** ****** 30 segundos y 16334 Puntos
[04:10] Avestruz_ConPrisa 3 Pista: la�a*ui*a **a**a 15 segundos y 16334 Puntos [04:10] Avestruz_ConPrisa
3 Pista: la�a*ui*a **a**a 15 segundos y 16334 Puntos
[04:10] Avestruz_ConPrisa Tiempo! La respuesta es -> la�aquina�lanca <- [04:10] Avestruz_ConPrisa
Tiempo! La respuesta es -> la�aquina�lanca <-
[04:10] Avestruz_ConPrisa Please refrain from using Extreme Bad Language [04:10] Avestruz_ConPrisa
Please refrain from using Extreme Bad Language
[04:10] Avestruz_ConPrisa Tri.2356 PersonajesɂRUJI˿ARTISTAtMAStFAMOSOtDELtRENACIMIENTOtALEMAN,tPINTOtENTREtOTRASt"LOStCUATROtAPOSTOLES"t?t [04:10] Avestruz_ConPrisa
Tri.2356 PersonajesɂRUJI˿ARTISTAtMAStFAMOSOtDELtRENACIMIENTOtALEMAN,tPINTOtENTREtOTRASt"LOStCUATROtAPOSTOLES"t?t
[04:10] Avestruz_ConPrisa 1 Pista: ******* ****** Valor pregunta : 14082 Puntos [04:10] Avestruz_ConPrisa
1 Pista: ******* ****** Valor pregunta : 14082 Puntos
[04:10] Avestruz_ConPrisa 2 Pista: alb**** ****** 30 segundos y 14082 Puntos [04:10] Avestruz_ConPrisa
2 Pista: alb**** ****** 30 segundos y 14082 Puntos
[04:10] Avestruz_ConPrisa 3 Pista: albe**o *u*e*o 15 segundos y 14082 Puntos [04:10] Avestruz_ConPrisa
3 Pista: albe**o *u*e*o 15 segundos y 14082 Puntos
[04:11] Avestruz_ConPrisa Tiempo! La respuesta es -> alberto�urero <- [04:11] Avestruz_ConPrisa
Tiempo! La respuesta es -> alberto�urero <-
[04:11] Avestruz_ConPrisa This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa [04:11] Avestruz_ConPrisa
This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa
[04:11] Avestruz_ConPrisa Tri.15377 Cineɴamzarian˿Actrizznorteamericana,zhermanardenJoanlFontainen?z [04:11] Avestruz_ConPrisa
Tri.15377 Cineɴamzarian˿Actrizznorteamericana,zhermanardenJoanlFontainen?z
[04:11] Avestruz_ConPrisa 1 Pista: ****** ** ********* Valor pregunta : 17840 Puntos [04:11] Avestruz_ConPrisa
1 Pista: ****** ** ********* Valor pregunta : 17840 Puntos
[04:11] Avestruz_ConPrisa 2 Pista: oli*** ** ********* 30 segundos y 17840 Puntos [04:11] Avestruz_ConPrisa
2 Pista: oli*** ** ********* 30 segundos y 17840 Puntos
[04:11] Avestruz_ConPrisa 3 Pista: oli*ia *e *a*i**a** 15 segundos y 17840 Puntos [04:11] Avestruz_ConPrisa
3 Pista: oli*ia *e *a*i**a** 15 segundos y 17840 Puntos
[04:12] Avestruz_ConPrisa Tiempo! La respuesta es -> olivia�e�avilland <- [04:12] Avestruz_ConPrisa
Tiempo! La respuesta es -> olivia�e�avilland <-
[04:12] Avestruz_ConPrisa This WEEKS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0 [04:12] Avestruz_ConPrisa
This WEEKS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0
[04:12] Avestruz_ConPrisa Tri.10722 Politicaɭ˿C󭯃01ysezllamageldpresidentezdezVenezuelag(2004)d?d [04:12] Avestruz_ConPrisa
Tri.10722 Politicaɭ˿C󭯃01ysezllamageldpresidentezdezVenezuelag(2004)d?d
[04:12] Avestruz_ConPrisa 1 Pista: **** ****** Valor pregunta : 13056 Puntos [04:12] Avestruz_ConPrisa
1 Pista: **** ****** Valor pregunta : 13056 Puntos
[04:12] Avestruz_ConPrisa 2 Pista: hug* ****** 30 segundos y 13056 Puntos [04:12] Avestruz_ConPrisa
2 Pista: hug* ****** 30 segundos y 13056 Puntos
[04:12] Gallina\Elocuente hugo sanchez [04:12] Gallina\Elocuente
hugo sanchez
[04:12] Avestruz_ConPrisa 3 Pista: hugo **a*e* 15 segundos y 13056 Puntos [04:12] Avestruz_ConPrisa
3 Pista: hugo **a*e* 15 segundos y 13056 Puntos
[04:13] Avestruz_ConPrisa �As�e hace Gallina\Elocuente!! Contestaste "hugo chavez" en �9.796 segundos y sumas �3056�12 puntos [04:13] Avestruz_ConPrisa
�As�e hace Gallina\Elocuente!! Contestaste "hugo chavez" en �9.796 segundos y sumas �3056�12 puntos
[04:13] Avestruz_ConPrisa Gallina\Elocuente has acertado 3 seguidas!! Puntos HOY: 113310, SEMANA: 6945237 y MES: 6945237 [04:13] Avestruz_ConPrisa
Gallina\Elocuente has acertado 3 seguidas!! Puntos HOY: 113310, SEMANA: 6945237 y MES: 6945237
[04:13] Gallina\Elocuente hugo chavez [04:13] Gallina\Elocuente
hugo chavez
[04:13] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [04:13] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[04:13] Avestruz_ConPrisa Tri.11895 Cotilleo-TVɃarPEnTer˿(DragongBall)wCuᬃ01eesleleaut鮴icounombrefdefGokub?w [04:13] Avestruz_ConPrisa
Tri.11895 Cotilleo-TVɃarPEnTer˿(DragongBall)wCuᬃ01eesleleaut鮴icounombrefdefGokub?w
[04:13] Avestruz_ConPrisa 1 Pista: ******* Valor pregunta : 16834 Puntos [04:13] Avestruz_ConPrisa
1 Pista: ******* Valor pregunta : 16834 Puntos
[04:13] Avestruz_ConPrisa 2 Pista: kak**** 30 segundos y 16834 Puntos [04:13] Avestruz_ConPrisa
2 Pista: kak**** 30 segundos y 16834 Puntos
[04:13] Avestruz_ConPrisa 3 Pista: kaka*o* 15 segundos y 16834 Puntos [04:13] Avestruz_ConPrisa
3 Pista: kaka*o* 15 segundos y 16834 Puntos
[04:13] Avestruz_ConPrisa Tiempo! La respuesta es -> kakarot <- [04:13] Avestruz_ConPrisa
Tiempo! La respuesta es -> kakarot <-
[04:14] Avestruz_ConPrisa This MONTHS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0 [04:14] Avestruz_ConPrisa
This MONTHS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0
[04:14] Avestruz_ConPrisa Tri.13395 Literaturaɉcia˿DondepestavambientadavlavnovelavdepTorcuatolLucavdepTenavLosxrenglonesxtorcidosxdepDiosx?s [04:14] Avestruz_ConPrisa
Tri.13395 Literaturaɉcia˿DondepestavambientadavlavnovelavdepTorcuatolLucavdepTenavLosxrenglonesxtorcidosxdepDiosx?s
[04:14] Avestruz_ConPrisa 1 Pista: ********* Pregunta de BONUS : 50000 Puntos [04:14] Avestruz_ConPrisa
1 Pista: ********* Pregunta de BONUS : 50000 Puntos
[04:14] Avestruz_ConPrisa 2 Pista: man****** 30 segundos y 50000 Puntos [04:14] Avestruz_ConPrisa
2 Pista: man****** 30 segundos y 50000 Puntos
[04:14] Avestruz_ConPrisa 3 Pista: mani*o*io 15 segundos y 50000 Puntos [04:14] Avestruz_ConPrisa
3 Pista: mani*o*io 15 segundos y 50000 Puntos
[04:14] Caracol_ConBravura Manicomio [04:14] Caracol_ConBravura
Manicomio
[04:14] Avestruz_ConPrisa �Muy bien Caracol_ConBravura!! Acertaste "Manicomio" en tan s󬯠�7.219 segundos y por eso has ganado: �0000�12 puntos [04:14] Avestruz_ConPrisa
�Muy bien Caracol_ConBravura!! Acertaste "Manicomio" en tan s󬯠�7.219 segundos y por eso has ganado: �0000�12 puntos
[04:14] Avestruz_ConPrisa Caracol_ConBravura has acertado 1 seguidas!! Puntos HOY: 50000, SEMANA: 478330 y MES: 478330 [04:14] Avestruz_ConPrisa
Caracol_ConBravura has acertado 1 seguidas!! Puntos HOY: 50000, SEMANA: 478330 y MES: 478330
[04:14] Gallina\Elocuente manicomio [04:14] Gallina\Elocuente
manicomio
[04:14] Cabra{Torpe ahi vives Caracol_ConBravura ? [04:14] Cabra{Torpe
ahi vives Caracol_ConBravura ?
[04:14] Cabra{Torpe xD [04:14] Cabra{Torpe
xD
[04:14] Avestruz_ConPrisa R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516 [04:14] Avestruz_ConPrisa
R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516
[04:14] Avestruz_ConPrisa Tri.17823 Historiaɳtephewo˿ComowsecllamazelqcampowdecconcentracionkquecestazenkPostdam?t?t [04:14] Avestruz_ConPrisa
Tri.17823 Historiaɳtephewo˿ComowsecllamazelqcampowdecconcentracionkquecestazenkPostdam?t?t
[04:14] Avestruz_ConPrisa 1 Pista: ************* Valor pregunta : 7504 Puntos [04:14] Avestruz_ConPrisa
1 Pista: ************* Valor pregunta : 7504 Puntos
[04:15] Avestruz_ConPrisa 2 Pista: sac********** 30 segundos y 7504 Puntos [04:15] Avestruz_ConPrisa
2 Pista: sac********** 30 segundos y 7504 Puntos
[04:15] Caracol_ConBravura Ajajaja [04:15] Caracol_ConBravura
Ajajaja
[04:15] Cabra{Torpe jajajajaja [04:15] Cabra{Torpe
jajajajaja
[04:15] Caracol_ConBravura Welcome3 ajajaja al lado [04:15] Caracol_ConBravura
Welcome3 ajajaja al lado
[04:15] Avestruz_ConPrisa 3 Pista: sac**e**au*e* 15 segundos y 7504 Puntos [04:15] Avestruz_ConPrisa
3 Pista: sac**e**au*e* 15 segundos y 7504 Puntos
[04:15] Caracol_ConBravura Ajaaja gafo chamo [04:15] Caracol_ConBravura
Ajaaja gafo chamo
[04:15] Caracol_ConBravura Jajajaja [04:15] Caracol_ConBravura
Jajajaja
[04:15] Cabra{Torpe lo teneis claro!!! [04:15] Cabra{Torpe
lo teneis claro!!!
[04:15] Avestruz_ConPrisa Tiempo! La respuesta es -> sachsenhausen <- [04:15] Avestruz_ConPrisa
Tiempo! La respuesta es -> sachsenhausen <-
[04:15] Cabra{Torpe :*** [04:15] Cabra{Torpe
:***
[04:15] Caracol_ConBravura Que masssssss [04:15] Caracol_ConBravura
Que masssssss
[04:15] Avestruz_ConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [04:15] Avestruz_ConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[04:15] Avestruz_ConPrisa Tri.14946 Biologiaɖivian˿Cu᮴asfalasftienebunarpulga?w?w [04:15] Avestruz_ConPrisa
Tri.14946 Biologiaɖivian˿Cu᮴asfalasftienebunarpulga?w?w
[04:15] Avestruz_ConPrisa 1 Pista: ******* Valor pregunta : 21396 Puntos [04:15] Avestruz_ConPrisa
1 Pista: ******* Valor pregunta : 21396 Puntos
[04:15] Caracol_ConBravura Asi es [04:15] Caracol_ConBravura
Asi es
[04:15] Caracol_ConBravura Ninguna [04:15] Caracol_ConBravura
Ninguna
[04:15] Avestruz_ConPrisa �Increible!! Caracol_ConBravura contest󺠃04"Ninguna" en �.672 segundos, y ha ganado �1396�12 puntos [04:15] Avestruz_ConPrisa
�Increible!! Caracol_ConBravura contest󺠃04"Ninguna" en �.672 segundos, y ha ganado �1396�12 puntos
[04:15] Avestruz_ConPrisa Caracol_ConBravura has acertado 2 seguidas!! Puntos HOY: 71396, SEMANA: 499726 y MES: 499726 [04:15] Avestruz_ConPrisa
Caracol_ConBravura has acertado 2 seguidas!! Puntos HOY: 71396, SEMANA: 499726 y MES: 499726
[04:15] Gallina\Elocuente ninguna [04:15] Gallina\Elocuente
ninguna
[04:16] Avestruz_ConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [04:16] Avestruz_ConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[04:16] Avestruz_ConPrisa Tri.4841 Cotilleo-TVɚytox˿ComowsebllamanlannoviandebCarlosndebInglaterran?h [04:16] Avestruz_ConPrisa
Tri.4841 Cotilleo-TVɚytox˿ComowsebllamanlannoviandebCarlosndebInglaterran?h
[04:16] Avestruz_ConPrisa 1 Pista: ****** ****** ****** Valor pregunta : 11386 Puntos [04:16] Avestruz_ConPrisa
1 Pista: ****** ****** ****** Valor pregunta : 11386 Puntos
[04:16] Caracol_ConBravura Ajajaj y que pulga con alas fosfora ajaja [04:16] Caracol_ConBravura
Ajajaj y que pulga con alas fosfora ajaja
[04:16] Avestruz_ConPrisa 2 Pista: cam*** ****** ****** 30 segundos y 11386 Puntos [04:16] Avestruz_ConPrisa
2 Pista: cam*** ****** ****** 30 segundos y 11386 Puntos
[04:16] Caracol_ConBravura Camila [04:16] Caracol_ConBravura
Camila
[04:16] Avestruz_ConPrisa 3 Pista: cami*a *a**e* *o**e* 15 segundos y 11386 Puntos [04:16] Avestruz_ConPrisa
3 Pista: cami*a *a**e* *o**e* 15 segundos y 11386 Puntos
[04:16] Avestruz_ConPrisa Tiempo! La respuesta es -> camila�arker�owles <- [04:16] Avestruz_ConPrisa
Tiempo! La respuesta es -> camila�arker�owles <-
[04:17] Avestruz_ConPrisa R᮫ing SEMANA: - #1: Gallina\Elocuente 6945237 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 531253 #5: Caracol_ConBravura 499726 #6: Alii 491671 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [04:17] Avestruz_ConPrisa
R᮫ing SEMANA: - #1: Gallina\Elocuente 6945237 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 531253 #5: Caracol_ConBravura 499726 #6: Alii 491671 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[04:17] Avestruz_ConPrisa Tri.17024 Eros-Sexɒachy˿Condici󮃰1bdeks󬯃01robtenerzexcitaci󮃰1bsexualoenbsituacionesidekpeligror?r [04:17] Avestruz_ConPrisa
Tri.17024 Eros-Sexɒachy˿Condici󮃰1bdeks󬯃01robtenerzexcitaci󮃰1bsexualoenbsituacionesidekpeligror?r
[04:17] Avestruz_ConPrisa 1 Pista: ************* Valor pregunta : 12988 Puntos [04:17] Avestruz_ConPrisa
1 Pista: ************* Valor pregunta : 12988 Puntos
[04:17] Avestruz_ConPrisa 2 Pista: qui********** 30 segundos y 12988 Puntos [04:17] Avestruz_ConPrisa
2 Pista: qui********** 30 segundos y 12988 Puntos
[04:17] Avestruz_ConPrisa 3 Pista: qui*u*o*a**ia 15 segundos y 12988 Puntos [04:17] Avestruz_ConPrisa
3 Pista: qui*u*o*a**ia 15 segundos y 12988 Puntos
[04:17] Avestruz_ConPrisa Tiempo! La respuesta es -> quinunolagnia <- [04:17] Avestruz_ConPrisa
Tiempo! La respuesta es -> quinunolagnia <-
[04:17] Avestruz_ConPrisa We feature over 50,000 Q&A ! [04:17] Avestruz_ConPrisa
We feature over 50,000 Q&A !
[04:17] Avestruz_ConPrisa Tri.2416 Cotilleo-TVɴjmm.com˿Consqui鮃01ssepcas󃰱qlaqhijaqdepJos郰1qMar�01qAznar,qAnaqAznar,qensSept-2002?q?q [04:17] Avestruz_ConPrisa
Tri.2416 Cotilleo-TVɴjmm.com˿Consqui鮃01ssepcas󃰱qlaqhijaqdepJos郰1qMar�01qAznar,qAnaqAznar,qensSept-2002?q?q
[04:17] Avestruz_ConPrisa 1 Pista: ********* **** Valor pregunta : 21743 Puntos [04:17] Avestruz_ConPrisa
1 Pista: ********* **** Valor pregunta : 21743 Puntos
[04:18] Avestruz_ConPrisa 2 Pista: ale****** **** 30 segundos y 21743 Puntos [04:18] Avestruz_ConPrisa
2 Pista: ale****** **** 30 segundos y 21743 Puntos
[04:18] Avestruz_ConPrisa 3 Pista: ale*a***o a*a* 15 segundos y 21743 Puntos [04:18] Avestruz_ConPrisa
3 Pista: ale*a***o a*a* 15 segundos y 21743 Puntos
[04:18] Avestruz_ConPrisa Tiempo! La respuesta es -> alejandro�gag <- [04:18] Avestruz_ConPrisa
Tiempo! La respuesta es -> alejandro�gag <-
[04:18] Avestruz_ConPrisa Tri.20572 IdiomasɄassler˿C󭯃01useediceeentholand鳃01pMARIPOSA?x?x [04:18] Avestruz_ConPrisa
Tri.20572 IdiomasɄassler˿C󭯃01useediceeentholand鳃01pMARIPOSA?x?x
[04:18] Avestruz_ConPrisa 1 Pista: ******* Valor pregunta : 16023 Puntos [04:18] Avestruz_ConPrisa
1 Pista: ******* Valor pregunta : 16023 Puntos
[04:19] Avestruz_ConPrisa 2 Pista: vli**** 30 segundos y 16023 Puntos [04:19] Avestruz_ConPrisa
2 Pista: vli**** 30 segundos y 16023 Puntos
[04:19] Avestruz_ConPrisa 3 Pista: vli**e* 15 segundos y 16023 Puntos [04:19] Avestruz_ConPrisa
3 Pista: vli**e* 15 segundos y 16023 Puntos
[04:19] Avestruz_ConPrisa Tiempo! La respuesta es -> vlinder <- [04:19] Avestruz_ConPrisa
Tiempo! La respuesta es -> vlinder <-
[04:19] Avestruz_ConPrisa Tri.13304 Informaticaɳtephenwo˿C󭯃01bsendenominasentjergasinformᴩcasallpotentenordenadorcquensenconectasasunasobvariaslestacionesldentrabajo?n?n [04:19] Avestruz_ConPrisa
Tri.13304 Informaticaɳtephenwo˿C󭯃01bsendenominasentjergasinformᴩcasallpotentenordenadorcquensenconectasasunasobvariaslestacionesldentrabajo?n?n
[04:19] Avestruz_ConPrisa 1 Pista: ********* Valor pregunta : 17876 Puntos [04:19] Avestruz_ConPrisa
1 Pista: ********* Valor pregunta : 17876 Puntos
[04:20] Avestruz_ConPrisa 2 Pista: mai****** 30 segundos y 17876 Puntos [04:20] Avestruz_ConPrisa
2 Pista: mai****** 30 segundos y 17876 Puntos
[04:20] Avestruz_ConPrisa 3 Pista: mai***a*e 15 segundos y 17876 Puntos [04:20] Avestruz_ConPrisa
3 Pista: mai***a*e 15 segundos y 17876 Puntos
[04:20] Avestruz_ConPrisa Tiempo! La respuesta es -> mainframe <- [04:20] Avestruz_ConPrisa
Tiempo! La respuesta es -> mainframe <-
[04:20] Cabra{Torpe yooo quiero [04:20] Cabra{Torpe
yooo quiero
[04:20] Cabra{Torpe pulguitasss [04:20] Cabra{Torpe
pulguitasss
[04:20] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [04:20] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[04:20] Avestruz_ConPrisa Tri.15973 MiscelaneaɁrtea˿ComonterminanlanfrasepdepErichwMarianRemarque:bElccaracterudepunanpersonansolonsepdescubrepcuandonsepconviertepenm?b [04:20] Avestruz_ConPrisa
Tri.15973 MiscelaneaɁrtea˿ComonterminanlanfrasepdepErichwMarianRemarque:bElccaracterudepunanpersonansolonsepdescubrepcuandonsepconviertepenm?b
[04:20] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 9086 Puntos [04:20] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 9086 Puntos
[04:20] Avestruz_ConPrisa 2 Pista: pat*** 30 segundos y 9086 Puntos [04:20] Avestruz_ConPrisa
2 Pista: pat*** 30 segundos y 9086 Puntos
[04:21] Avestruz_ConPrisa 3 Pista: pat*o* 15 segundos y 9086 Puntos [04:21] Avestruz_ConPrisa
3 Pista: pat*o* 15 segundos y 9086 Puntos
[04:21] Avestruz_ConPrisa Tiempo! La respuesta es -> patron <- [04:21] Avestruz_ConPrisa
Tiempo! La respuesta es -> patron <-
[04:21] Avestruz_ConPrisa R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898 [04:21] Avestruz_ConPrisa
R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898
[04:21] Avestruz_ConPrisa Tri.7084 MitologiaɈdosO˿DIOSAkROMANAkDEkLOSkBOSQUESkYkDEkLAkCAZAk?k [04:21] Avestruz_ConPrisa
Tri.7084 MitologiaɈdosO˿DIOSAkROMANAkDEkLOSkBOSQUESkYkDEkLAkCAZAk?k
[04:21] Avestruz_ConPrisa 1 Pista: ***** Valor pregunta : 8610 Puntos [04:21] Avestruz_ConPrisa
1 Pista: ***** Valor pregunta : 8610 Puntos
[04:21] Avestruz_ConPrisa 2 Pista: dia** 30 segundos y 8610 Puntos [04:21] Avestruz_ConPrisa
2 Pista: dia** 30 segundos y 8610 Puntos
[04:22] Avestruz_ConPrisa 3 Pista: dia*a 15 segundos y 8610 Puntos [04:22] Avestruz_ConPrisa
3 Pista: dia*a 15 segundos y 8610 Puntos
[04:22] Avestruz_ConPrisa Tiempo! La respuesta es -> diana <- [04:22] Avestruz_ConPrisa
Tiempo! La respuesta es -> diana <-
[04:22] Avestruz_ConPrisa If you think a Q&A is wrong, please call an OP [04:22] Avestruz_ConPrisa
If you think a Q&A is wrong, please call an OP
[04:22] Avestruz_ConPrisa Tri.9076 Cineɓebosin˿Cuᬃ01yeselabnacionalidadedelydirectorqdev"Deepybluevsea",fRennyqHarlinb?f [04:22] Avestruz_ConPrisa
Tri.9076 Cineɓebosin˿Cuᬃ01yeselabnacionalidadedelydirectorqdev"Deepybluevsea",fRennyqHarlinb?f
[04:22] Avestruz_ConPrisa 1 Pista: ********** Valor pregunta : 16022 Puntos [04:22] Avestruz_ConPrisa
1 Pista: ********** Valor pregunta : 16022 Puntos
[04:22] Avestruz_ConPrisa 2 Pista: fin******* 30 segundos y 16022 Puntos [04:22] Avestruz_ConPrisa
2 Pista: fin******* 30 segundos y 16022 Puntos
[04:22] Libelula-ConPrisa ⭐ Caracol_ConBravura le da un like a Cocodrilo{Suave! Total likes: 3 [04:22] Libelula-ConPrisa
⭐ Caracol_ConBravura le da un like a Cocodrilo{Suave! Total likes: 3
[04:22] Caracol_ConBravura !like [04:22] Caracol_ConBravura
!like
[04:23] Avestruz_ConPrisa 3 Pista: fin*a**e*a 15 segundos y 16022 Puntos [04:23] Avestruz_ConPrisa
3 Pista: fin*a**e*a 15 segundos y 16022 Puntos
[04:23] Avestruz_ConPrisa Tiempo! La respuesta es -> finlandesa <- [04:23] Avestruz_ConPrisa
Tiempo! La respuesta es -> finlandesa <-
[04:23] Avestruz_ConPrisa R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226 [04:23] Avestruz_ConPrisa
R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226
[04:23] Avestruz_ConPrisa Tri.11389 Fisica-Quimicaɑuique˿Descubridorddelzfen󭥮oxdenlay󳭯sis;hus󃰱hlayprimeraymembranaysemipermeablenhechaydenlayvejigaydenunkcerdo...h?h [04:23] Avestruz_ConPrisa
Tri.11389 Fisica-Quimicaɑuique˿Descubridorddelzfen󭥮oxdenlay󳭯sis;hus󃰱hlayprimeraymembranaysemipermeablenhechaydenlayvejigaydenunkcerdo...h?h
[04:23] Avestruz_ConPrisa 1 Pista: **** ******* ****** Valor pregunta : 18712 Puntos [04:23] Avestruz_ConPrisa
1 Pista: **** ******* ****** Valor pregunta : 18712 Puntos
[04:23] Avestruz_ConPrisa 2 Pista: jea* ******* ****** 30 segundos y 18712 Puntos [04:23] Avestruz_ConPrisa
2 Pista: jea* ******* ****** 30 segundos y 18712 Puntos
[04:24] Avestruz_ConPrisa 3 Pista: jea* a**oi*e *o**e* 15 segundos y 18712 Puntos [04:24] Avestruz_ConPrisa
3 Pista: jea* a**oi*e *o**e* 15 segundos y 18712 Puntos
[04:24] Avestruz_ConPrisa Tiempo! La respuesta es -> jean�ntoine�ollet <- [04:24] Avestruz_ConPrisa
Tiempo! La respuesta es -> jean�ntoine�ollet <-
[04:24] Avestruz_ConPrisa For The Competitive Edge type !pingme [04:24] Avestruz_ConPrisa
For The Competitive Edge type !pingme
[04:24] Avestruz_ConPrisa Tri.10891 Medicina-SaludɍARdeJAVA˃OMPLETAwLOSwGRUPOSwDEwDIENTESwQUEwPOSEEMOSwLOSwSERESwHUMANOS:wCANINOS,wMOLARES,wPREMOLARESwE...w?w [04:24] Avestruz_ConPrisa
Tri.10891 Medicina-SaludɍARdeJAVA˃OMPLETAwLOSwGRUPOSwDEwDIENTESwQUEwPOSEEMOSwLOSwSERESwHUMANOS:wCANINOS,wMOLARES,wPREMOLARESwE...w?w
[04:24] Avestruz_ConPrisa 1 Pista: ********* Valor pregunta : 5925 Puntos [04:24] Avestruz_ConPrisa
1 Pista: ********* Valor pregunta : 5925 Puntos
[04:24] Avestruz_ConPrisa 2 Pista: inc****** 30 segundos y 5925 Puntos [04:24] Avestruz_ConPrisa
2 Pista: inc****** 30 segundos y 5925 Puntos
[04:24] Gallina\Elocuente incisivos [04:24] Gallina\Elocuente
incisivos
[04:24] Avestruz_ConPrisa �Bingo!! Gallina\Elocuente dio la respuesta: "incisivos" en �6.875 segundos e incrementa sus ganancias con �925�12 puntos [04:24] Avestruz_ConPrisa
�Bingo!! Gallina\Elocuente dio la respuesta: "incisivos" en �6.875 segundos e incrementa sus ganancias con �925�12 puntos
[04:24] Avestruz_ConPrisa Gallina\Elocuente has acertado 1 seguidas!! Puntos HOY: 119235, SEMANA: 6951162 y MES: 6951162 [04:24] Avestruz_ConPrisa
Gallina\Elocuente has acertado 1 seguidas!! Puntos HOY: 119235, SEMANA: 6951162 y MES: 6951162
[04:25] Avestruz_ConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [04:25] Avestruz_ConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[04:25] Avestruz_ConPrisa Tri.16138 Musicaɰailas˿Deoqu郰1etipoddeoinstrumentodesfeltbongod?e [04:25] Avestruz_ConPrisa
Tri.16138 Musicaɰailas˿Deoqu郰1etipoddeoinstrumentodesfeltbongod?e
[04:25] Avestruz_ConPrisa 1 Pista: ********* Valor pregunta : 11372 Puntos [04:25] Avestruz_ConPrisa
1 Pista: ********* Valor pregunta : 11372 Puntos
[04:25] Avestruz_ConPrisa 2 Pista: per****** 30 segundos y 11372 Puntos [04:25] Avestruz_ConPrisa
2 Pista: per****** 30 segundos y 11372 Puntos
[04:25] Avestruz_ConPrisa 3 Pista: per*u*io* 15 segundos y 11372 Puntos [04:25] Avestruz_ConPrisa
3 Pista: per*u*io* 15 segundos y 11372 Puntos
[04:25] Avestruz_ConPrisa �Est᳠que lo tiras Gallina\Elocuente!! ߃󭯠supiste que "percusion" era la respuesta? Venga, �1372�12 puntos suben a tu marcador [04:25] Avestruz_ConPrisa
�Est᳠que lo tiras Gallina\Elocuente!! ߃󭯠supiste que "percusion" era la respuesta? Venga, �1372�12 puntos suben a tu marcador
[04:25] Avestruz_ConPrisa Gallina\Elocuente has acertado 2 seguidas!! Puntos HOY: 130607, SEMANA: 6962534 y MES: 6962534 [04:25] Avestruz_ConPrisa
Gallina\Elocuente has acertado 2 seguidas!! Puntos HOY: 130607, SEMANA: 6962534 y MES: 6962534
[04:25] Gallina\Elocuente percusion [04:25] Gallina\Elocuente
percusion
[04:25] Avestruz_ConPrisa R᮫ing MES: - #1: Gallina\Elocuente 6951162 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 531253 #5: Caracol_ConBravura 499726 #6: Alii 491671 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [04:25] Avestruz_ConPrisa
R᮫ing MES: - #1: Gallina\Elocuente 6951162 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 531253 #5: Caracol_ConBravura 499726 #6: Alii 491671 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[04:25] Avestruz_ConPrisa Tri.12416 CancionesɓESINO˿Completar:uSiniestroxTotal-->"Yaqnoxhayytrilobitesxentelnmar,uentSiberiaqnoxquedaqniuuntmamut,...."u?u [04:25] Avestruz_ConPrisa
Tri.12416 CancionesɓESINO˿Completar:uSiniestroxTotal-->"Yaqnoxhayytrilobitesxentelnmar,uentSiberiaqnoxquedaqniuuntmamut,...."u?u
[04:25] Avestruz_ConPrisa 1 Pista: *** ******** ************* Valor pregunta : 18641 Puntos [04:25] Avestruz_ConPrisa
1 Pista: *** ******** ************* Valor pregunta : 18641 Puntos
[04:26] Avestruz_ConPrisa 2 Pista: las ******** ************* 30 segundos y 18641 Puntos [04:26] Avestruz_ConPrisa
2 Pista: las ******** ************* 30 segundos y 18641 Puntos
[04:26] Avestruz_ConPrisa 3 Pista: las *a**e*a* *e*a*a*e*e*a* 15 segundos y 18641 Puntos [04:26] Avestruz_ConPrisa
3 Pista: las *a**e*a* *e*a*a*e*e*a* 15 segundos y 18641 Puntos
[04:26] Avestruz_ConPrisa Tiempo! La respuesta es -> las�allenas�esapareceran <- [04:26] Avestruz_ConPrisa
Tiempo! La respuesta es -> las�allenas�esapareceran <-
[04:26] Avestruz_ConPrisa Please refrain from using Extreme Bad Language [04:26] Avestruz_ConPrisa
Please refrain from using Extreme Bad Language
[04:26] Avestruz_ConPrisa Tri.6348 Cienciaɖivian˿C󭯃01ksewllamamlambocamdewunevolcᮿs?s [04:26] Avestruz_ConPrisa
Tri.6348 Cienciaɖivian˿C󭯃01ksewllamamlambocamdewunevolcᮿs?s
[04:26] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 13012 Puntos [04:26] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 13012 Puntos
[04:26] Avestruz_ConPrisa 2 Pista: cra*** 30 segundos y 13012 Puntos [04:26] Avestruz_ConPrisa
2 Pista: cra*** 30 segundos y 13012 Puntos
[04:27] Avestruz_ConPrisa �emuestra lo que sabes Ketzy! Has respondido "crater" correctamente y eso te da: �3012�12 puntos [04:27] Avestruz_ConPrisa
�emuestra lo que sabes Ketzy! Has respondido "crater" correctamente y eso te da: �3012�12 puntos
[04:27] Avestruz_ConPrisa ACTION awards Ketzy with a +v for having over 15000 points [04:27] Avestruz_ConPrisa
ACTION awards Ketzy with a +v for having over 15000 points
[04:27] Avestruz_ConPrisa Ketzy has acertado 1 seguidas!! Puntos HOY: 13012, SEMANA: 544265 y MES: 544265 [04:27] Avestruz_ConPrisa
Ketzy has acertado 1 seguidas!! Puntos HOY: 13012, SEMANA: 544265 y MES: 544265
[04:27] Avestruz_ConPrisa This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa [04:27] Avestruz_ConPrisa
This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa
[04:27] Avestruz_ConPrisa Tri.15522 LiteraturaɔeLaRaNhA˿Autorydea"landeshumanizacionfdelceste"z?z [04:27] Avestruz_ConPrisa
Tri.15522 LiteraturaɔeLaRaNhA˿Autorydea"landeshumanizacionfdelceste"z?z
[04:27] Avestruz_ConPrisa 1 Pista: ****** * ****** Valor pregunta : 14504 Puntos [04:27] Avestruz_ConPrisa
1 Pista: ****** * ****** Valor pregunta : 14504 Puntos
[04:27] Avestruz_ConPrisa 2 Pista: ort*** * ****** 30 segundos y 14504 Puntos [04:27] Avestruz_ConPrisa
2 Pista: ort*** * ****** 30 segundos y 14504 Puntos
[04:27] Avestruz_ConPrisa 3 Pista: orte*a * *a**e* 15 segundos y 14504 Puntos [04:27] Avestruz_ConPrisa
3 Pista: orte*a * *a**e* 15 segundos y 14504 Puntos
[04:27] Libelula-ConPrisa DJ "Cocodrilo{Suave" cierra peticiones [04:27] Libelula-ConPrisa
DJ "Cocodrilo{Suave" cierra peticiones
[04:27] Avestruz_ConPrisa Tiempo! La respuesta es -> ortega��asset <- [04:27] Avestruz_ConPrisa
Tiempo! La respuesta es -> ortega��asset <-
[04:28] Cabra{Torpe jajajaj siempre sacas los buenos nicks [04:28] Cabra{Torpe
jajajaj siempre sacas los buenos nicks
[04:28] Avestruz_ConPrisa This WEEKS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0 [04:28] Avestruz_ConPrisa
This WEEKS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0
[04:28] Avestruz_ConPrisa Tri.11981 Eros-Sexɖonda˿Endqu郰1p�nicaupel�laudebsuycarrera,pdirigidauporrPedrobAlmodovar,papareci󃰱pdesnudaucompletamenteblauactrizpVer󮩣auForqu郰1p?p [04:28] Avestruz_ConPrisa
Tri.11981 Eros-Sexɖonda˿Endqu郰1p�nicaupel�laudebsuycarrera,pdirigidauporrPedrobAlmodovar,papareci󃰱pdesnudaucompletamenteblauactrizpVer󮩣auForqu郰1p?p
[04:28] Avestruz_ConPrisa 1 Pista: **** Valor pregunta : 24109 Puntos [04:28] Avestruz_ConPrisa
1 Pista: **** Valor pregunta : 24109 Puntos
[04:28] Avestruz_ConPrisa 2 Pista: kik* 30 segundos y 24109 Puntos [04:28] Avestruz_ConPrisa
2 Pista: kik* 30 segundos y 24109 Puntos
[04:28] Avestruz_ConPrisa 3 Pista: kika 15 segundos y 24109 Puntos [04:28] Avestruz_ConPrisa
3 Pista: kika 15 segundos y 24109 Puntos
[04:28] Caracol_ConBravura Kika [04:28] Caracol_ConBravura
Kika
[04:28] Avestruz_ConPrisa �Suma y sigue Caracol_ConBravura!! La respuesta: "Kika" incrementa tu marcador en �4109�12 puntos [04:28] Avestruz_ConPrisa
�Suma y sigue Caracol_ConBravura!! La respuesta: "Kika" incrementa tu marcador en �4109�12 puntos
[04:28] Avestruz_ConPrisa Caracol_ConBravura has acertado 1 seguidas!! Puntos HOY: 95505, SEMANA: 523835 y MES: 523835 [04:28] Avestruz_ConPrisa
Caracol_ConBravura has acertado 1 seguidas!! Puntos HOY: 95505, SEMANA: 523835 y MES: 523835
[04:28] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [04:28] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[04:28] Avestruz_ConPrisa Tri.3388 Personajesɖivi˿Enkqu郰1cdestac󃰱cWilliampCranchdBond?c?c [04:28] Avestruz_ConPrisa
Tri.3388 Personajesɖivi˿Enkqu郰1cdestac󃰱cWilliampCranchdBond?c?c
[04:28] Avestruz_ConPrisa 1 Pista: ********** Valor pregunta : 11069 Puntos [04:28] Avestruz_ConPrisa
1 Pista: ********** Valor pregunta : 11069 Puntos
[04:29] Avestruz_ConPrisa 2 Pista: ast******* 30 segundos y 11069 Puntos [04:29] Avestruz_ConPrisa
2 Pista: ast******* 30 segundos y 11069 Puntos
[04:29] Avestruz_ConPrisa 3 Pista: ast*o*o*ia 15 segundos y 11069 Puntos [04:29] Avestruz_ConPrisa
3 Pista: ast*o*o*ia 15 segundos y 11069 Puntos
[04:29] Gallina\Elocuente astrologia [04:29] Gallina\Elocuente
astrologia
[04:29] Avestruz_ConPrisa Tiempo! La respuesta es -> astronomia <- [04:29] Avestruz_ConPrisa
Tiempo! La respuesta es -> astronomia <-
[04:29] Avestruz_ConPrisa This MONTHS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0 [04:29] Avestruz_ConPrisa
This MONTHS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: Botones 58004 #13: gonsi 38799 #14: LeCaTwaLk_z 23250 #15: solterita 22277 #16: Calvito_Klein 20510 #17: QuieroChat-0 13173 #18: Cosmo 7017 #19: * 0 #20: * 0
[04:29] Avestruz_ConPrisa Tri.2817 Cineɴarra˄irectorjfrancesydeupeliculasycomoc"Envlaibocaino"(Cannes,1991),h"Losyjuncosysalvajes"(1994),"AliceuypMartin"(1998)?h?h [04:29] Avestruz_ConPrisa
Tri.2817 Cineɴarra˄irectorjfrancesydeupeliculasycomoc"Envlaibocaino"(Cannes,1991),h"Losyjuncosysalvajes"(1994),"AliceuypMartin"(1998)?h?h
[04:29] Avestruz_ConPrisa 1 Pista: ***** ******* Valor pregunta : 10235 Puntos [04:29] Avestruz_ConPrisa
1 Pista: ***** ******* Valor pregunta : 10235 Puntos
[04:30] Avestruz_ConPrisa 2 Pista: and** ******* 30 segundos y 10235 Puntos [04:30] Avestruz_ConPrisa
2 Pista: and** ******* 30 segundos y 10235 Puntos
[04:30] Avestruz_ConPrisa 3 Pista: and*e *e**i*e 15 segundos y 10235 Puntos [04:30] Avestruz_ConPrisa
3 Pista: and*e *e**i*e 15 segundos y 10235 Puntos
[04:30] Avestruz_ConPrisa Tiempo! La respuesta es -> andre�echine <- [04:30] Avestruz_ConPrisa
Tiempo! La respuesta es -> andre�echine <-
[04:30] Avestruz_ConPrisa R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516 [04:30] Avestruz_ConPrisa
R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516
[04:30] Avestruz_ConPrisa Tri.12725 Medicina-Saludɒolo˿Comofsevllamarelrtumorudevlosfvasosflinfaticosf?g [04:30] Avestruz_ConPrisa
Tri.12725 Medicina-Saludɒolo˿Comofsevllamarelrtumorudevlosfvasosflinfaticosf?g
[04:30] Avestruz_ConPrisa 1 Pista: *********** Valor pregunta : 17899 Puntos [04:30] Avestruz_ConPrisa
1 Pista: *********** Valor pregunta : 17899 Puntos
[04:30] Avestruz_ConPrisa 2 Pista: lin******** 30 segundos y 17899 Puntos [04:30] Avestruz_ConPrisa
2 Pista: lin******** 30 segundos y 17899 Puntos
[04:31] Avestruz_ConPrisa 3 Pista: lin*a**io*a 15 segundos y 17899 Puntos [04:31] Avestruz_ConPrisa
3 Pista: lin*a**io*a 15 segundos y 17899 Puntos
[04:31] Avestruz_ConPrisa Tiempo! La respuesta es -> linfangioma <- [04:31] Avestruz_ConPrisa
Tiempo! La respuesta es -> linfangioma <-
[04:31] Libelula-ConPrisa Bienvenido Caracol_ConBravura FOUNDER de Radio Luna de Miel. [04:31] Libelula-ConPrisa
Bienvenido Caracol_ConBravura FOUNDER de Radio Luna de Miel.
[04:31] Avestruz_ConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [04:31] Avestruz_ConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[04:31] Avestruz_ConPrisa Tri.12680 PersonajesɍARdeJAVA˿CU�tEStELtSIGNOtDELtZODIACOtDEtLOStSIGUIENTEStPERSONAJEStCɌEBRES:tLUCIANOtPAVAROTTI,tMARGARETtTHATCHER,tPEDROtALMODӖARtYtMICHAELtDOUGLAS?t?t [04:31] Avestruz_ConPrisa
Tri.12680 PersonajesɍARdeJAVA˿CU�tEStELtSIGNOtDELtZODIACOtDEtLOStSIGUIENTEStPERSONAJEStCɌEBRES:tLUCIANOtPAVAROTTI,tMARGARETtTHATCHER,tPEDROtALMODӖARtYtMICHAELtDOUGLAS?t?t
[04:31] Avestruz_ConPrisa 1 Pista: ***** Valor pregunta : 16263 Puntos [04:31] Avestruz_ConPrisa
1 Pista: ***** Valor pregunta : 16263 Puntos
[04:31] Avestruz_ConPrisa 2 Pista: lib** 30 segundos y 16263 Puntos [04:31] Avestruz_ConPrisa
2 Pista: lib** 30 segundos y 16263 Puntos
[04:32] Avestruz_ConPrisa 3 Pista: lib*a 15 segundos y 16263 Puntos [04:32] Avestruz_ConPrisa
3 Pista: lib*a 15 segundos y 16263 Puntos
[04:32] EstrellaDeMar\Agil Libra [04:32] EstrellaDeMar\Agil
Libra
[04:32] Avestruz_ConPrisa �EstrellaDeMar\Agil acert󡡠La respuesta era: "Libra" y contest󠥮 �4.797 segundos. Se lleva: �6263�12 puntos [04:32] Avestruz_ConPrisa
�EstrellaDeMar\Agil acert󡡠La respuesta era: "Libra" y contest󠥮 �4.797 segundos. Se lleva: �6263�12 puntos
[04:32] Avestruz_ConPrisa EstrellaDeMar\Agil has acertado 1 seguidas!! Puntos HOY: 16263, SEMANA: 16263 y MES: 16263 [04:32] Avestruz_ConPrisa
EstrellaDeMar\Agil has acertado 1 seguidas!! Puntos HOY: 16263, SEMANA: 16263 y MES: 16263
[04:32] Avestruz_ConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [04:32] Avestruz_ConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[04:32] Avestruz_ConPrisa Tri.11661 DeporteɁcuarios˿(FUTBOL)NOMBREzYzAPELLIDOSzDEzCAMINEROz?z [04:32] Avestruz_ConPrisa
Tri.11661 DeporteɁcuarios˿(FUTBOL)NOMBREzYzAPELLIDOSzDEzCAMINEROz?z
[04:32] Avestruz_ConPrisa 1 Pista: **** **** ***** ******** Valor pregunta : 11607 Puntos [04:32] Avestruz_ConPrisa
1 Pista: **** **** ***** ******** Valor pregunta : 11607 Puntos
[04:32] Libelula-ConPrisa Bienvenido Cocodrilo{Suave DJ de Radio Luna de Miel. [04:32] Libelula-ConPrisa
Bienvenido Cocodrilo{Suave DJ de Radio Luna de Miel.
[04:32] Avestruz_ConPrisa 2 Pista: jos* **** ***** ******** 30 segundos y 11607 Puntos [04:32] Avestruz_ConPrisa
2 Pista: jos* **** ***** ******** 30 segundos y 11607 Puntos
[04:32] Avestruz_ConPrisa 3 Pista: jose *ui* *e*e* *a*i*e*o 15 segundos y 11607 Puntos [04:32] Avestruz_ConPrisa
3 Pista: jose *ui* *e*e* *a*i*e*o 15 segundos y 11607 Puntos
[04:33] Avestruz_ConPrisa Tiempo! La respuesta es -> jose�uis�erez�aminero <- [04:33] Avestruz_ConPrisa
Tiempo! La respuesta es -> jose�uis�erez�aminero <-
[04:33] Avestruz_ConPrisa R᮫ing SEMANA: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 544265 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [04:33] Avestruz_ConPrisa
R᮫ing SEMANA: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 544265 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[04:33] Avestruz_ConPrisa Tri.17551 Miscelaneaɴamzarian˿Clavovparamunirvplanchasrmetᬩcasrcuyovextremovsecremachamenjcalientecparamformarvunamsegundamcabezam?n [04:33] Avestruz_ConPrisa
Tri.17551 Miscelaneaɴamzarian˿Clavovparamunirvplanchasrmetᬩcasrcuyovextremovsecremachamenjcalientecparamformarvunamsegundamcabezam?n
[04:33] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 20197 Puntos [04:33] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 20197 Puntos
[04:33] Avestruz_ConPrisa 2 Pista: rob*** 30 segundos y 20197 Puntos [04:33] Avestruz_ConPrisa
2 Pista: rob*** 30 segundos y 20197 Puntos
[04:33] Avestruz_ConPrisa 3 Pista: rob*o* 15 segundos y 20197 Puntos [04:33] Avestruz_ConPrisa
3 Pista: rob*o* 15 segundos y 20197 Puntos
[04:34] Avestruz_ConPrisa Tiempo! La respuesta es -> roblon <- [04:34] Avestruz_ConPrisa
Tiempo! La respuesta es -> roblon <-
[04:34] Avestruz_ConPrisa We feature over 50,000 Q&A ! [04:34] Avestruz_ConPrisa
We feature over 50,000 Q&A !
[04:34] Avestruz_ConPrisa Tri.13177 Literaturaɩda˿Deqqueqlibrodestaoextraidodellpasajeq"Laovidaoescunycuentodcontadodporwunyidiota"?n?n [04:34] Avestruz_ConPrisa
Tri.13177 Literaturaɩda˿Deqqueqlibrodestaoextraidodellpasajeq"Laovidaoescunycuentodcontadodporwunyidiota"?n?n
[04:34] Avestruz_ConPrisa 1 Pista: ******* Valor pregunta : 10892 Puntos [04:34] Avestruz_ConPrisa
1 Pista: ******* Valor pregunta : 10892 Puntos
[04:34] Avestruz_ConPrisa 2 Pista: mac**** 30 segundos y 10892 Puntos [04:34] Avestruz_ConPrisa
2 Pista: mac**** 30 segundos y 10892 Puntos
[04:34] Avestruz_ConPrisa 3 Pista: mac*e** 15 segundos y 10892 Puntos [04:34] Avestruz_ConPrisa
3 Pista: mac*e** 15 segundos y 10892 Puntos
[04:34] Avestruz_ConPrisa Tiempo! La respuesta es -> macbeth <- [04:34] Avestruz_ConPrisa
Tiempo! La respuesta es -> macbeth <-
[04:35] Avestruz_ConPrisa Tri.4678 Medicina-Saludɍonteso˿Akdondeuvatlatarteriatcarotidat?k [04:35] Avestruz_ConPrisa
Tri.4678 Medicina-Saludɍonteso˿Akdondeuvatlatarteriatcarotidat?k
[04:35] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 24935 Puntos [04:35] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 24935 Puntos
[04:35] Avestruz_ConPrisa 2 Pista: cab*** 30 segundos y 24935 Puntos [04:35] Avestruz_ConPrisa
2 Pista: cab*** 30 segundos y 24935 Puntos
[04:35] Avestruz_ConPrisa 3 Pista: cabe*a 15 segundos y 24935 Puntos [04:35] Avestruz_ConPrisa
3 Pista: cabe*a 15 segundos y 24935 Puntos
[04:35] Avestruz_ConPrisa Tiempo! La respuesta es -> cabeza <- [04:35] Avestruz_ConPrisa
Tiempo! La respuesta es -> cabeza <-
[04:36] Avestruz_ConPrisa Tri.16018 GastronomiaɃHESARE˿EspecialjNavidad:vPavo,vaceite,vcognac,vvino,vsal,vpimienta,vcebolla,vajos,vpan,vchorizovcantimpalo,vjam󮃰1rserrano,vaceitunas,vhuevovdurovyeJerez,vcomemos...v?v [04:36] Avestruz_ConPrisa
Tri.16018 GastronomiaɃHESARE˿EspecialjNavidad:vPavo,vaceite,vcognac,vvino,vsal,vpimienta,vcebolla,vajos,vpan,vchorizovcantimpalo,vjam󮃰1rserrano,vaceitunas,vhuevovdurovyeJerez,vcomemos...v?v
[04:36] Avestruz_ConPrisa 1 Pista: **** ******* Valor pregunta : 5797 Puntos [04:36] Avestruz_ConPrisa
1 Pista: **** ******* Valor pregunta : 5797 Puntos
[04:36] Libelula-ConPrisa ♪ Sonando: Galvan Real - Volvernos A Encontrar [04:36] Libelula-ConPrisa
♪ Sonando: Galvan Real - Volvernos A Encontrar
[04:36] EstrellaDeMar\Agil !tema [04:36] EstrellaDeMar\Agil
!tema
[04:36] Avestruz_ConPrisa 2 Pista: pav* ******* 30 segundos y 5797 Puntos [04:36] Avestruz_ConPrisa
2 Pista: pav* ******* 30 segundos y 5797 Puntos
[04:36] Avestruz_ConPrisa 3 Pista: pavo *e**e*o 15 segundos y 5797 Puntos [04:36] Avestruz_ConPrisa
3 Pista: pavo *e**e*o 15 segundos y 5797 Puntos
[04:36] Cabra_Pedante cual es el link de la radio? o la sala jsjs [04:36] Cabra_Pedante
cual es el link de la radio? o la sala jsjs
[04:36] Avestruz_ConPrisa Tiempo! La respuesta es -> pavo�elleno <- [04:36] Avestruz_ConPrisa
Tiempo! La respuesta es -> pavo�elleno <-
[04:37] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [04:37] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[04:37] Avestruz_ConPrisa Tri.5320 CienciaɐEDROC˿DIFICIL,pTIPOpDEpESTRELLApVARIABLEpGIGANTEpPULSANTEp(pCOMOpLApESTRELLApDELTApDEpCEFEOp)p?p [04:37] Avestruz_ConPrisa
Tri.5320 CienciaɐEDROC˿DIFICIL,pTIPOpDEpESTRELLApVARIABLEpGIGANTEpPULSANTEp(pCOMOpLApESTRELLApDELTApDEpCEFEOp)p?p
[04:37] Avestruz_ConPrisa 1 Pista: ******* Valor pregunta : 7263 Puntos [04:37] Avestruz_ConPrisa
1 Pista: ******* Valor pregunta : 7263 Puntos
[04:37] Avestruz_ConPrisa 2 Pista: cef**** 30 segundos y 7263 Puntos [04:37] Avestruz_ConPrisa
2 Pista: cef**** 30 segundos y 7263 Puntos
[04:37] Cabra{Torpe no hay radio [04:37] Cabra{Torpe
no hay radio
[04:37] Avestruz_ConPrisa 3 Pista: cefei*a 15 segundos y 7263 Puntos [04:37] Avestruz_ConPrisa
3 Pista: cefei*a 15 segundos y 7263 Puntos
[04:37] Cabra{Torpe murio [04:37] Cabra{Torpe
murio
[04:37] Cabra{Torpe hace 10 años [04:37] Cabra{Torpe
hace 10 años
[04:37] EstrellaDeMar\Agil Jajajaaj [04:37] EstrellaDeMar\Agil
Jajajaaj
[04:37] Avestruz_ConPrisa Tiempo! La respuesta es -> cefeida <- [04:37] Avestruz_ConPrisa
Tiempo! La respuesta es -> cefeida <-
[04:37] Avestruz_ConPrisa R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898 [04:37] Avestruz_ConPrisa
R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898
[04:37] Avestruz_ConPrisa Tri.1812 Idiomasɉcia˿Italiano-Espa񯬃01yprodeg?r [04:37] Avestruz_ConPrisa
Tri.1812 Idiomasɉcia˿Italiano-Espa񯬃01yprodeg?r
[04:37] Avestruz_ConPrisa 1 Pista: ******** Pregunta de BONUS : 100000 Puntos [04:37] Avestruz_ConPrisa
1 Pista: ******** Pregunta de BONUS : 100000 Puntos
[04:37] EstrellaDeMar\Agil !like [04:37] EstrellaDeMar\Agil
!like
[04:37] Libelula-ConPrisa ⏱ EstrellaDeMar\Agil, espera 28 min antes de dar otro like. [04:37] Libelula-ConPrisa
⏱ EstrellaDeMar\Agil, espera 28 min antes de dar otro like.
[04:38] Cabra{Torpe aqui quedamos puros pandilleros [04:38] Cabra{Torpe
aqui quedamos puros pandilleros
[04:38] Avestruz_ConPrisa 2 Pista: Val***** 30 segundos y 100000 Puntos [04:38] Avestruz_ConPrisa
2 Pista: Val***** 30 segundos y 100000 Puntos
[04:38] Avestruz_ConPrisa 3 Pista: Valie**e 15 segundos y 100000 Puntos [04:38] Avestruz_ConPrisa
3 Pista: Valie**e 15 segundos y 100000 Puntos
[04:38] Cabra{Torpe que negociamos con cosas ilegales [04:38] Cabra{Torpe
que negociamos con cosas ilegales
[04:38] Avestruz_ConPrisa Tiempo! La respuesta es -> Valiente <- [04:38] Avestruz_ConPrisa
Tiempo! La respuesta es -> Valiente <-
[04:38] EstrellaDeMar\Agil Cabra_Pedante este es el link https://chathispano.link/bunQ/4r4RVA5ZwmgfCP3ZA [04:38] EstrellaDeMar\Agil
Cabra_Pedante este es el link https://chathispano.link/bunQ/4r4RVA5ZwmgfCP3ZA
[04:38] Cabra{Torpe es virus [04:38] Cabra{Torpe
es virus
[04:38] Cabra{Torpe eh [04:38] Cabra{Torpe
eh
[04:38] Avestruz_ConPrisa If you think a Q&A is wrong, please call an OP [04:38] Avestruz_ConPrisa
If you think a Q&A is wrong, please call an OP
[04:38] Avestruz_ConPrisa Tri.10818 LiteraturaɔeLaRaNhA˿Autorfdei"elgfulgorfyflansangre"q?q [04:38] Avestruz_ConPrisa
Tri.10818 LiteraturaɔeLaRaNhA˿Autorfdei"elgfulgorfyflansangre"q?q
[04:38] Avestruz_ConPrisa 1 Pista: ******* ******* Valor pregunta : 18856 Puntos [04:38] Avestruz_ConPrisa
1 Pista: ******* ******* Valor pregunta : 18856 Puntos
[04:38] EstrellaDeMar\Agil Que [04:38] EstrellaDeMar\Agil
Que
[04:39] Cabra{Torpe que eres un virus :) [04:39] Cabra{Torpe
que eres un virus :)
[04:39] Cabra{Torpe x [04:39] Cabra{Torpe
x
[04:39] Avestruz_ConPrisa 2 Pista: ign**** ******* 30 segundos y 18856 Puntos [04:39] Avestruz_ConPrisa
2 Pista: ign**** ******* 30 segundos y 18856 Puntos
[04:39] Cabra{Torpe jajajaja [04:39] Cabra{Torpe
jajajaja
[04:39] Cabra_Pedante gracias sirenita [04:39] Cabra_Pedante
gracias sirenita
[04:39] EstrellaDeMar\Agil Ya no es chiste ^^ [04:39] EstrellaDeMar\Agil
Ya no es chiste ^^
[04:39] Avestruz_ConPrisa 3 Pista: igna*io a**e*oa 15 segundos y 18856 Puntos [04:39] Avestruz_ConPrisa
3 Pista: igna*io a**e*oa 15 segundos y 18856 Puntos
[04:39] EstrellaDeMar\Agil Cabra_Pedante chevere [04:39] EstrellaDeMar\Agil
Cabra_Pedante chevere
[04:39] Cabra{Torpe grrrrrrrrrrrrrr [04:39] Cabra{Torpe
grrrrrrrrrrrrrr
[04:39] Cabra{Torpe chistositaaa [04:39] Cabra{Torpe
chistositaaa
[04:39] EstrellaDeMar\Agil Tu [04:39] EstrellaDeMar\Agil
Tu
[04:39] Cabra{Torpe cuando vienes a mexico? [04:39] Cabra{Torpe
cuando vienes a mexico?
[04:39] EstrellaDeMar\Agil Me caes mal lo sepas [04:39] EstrellaDeMar\Agil
Me caes mal lo sepas
[04:39] Avestruz_ConPrisa Tiempo! La respuesta es -> ignacio�ldecoa <- [04:39] Avestruz_ConPrisa
Tiempo! La respuesta es -> ignacio�ldecoa <-
[04:39] Cabra{Torpe no te creooo!! [04:39] Cabra{Torpe
no te creooo!!
[04:39] EstrellaDeMar\Agil De pana [04:39] EstrellaDeMar\Agil
De pana
[04:39] Cabra{Torpe te caigo muy bien ,! admitelo [04:39] Cabra{Torpe
te caigo muy bien ,! admitelo
[04:39] Avestruz_ConPrisa R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226 [04:39] Avestruz_ConPrisa
R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226
[04:39] Avestruz_ConPrisa Tri.2652 CancionesɓESINO˿Completar:zSKA-P-'EltGatotL󰥺'-->"DesdewcachorritotyawbailabawSka,zsusgbotas,zsuwchalecotyosuwformawdewandar,znotestawdomesticado....."z?z [04:39] Avestruz_ConPrisa
Tri.2652 CancionesɓESINO˿Completar:zSKA-P-'EltGatotL󰥺'-->"DesdewcachorritotyawbailabawSka,zsusgbotas,zsuwchalecotyosuwformawdewandar,znotestawdomesticado....."z?z
[04:39] Avestruz_ConPrisa 1 Pista: *** ** ******** Valor pregunta : 20065 Puntos [04:39] Avestruz_ConPrisa
1 Pista: *** ** ******** Valor pregunta : 20065 Puntos
[04:39] Cabra{Torpe grrrrrrrrrrr [04:39] Cabra{Torpe
grrrrrrrrrrr
[04:40] Avestruz_ConPrisa 2 Pista: ama ** ******** 30 segundos y 20065 Puntos [04:40] Avestruz_ConPrisa
2 Pista: ama ** ******** 30 segundos y 20065 Puntos
[04:40] EstrellaDeMar\Agil Pa electrocutarte Cabra{Torpe grrrrrrr [04:40] EstrellaDeMar\Agil
Pa electrocutarte Cabra{Torpe grrrrrrr
[04:40] Cabra{Torpe ya te vale! [04:40] Cabra{Torpe
ya te vale!
[04:40] EstrellaDeMar\Agil Pos si [04:40] EstrellaDeMar\Agil
Pos si
[04:40] Avestruz_ConPrisa 3 Pista: ama *a *i*e**a* 15 segundos y 20065 Puntos [04:40] Avestruz_ConPrisa
3 Pista: ama *a *i*e**a* 15 segundos y 20065 Puntos
[04:40] Cabra{Torpe vente para aca , chama [04:40] Cabra{Torpe
vente para aca , chama
[04:40] EstrellaDeMar\Agil Voy a emitir en la radio que no hay Cabra{Torpe [04:40] EstrellaDeMar\Agil
Voy a emitir en la radio que no hay Cabra{Torpe
[04:40] EstrellaDeMar\Agil Naaa [04:40] EstrellaDeMar\Agil
Naaa
[04:40] Avestruz_ConPrisa Tiempo! La respuesta es -> ama�a�ibertad <- [04:40] Avestruz_ConPrisa
Tiempo! La respuesta es -> ama�a�ibertad <-
[04:40] Cabra{Torpe en la radio fantasmaaa buuuuuU!!! [04:40] Cabra{Torpe
en la radio fantasmaaa buuuuuU!!!
[04:40] Cabra{Torpe no te da miedo_ [04:40] Cabra{Torpe
no te da miedo_
[04:40] Avestruz_ConPrisa For The Competitive Edge type !pingme [04:40] Avestruz_ConPrisa
For The Competitive Edge type !pingme
[04:40] Avestruz_ConPrisa Tri.13919 Informaticaɱuicksand˿CualjeraseljnombrezdezlassegundasgeneracionrdezprocesadoresuCeleronr?b [04:40] Avestruz_ConPrisa
Tri.13919 Informaticaɱuicksand˿CualjeraseljnombrezdezlassegundasgeneracionrdezprocesadoresuCeleronr?b
[04:40] Cabra{Torpe ? [04:40] Cabra{Torpe
?
[04:40] Avestruz_ConPrisa 1 Pista: ********* Valor pregunta : 15305 Puntos [04:40] Avestruz_ConPrisa
1 Pista: ********* Valor pregunta : 15305 Puntos
[04:40] EstrellaDeMar\Agil Sii [04:40] EstrellaDeMar\Agil
Sii
[04:40] Cabra{Torpe cuenta historia de terror [04:40] Cabra{Torpe
cuenta historia de terror
[04:40] EstrellaDeMar\Agil En el manicomio [04:40] EstrellaDeMar\Agil
En el manicomio
[04:40] Cabra{Torpe para que se asuste la fosforita [04:40] Cabra{Torpe
para que se asuste la fosforita
[04:40] EstrellaDeMar\Agil Na tengo una tuya [04:40] EstrellaDeMar\Agil
Na tengo una tuya
[04:40] Cabra_Pedante sii sirenita , para pedirte unas cumbias xd [04:40] Cabra_Pedante
sii sirenita , para pedirte unas cumbias xd
[04:40] Avestruz_ConPrisa 2 Pista: men****** 30 segundos y 15305 Puntos [04:40] Avestruz_ConPrisa
2 Pista: men****** 30 segundos y 15305 Puntos
[04:40] EstrellaDeMar\Agil Te acuerdas [04:40] EstrellaDeMar\Agil
Te acuerdas
[04:41] Cabra{Torpe sii [04:41] Cabra{Torpe
sii
[04:41] EstrellaDeMar\Agil Cabra_Pedante vale [04:41] EstrellaDeMar\Agil
Cabra_Pedante vale
[04:41] Cabra{Torpe aun la tienes_ [04:41] Cabra{Torpe
aun la tienes_
[04:41] Cabra{Torpe ? [04:41] Cabra{Torpe
?
[04:41] Cabra{Torpe ponsela luego [04:41] Cabra{Torpe
ponsela luego
[04:41] Cabra_Pedante valee :p [04:41] Cabra_Pedante
valee :p
[04:41] Avestruz_ConPrisa 3 Pista: men*o*i*o 15 segundos y 15305 Puntos [04:41] Avestruz_ConPrisa
3 Pista: men*o*i*o 15 segundos y 15305 Puntos
[04:41] EstrellaDeMar\Agil Cumbias argentinas o mexicanas? [04:41] EstrellaDeMar\Agil
Cumbias argentinas o mexicanas?
[04:41] Cabra_Pedante sirena, unas cumbias rebajadas xd [04:41] Cabra_Pedante
sirena, unas cumbias rebajadas xd
[04:41] EstrellaDeMar\Agil Si Cabra{Torpe aqui no en otra lapto [04:41] EstrellaDeMar\Agil
Si Cabra{Torpe aqui no en otra lapto
[04:41] Avestruz_ConPrisa Tiempo! La respuesta es -> mendocino <- [04:41] Avestruz_ConPrisa
Tiempo! La respuesta es -> mendocino <-
[04:41] Avestruz_ConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [04:41] Avestruz_ConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[04:41] Avestruz_ConPrisa Tri.12405 MitologiaɐEDROC˿COMOdSEdLLAMANdLOSdDIOSESdROMANOSdDELdHOGARd?d [04:41] Avestruz_ConPrisa
Tri.12405 MitologiaɐEDROC˿COMOdSEdLLAMANdLOSdDIOSESdROMANOSdDELdHOGARd?d
[04:41] Avestruz_ConPrisa 1 Pista: ***** Pregunta de BONUS : 50000 Puntos [04:41] Avestruz_ConPrisa
1 Pista: ***** Pregunta de BONUS : 50000 Puntos
[04:41] Cabra{Torpe en la laptop donde guardas tus fotos atrevidas [04:41] Cabra{Torpe
en la laptop donde guardas tus fotos atrevidas
[04:41] Cabra_Pedante solo que no carga el link aun xd, [04:41] Cabra_Pedante
solo que no carga el link aun xd,
[04:41] EstrellaDeMar\Agil Pos no se cuales son Cabra_Pedante pidelas para concerlas [04:41] EstrellaDeMar\Agil
Pos no se cuales son Cabra_Pedante pidelas para concerlas
[04:41] Cabra{Torpe dame la clave de esa laptop [04:41] Cabra{Torpe
dame la clave de esa laptop
[04:41] Avestruz_ConPrisa 2 Pista: lar** 30 segundos y 50000 Puntos [04:41] Avestruz_ConPrisa
2 Pista: lar** 30 segundos y 50000 Puntos
[04:41] Libelula-ConPrisa 📻 [Radio Luna de Miel] | 🎧 DJ: Cocodrilo{Suave | 🎶 Musica variada | 🌍 México | 📩 Peticiones: CERRADAS | 🌐 www.radiolunademiel.com [04:41] Libelula-ConPrisa
📻 [Radio Luna de Miel] | 🎧 DJ: Cocodrilo{Suave | 🎶 Musica variada | 🌍 México | 📩 Peticiones: CERRADAS | 🌐 www.radiolunademiel.com
[04:41] EstrellaDeMar\Agil !radio [04:41] EstrellaDeMar\Agil
!radio
[04:42] Avestruz_ConPrisa 3 Pista: lare* 15 segundos y 50000 Puntos [04:42] Avestruz_ConPrisa
3 Pista: lare* 15 segundos y 50000 Puntos
[04:42] EstrellaDeMar\Agil Welcome3 jamas jamassss [04:42] EstrellaDeMar\Agil
Welcome3 jamas jamassss
[04:42] EstrellaDeMar\Agil Lares [04:42] EstrellaDeMar\Agil
Lares
[04:42] Avestruz_ConPrisa �emuestra lo que sabes EstrellaDeMar\Agil! Has respondido "Lares" correctamente y eso te da: �0000�12 puntos [04:42] Avestruz_ConPrisa
�emuestra lo que sabes EstrellaDeMar\Agil! Has respondido "Lares" correctamente y eso te da: �0000�12 puntos
[04:42] Avestruz_ConPrisa EstrellaDeMar\Agil has acertado 2 seguidas!! Puntos HOY: 66263, SEMANA: 66263 y MES: 66263 [04:42] Avestruz_ConPrisa
EstrellaDeMar\Agil has acertado 2 seguidas!! Puntos HOY: 66263, SEMANA: 66263 y MES: 66263
[04:42] Avestruz_ConPrisa R᮫ing MES: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 544265 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [04:42] Avestruz_ConPrisa
R᮫ing MES: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 544265 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[04:42] Avestruz_ConPrisa Tri.20437 Literaturaɴarraˁutorxdei"Cromwell"j?j [04:42] Avestruz_ConPrisa
Tri.20437 Literaturaɴarraˁutorxdei"Cromwell"j?j
[04:42] Avestruz_ConPrisa 1 Pista: ****** **** Pregunta de BONUS : 100000 Puntos [04:42] Avestruz_ConPrisa
1 Pista: ****** **** Pregunta de BONUS : 100000 Puntos
[04:42] Cabra{Torpe jajajaj malosaa!! [04:42] Cabra{Torpe
jajajaj malosaa!!
[04:42] Cabra{Torpe ya me la daras esa claveeee de oro [04:42] Cabra{Torpe
ya me la daras esa claveeee de oro
[04:42] EstrellaDeMar\Agil Pero tengo ese relato tuyo [04:42] EstrellaDeMar\Agil
Pero tengo ese relato tuyo
[04:42] Avestruz_ConPrisa 2 Pista: vic*** **** 30 segundos y 100000 Puntos [04:42] Avestruz_ConPrisa
2 Pista: vic*** **** 30 segundos y 100000 Puntos
[04:42] Cabra_Pedante listo ya pude entrar xd [04:42] Cabra_Pedante
listo ya pude entrar xd
[04:42] Cabra{Torpe jajajaj siii? [04:42] Cabra{Torpe
jajajaj siii?
[04:42] EstrellaDeMar\Agil A ver si un dia los coloco [04:42] EstrellaDeMar\Agil
A ver si un dia los coloco
[04:42] EstrellaDeMar\Agil Vale Cabra_Pedante [04:42] EstrellaDeMar\Agil
Vale Cabra_Pedante
[04:42] Avestruz_ConPrisa 3 Pista: vic*o* *u*o 15 segundos y 100000 Puntos [04:42] Avestruz_ConPrisa
3 Pista: vic*o* *u*o 15 segundos y 100000 Puntos
[04:42] Cabra{Torpe siii para que se haga pipi la fosforita del susto [04:42] Cabra{Torpe
siii para que se haga pipi la fosforita del susto
[04:43] EstrellaDeMar\Agil Sii te aviso cuando vaya a ponerla [04:43] EstrellaDeMar\Agil
Sii te aviso cuando vaya a ponerla
[04:43] Cabra{Torpe cuando vas a emitir__ [04:43] Cabra{Torpe
cuando vas a emitir__
[04:43] Avestruz_ConPrisa Tiempo! La respuesta es -> victor�ugo <- [04:43] Avestruz_ConPrisa
Tiempo! La respuesta es -> victor�ugo <-
[04:43] EstrellaDeMar\Agil Na fosforita es fuerte [04:43] EstrellaDeMar\Agil
Na fosforita es fuerte
[04:43] EstrellaDeMar\Agil En breve [04:43] EstrellaDeMar\Agil
En breve
[04:43] Avestruz_ConPrisa Please refrain from using Extreme Bad Language [04:43] Avestruz_ConPrisa
Please refrain from using Extreme Bad Language
[04:43] Avestruz_ConPrisa Tri.20489 Gastronomiaɭalila˿CAPITALfMANZANERAfDEfESPA񁃰1f?f [04:43] Avestruz_ConPrisa
Tri.20489 Gastronomiaɭalila˿CAPITALfMANZANERAfDEfESPA񁃰1f?f
[04:43] Avestruz_ConPrisa 1 Pista: ************ Valor pregunta : 21314 Puntos [04:43] Avestruz_ConPrisa
1 Pista: ************ Valor pregunta : 21314 Puntos
[04:43] Avestruz_ConPrisa 2 Pista: vil********* 30 segundos y 21314 Puntos [04:43] Avestruz_ConPrisa
2 Pista: vil********* 30 segundos y 21314 Puntos
[04:43] Libelula-ConPrisa ♪ Sonando: OBK - Tal Vez [04:43] Libelula-ConPrisa
♪ Sonando: OBK - Tal Vez
[04:43] EstrellaDeMar\Agil !tema [04:43] EstrellaDeMar\Agil
!tema
[04:43] Avestruz_ConPrisa 3 Pista: vil*a*i*io*a 15 segundos y 21314 Puntos [04:43] Avestruz_ConPrisa
3 Pista: vil*a*i*io*a 15 segundos y 21314 Puntos
[04:43] Cabra{Torpe hay que hacer la reunion de la sala en mi ranchito [04:43] Cabra{Torpe
hay que hacer la reunion de la sala en mi ranchito
[04:44] Avestruz_ConPrisa Tiempo! La respuesta es -> villaviciosa <- [04:44] Avestruz_ConPrisa
Tiempo! La respuesta es -> villaviciosa <-
[04:44] Cabra_Pedante !tocame [04:44] Cabra_Pedante
!tocame
[04:44] Cabra{Torpe o vas a creer que andara gente armada y cosas asi [04:44] Cabra{Torpe
o vas a creer que andara gente armada y cosas asi
[04:44] Avestruz_ConPrisa This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa [04:44] Avestruz_ConPrisa
This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa
[04:44] Avestruz_ConPrisa Tri.10155 Musicaɰailas˿Conmqu郰1sinstrumentoxasociariasqadKennyoBurrellg?s [04:44] Avestruz_ConPrisa
Tri.10155 Musicaɰailas˿Conmqu郰1sinstrumentoxasociariasqadKennyoBurrellg?s
[04:44] Avestruz_ConPrisa 1 Pista: ******** Pregunta de BONUS : 50000 Puntos [04:44] Avestruz_ConPrisa
1 Pista: ******** Pregunta de BONUS : 50000 Puntos
[04:44] Avestruz_ConPrisa 2 Pista: gui***** 30 segundos y 50000 Puntos [04:44] Avestruz_ConPrisa
2 Pista: gui***** 30 segundos y 50000 Puntos
[04:44] EstrellaDeMar\Agil No se [04:44] EstrellaDeMar\Agil
No se
[04:44] Cabra{Torpe me salieron unas ronchitas en el cuello [04:44] Cabra{Torpe
me salieron unas ronchitas en el cuello
[04:44] Avestruz_ConPrisa 3 Pista: gui*a**a 15 segundos y 50000 Puntos [04:44] Avestruz_ConPrisa
3 Pista: gui*a**a 15 segundos y 50000 Puntos
[04:44] EstrellaDeMar\Agil Cabra_Pedante es !tocame tema-interprete [04:44] EstrellaDeMar\Agil
Cabra_Pedante es !tocame tema-interprete
[04:44] Cabra{Torpe me colgue una bolsa en el cuello [04:44] Cabra{Torpe
me colgue una bolsa en el cuello
[04:44] Avestruz_ConPrisa Tiempo! La respuesta es -> guitarra <- [04:44] Avestruz_ConPrisa
Tiempo! La respuesta es -> guitarra <-
[04:45] EstrellaDeMar\Agil Guitarra [04:45] EstrellaDeMar\Agil
Guitarra
[04:45] Cabra{Torpe y siento que eso me dio alguna alergia [04:45] Cabra{Torpe
y siento que eso me dio alguna alergia
[04:45] Cabra_Pedante ahh gracias jsjs sirena__ [04:45] Cabra_Pedante
ahh gracias jsjs sirena__
[04:45] Avestruz_ConPrisa This WEEKS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: EstrellaDeMar\Agil 66263 #13: Botones 58004 #14: gonsi 38799 #15: LeCaTwaLk_z 23250 #16: solterita 22277 #17: Calvito_Klein 20510 #18: QuieroChat-0 13173 #19: Cosmo 7017 #20: * 0 [04:45] Avestruz_ConPrisa
This WEEKS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: EstrellaDeMar\Agil 66263 #13: Botones 58004 #14: gonsi 38799 #15: LeCaTwaLk_z 23250 #16: solterita 22277 #17: Calvito_Klein 20510 #18: QuieroChat-0 13173 #19: Cosmo 7017 #20: * 0
[04:45] Avestruz_ConPrisa Tri.5322 Mitologiaɴjmm.com˿Enalanmitolog�01ngriega,wdioshdelwvientohdelwOeste...w?w [04:45] Avestruz_ConPrisa
Tri.5322 Mitologiaɴjmm.com˿Enalanmitolog�01ngriega,wdioshdelwvientohdelwOeste...w?w
[04:45] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 11989 Puntos [04:45] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 11989 Puntos
[04:45] Avestruz_ConPrisa 2 Pista: cef*** 30 segundos y 11989 Puntos [04:45] Avestruz_ConPrisa
2 Pista: cef*** 30 segundos y 11989 Puntos
[04:45] EstrellaDeMar\Agil Cefalo [04:45] EstrellaDeMar\Agil
Cefalo
[04:45] Avestruz_ConPrisa 3 Pista: cefi*o 15 segundos y 11989 Puntos [04:45] Avestruz_ConPrisa
3 Pista: cefi*o 15 segundos y 11989 Puntos
[04:45] EstrellaDeMar\Agil Gefilo [04:45] EstrellaDeMar\Agil
Gefilo
[04:45] Avestruz_ConPrisa �Increible!! Ketzy contest󺠃04"cefiro" en �9.188 segundos, y ha ganado �1989�12 puntos [04:45] Avestruz_ConPrisa
�Increible!! Ketzy contest󺠃04"cefiro" en �9.188 segundos, y ha ganado �1989�12 puntos
[04:45] Avestruz_ConPrisa ACTION awards Ketzy with a +v for having over 15000 points [04:45] Avestruz_ConPrisa
ACTION awards Ketzy with a +v for having over 15000 points
[04:45] Avestruz_ConPrisa Ketzy has acertado 1 seguidas!! Puntos HOY: 25001, SEMANA: 556254 y MES: 556254 [04:45] Avestruz_ConPrisa
Ketzy has acertado 1 seguidas!! Puntos HOY: 25001, SEMANA: 556254 y MES: 556254
[04:45] EstrellaDeMar\Agil Cefino [04:45] EstrellaDeMar\Agil
Cefino
[04:45] EstrellaDeMar\Agil Ajajaj [04:45] EstrellaDeMar\Agil
Ajajaj
[04:45] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [04:45] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[04:45] Avestruz_ConPrisa Tri.13504 Cotilleo-TVɤassler˿Aoqui鮃01phalestadouunidaldurantegmuchosya񯳃01ylalvedettegNormaltDuval?o?o [04:45] Avestruz_ConPrisa
Tri.13504 Cotilleo-TVɤassler˿Aoqui鮃01phalestadouunidaldurantegmuchosya񯳃01ylalvedettegNormaltDuval?o?o
[04:45] Avestruz_ConPrisa 1 Pista: **** ********** Valor pregunta : 7553 Puntos [04:45] Avestruz_ConPrisa
1 Pista: **** ********** Valor pregunta : 7553 Puntos
[04:46] EstrellaDeMar\Agil Na ajajaja [04:46] EstrellaDeMar\Agil
Na ajajaja
[04:46] Avestruz_ConPrisa 2 Pista: mar* ********** 30 segundos y 7553 Puntos [04:46] Avestruz_ConPrisa
2 Pista: mar* ********** 30 segundos y 7553 Puntos
[04:46] EstrellaDeMar\Agil XD [04:46] EstrellaDeMar\Agil
XD
[04:46] Avestruz_ConPrisa 3 Pista: mar* o**a**e*i* 15 segundos y 7553 Puntos [04:46] Avestruz_ConPrisa
3 Pista: mar* o**a**e*i* 15 segundos y 7553 Puntos
[04:46] Avestruz_ConPrisa Tiempo! La respuesta es -> marc�starcevic <- [04:46] Avestruz_ConPrisa
Tiempo! La respuesta es -> marc�starcevic <-
[04:46] Avestruz_ConPrisa This MONTHS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: EstrellaDeMar\Agil 66263 #13: Botones 58004 #14: gonsi 38799 #15: LeCaTwaLk_z 23250 #16: solterita 22277 #17: Calvito_Klein 20510 #18: QuieroChat-0 13173 #19: Cosmo 7017 #20: * 0 [04:46] Avestruz_ConPrisa
This MONTHS Top 11-20: - #11: ViajeroDeTiempo21 116913 #12: EstrellaDeMar\Agil 66263 #13: Botones 58004 #14: gonsi 38799 #15: LeCaTwaLk_z 23250 #16: solterita 22277 #17: Calvito_Klein 20510 #18: QuieroChat-0 13173 #19: Cosmo 7017 #20: * 0
[04:46] Avestruz_ConPrisa Tri.6831 Cineɭartuniki˿LAcFUERZAcDELcCARI񏃰1cTUVOcDOScACTRICEScCANDIDATAScAcOSCARcSHIRLEYcMACLAINEcYc?c [04:46] Avestruz_ConPrisa
Tri.6831 Cineɭartuniki˿LAcFUERZAcDELcCARI񏃰1cTUVOcDOScACTRICEScCANDIDATAScAcOSCARcSHIRLEYcMACLAINEcYc?c
[04:46] Avestruz_ConPrisa 1 Pista: ***** ****** Valor pregunta : 8296 Puntos [04:46] Avestruz_ConPrisa
1 Pista: ***** ****** Valor pregunta : 8296 Puntos
[04:47] Cabra_Pedante emma stone [04:47] Cabra_Pedante
emma stone
[04:47] Avestruz_ConPrisa 2 Pista: deb** ****** 30 segundos y 8296 Puntos [04:47] Avestruz_ConPrisa
2 Pista: deb** ****** 30 segundos y 8296 Puntos
[04:47] Avestruz_ConPrisa 3 Pista: deb*a *i**e* 15 segundos y 8296 Puntos [04:47] Avestruz_ConPrisa
3 Pista: deb*a *i**e* 15 segundos y 8296 Puntos
[04:47] Avestruz_ConPrisa Tiempo! La respuesta es -> debra�inger <- [04:47] Avestruz_ConPrisa
Tiempo! La respuesta es -> debra�inger <-
[04:47] Avestruz_ConPrisa R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516 [04:47] Avestruz_ConPrisa
R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516
[04:47] Avestruz_ConPrisa Tri.3173 Politicaɂasic˿Defqu郰1mᲢolpesylauhojauquefluceflaubanderaudefCanadჰ1m?m [04:47] Avestruz_ConPrisa
Tri.3173 Politicaɂasic˿Defqu郰1mᲢolpesylauhojauquefluceflaubanderaudefCanadჰ1m?m
[04:47] Avestruz_ConPrisa 1 Pista: **** Valor pregunta : 11922 Puntos [04:47] Avestruz_ConPrisa
1 Pista: **** Valor pregunta : 11922 Puntos
[04:47] Cabra_Pedante de maple [04:47] Cabra_Pedante
de maple
[04:48] Avestruz_ConPrisa 2 Pista: arc* 30 segundos y 11922 Puntos [04:48] Avestruz_ConPrisa
2 Pista: arc* 30 segundos y 11922 Puntos
[04:48] Avestruz_ConPrisa 3 Pista: arce 15 segundos y 11922 Puntos [04:48] Avestruz_ConPrisa
3 Pista: arce 15 segundos y 11922 Puntos
[04:48] Avestruz_ConPrisa Tiempo! La respuesta es -> arce <- [04:48] Avestruz_ConPrisa
Tiempo! La respuesta es -> arce <-
[04:48] Avestruz_ConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [04:48] Avestruz_ConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[04:48] Avestruz_ConPrisa Tri.8861 DeporteɔeLaRaNhA˿GanadormdelpDakarm2001,bcategoriavMOTOSb?b [04:48] Avestruz_ConPrisa
Tri.8861 DeporteɔeLaRaNhA˿GanadormdelpDakarm2001,bcategoriavMOTOSb?b
[04:48] Avestruz_ConPrisa 1 Pista: ******** ***** Valor pregunta : 23877 Puntos [04:48] Avestruz_ConPrisa
1 Pista: ******** ***** Valor pregunta : 23877 Puntos
[04:48] Avestruz_ConPrisa 2 Pista: fab***** ***** 30 segundos y 23877 Puntos [04:48] Avestruz_ConPrisa
2 Pista: fab***** ***** 30 segundos y 23877 Puntos
[04:49] Avestruz_ConPrisa 3 Pista: fab*i*io *eo*i 15 segundos y 23877 Puntos [04:49] Avestruz_ConPrisa
3 Pista: fab*i*io *eo*i 15 segundos y 23877 Puntos
[04:49] Avestruz_ConPrisa Tiempo! La respuesta es -> fabrizio�eoni <- [04:49] Avestruz_ConPrisa
Tiempo! La respuesta es -> fabrizio�eoni <-
[04:49] Avestruz_ConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [04:49] Avestruz_ConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[04:49] Avestruz_ConPrisa Tri.3951 Mitologiaɂeleg---˿CualafuegelatutorcdegTurinhTurambarcenhlatnovelatdegTolkienh"elaSilmarillionh?r [04:49] Avestruz_ConPrisa
Tri.3951 Mitologiaɂeleg---˿CualafuegelatutorcdegTurinhTurambarcenhlatnovelatdegTolkienh"elaSilmarillionh?r
[04:49] Avestruz_ConPrisa 1 Pista: ***** ********* Valor pregunta : 13751 Puntos [04:49] Avestruz_ConPrisa
1 Pista: ***** ********* Valor pregunta : 13751 Puntos
[04:49] Avestruz_ConPrisa 2 Pista: bel** ********* 30 segundos y 13751 Puntos [04:49] Avestruz_ConPrisa
2 Pista: bel** ********* 30 segundos y 13751 Puntos
[04:50] Avestruz_ConPrisa 3 Pista: bele* *u**a*io* 15 segundos y 13751 Puntos [04:50] Avestruz_ConPrisa
3 Pista: bele* *u**a*io* 15 segundos y 13751 Puntos
[04:50] Avestruz_ConPrisa Tiempo! La respuesta es -> beleg�uthalion <- [04:50] Avestruz_ConPrisa
Tiempo! La respuesta es -> beleg�uthalion <-
[04:50] Avestruz_ConPrisa R᮫ing SEMANA: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 556254 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [04:50] Avestruz_ConPrisa
R᮫ing SEMANA: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 556254 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[04:50] Avestruz_ConPrisa Tri.13638 Arteɋwahamot˿Endquecmaterialrestჰ1trealizadokelrArapPacisaromanok?t [04:50] Avestruz_ConPrisa
Tri.13638 Arteɋwahamot˿Endquecmaterialrestჰ1trealizadokelrArapPacisaromanok?t
[04:50] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 9831 Puntos [04:50] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 9831 Puntos
[04:50] Avestruz_ConPrisa 2 Pista: mar*** 30 segundos y 9831 Puntos [04:50] Avestruz_ConPrisa
2 Pista: mar*** 30 segundos y 9831 Puntos
[04:51] Avestruz_ConPrisa 3 Pista: mar*o* 15 segundos y 9831 Puntos [04:51] Avestruz_ConPrisa
3 Pista: mar*o* 15 segundos y 9831 Puntos
[04:51] EstrellaDeMar\Agil Marmol [04:51] EstrellaDeMar\Agil
Marmol
[04:51] Avestruz_ConPrisa �Bien EstrellaDeMar\Agil!! Tu respuesta: "Marmol" es correcta y ganas �831�12 puntos [04:51] Avestruz_ConPrisa
�Bien EstrellaDeMar\Agil!! Tu respuesta: "Marmol" es correcta y ganas �831�12 puntos
[04:51] Avestruz_ConPrisa EstrellaDeMar\Agil has acertado 1 seguidas!! Puntos HOY: 76094, SEMANA: 76094 y MES: 76094 [04:51] Avestruz_ConPrisa
EstrellaDeMar\Agil has acertado 1 seguidas!! Puntos HOY: 76094, SEMANA: 76094 y MES: 76094
[04:51] Avestruz_ConPrisa We feature over 50,000 Q&A ! [04:51] Avestruz_ConPrisa
We feature over 50,000 Q&A !
[04:51] Avestruz_ConPrisa Tri.7806 Cineɫotopoulo˿"Tienesrunae-mail"lselbasabagenaunagpel�lagdelLubitsch.lCualc?l [04:51] Avestruz_ConPrisa
Tri.7806 Cineɫotopoulo˿"Tienesrunae-mail"lselbasabagenaunagpel�lagdelLubitsch.lCualc?l
[04:51] Avestruz_ConPrisa 1 Pista: ** ***** ** *** ********* Valor pregunta : 23294 Puntos [04:51] Avestruz_ConPrisa
1 Pista: ** ***** ** *** ********* Valor pregunta : 23294 Puntos
[04:51] Avestruz_ConPrisa 2 Pista: el�**** ** *** ********* 30 segundos y 23294 Puntos [04:51] Avestruz_ConPrisa
2 Pista: el�**** ** *** ********* 30 segundos y 23294 Puntos
[04:51] Avestruz_ConPrisa 3 Pista: el�a*a* *e *a* *o***e*a* 15 segundos y 23294 Puntos [04:51] Avestruz_ConPrisa
3 Pista: el�a*a* *e *a* *o***e*a* 15 segundos y 23294 Puntos
[04:52] Avestruz_ConPrisa Tiempo! La respuesta es -> el�azar�e�as�orpresas <- [04:52] Avestruz_ConPrisa
Tiempo! La respuesta es -> el�azar�e�as�orpresas <-
[04:52] Avestruz_ConPrisa Tri.17773 Gastronomiaɉngusetia˿DesdondeseskelpvodkaoStolichnayao?f [04:52] Avestruz_ConPrisa
Tri.17773 Gastronomiaɉngusetia˿DesdondeseskelpvodkaoStolichnayao?f
[04:52] Avestruz_ConPrisa 1 Pista: ***** Valor pregunta : 24758 Puntos [04:52] Avestruz_ConPrisa
1 Pista: ***** Valor pregunta : 24758 Puntos
[04:52] Avestruz_ConPrisa 2 Pista: rus** 30 segundos y 24758 Puntos [04:52] Avestruz_ConPrisa
2 Pista: rus** 30 segundos y 24758 Puntos
[04:52] Avestruz_ConPrisa 3 Pista: rusia 15 segundos y 24758 Puntos [04:52] Avestruz_ConPrisa
3 Pista: rusia 15 segundos y 24758 Puntos
[04:52] EstrellaDeMar\Agil Rusia [04:52] EstrellaDeMar\Agil
Rusia
[04:52] Avestruz_ConPrisa �Ol頃04EstrellaDeMar\Agil!! Has contestado: "Rusia" en �3.203 segundos y sumas �4758�12 puntos a tu marcador. �Sigue as� [04:52] Avestruz_ConPrisa
�Ol頃04EstrellaDeMar\Agil!! Has contestado: "Rusia" en �3.203 segundos y sumas �4758�12 puntos a tu marcador. �Sigue as�
[04:52] Avestruz_ConPrisa EstrellaDeMar\Agil has acertado 2 seguidas!! Puntos HOY: 100852, SEMANA: 100852 y MES: 100852 [04:52] Avestruz_ConPrisa
EstrellaDeMar\Agil has acertado 2 seguidas!! Puntos HOY: 100852, SEMANA: 100852 y MES: 100852
[04:52] Cabra_Pedante :o [04:52] Cabra_Pedante
:o
[04:52] Avestruz_ConPrisa Tri.9619 CineɞIrati˿Actoresdprincipalesdden"Eljclansdenlosdirlandeses"h?h [04:52] Avestruz_ConPrisa
Tri.9619 CineɞIrati˿Actoresdprincipalesdden"Eljclansdenlosdirlandeses"h?h
[04:52] Avestruz_ConPrisa 1 Pista: **** ****** * **** **** Pregunta de BONUS : 50000 Puntos [04:52] Avestruz_ConPrisa
1 Pista: **** ****** * **** **** Pregunta de BONUS : 50000 Puntos
[04:52] Cabra_Pedante EstrellaDeMar\Agil está arrasando [04:52] Cabra_Pedante
EstrellaDeMar\Agil está arrasando
[04:53] Avestruz_ConPrisa 2 Pista: gar* ****** * **** **** 30 segundos y 50000 Puntos [04:53] Avestruz_ConPrisa
2 Pista: gar* ****** * **** **** 30 segundos y 50000 Puntos
[04:53] Avestruz_ConPrisa 3 Pista: gar* o***a* * *ea* *e** 15 segundos y 50000 Puntos [04:53] Avestruz_ConPrisa
3 Pista: gar* o***a* * *ea* *e** 15 segundos y 50000 Puntos
[04:53] EstrellaDeMar\Agil Cabra_Pedante ajajaja [04:53] EstrellaDeMar\Agil
Cabra_Pedante ajajaja
[04:53] Avestruz_ConPrisa Tiempo! La respuesta es -> gary�ldman��ean�enn <- [04:53] Avestruz_ConPrisa
Tiempo! La respuesta es -> gary�ldman��ean�enn <-
[04:53] EstrellaDeMar\Agil Juega tambien vale [04:53] EstrellaDeMar\Agil
Juega tambien vale
[04:53] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [04:53] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[04:53] Avestruz_ConPrisa Tri.9252 Cotilleo-TVɖivian˿ChristianfDiorberalunfdese񡤯rbdeimoda...?p?p [04:53] Avestruz_ConPrisa
Tri.9252 Cotilleo-TVɖivian˿ChristianfDiorberalunfdese񡤯rbdeimoda...?p?p
[04:53] Avestruz_ConPrisa 1 Pista: ******* Pregunta de BONUS : 50000 Puntos [04:53] Avestruz_ConPrisa
1 Pista: ******* Pregunta de BONUS : 50000 Puntos
[04:53] Cabra_Pedante jsjsjs  vaa aunque no se nada xp [04:53] Cabra_Pedante
jsjsjs  vaa aunque no se nada xp
[04:54] Avestruz_ConPrisa 2 Pista: fra**** 30 segundos y 50000 Puntos [04:54] Avestruz_ConPrisa
2 Pista: fra**** 30 segundos y 50000 Puntos
[04:54] Avestruz_ConPrisa 3 Pista: fra**e* 15 segundos y 50000 Puntos [04:54] Avestruz_ConPrisa
3 Pista: fra**e* 15 segundos y 50000 Puntos
[04:54] EstrellaDeMar\Agil Frances [04:54] EstrellaDeMar\Agil
Frances
[04:54] Avestruz_ConPrisa �Enhorabuena EstrellaDeMar\Agil!! Has contestado "Frances" y por ello has ganado �0000�12 puntos [04:54] Avestruz_ConPrisa
�Enhorabuena EstrellaDeMar\Agil!! Has contestado "Frances" y por ello has ganado �0000�12 puntos
[04:54] Avestruz_ConPrisa EstrellaDeMar\Agil has acertado 3 seguidas!! Puntos HOY: 150852, SEMANA: 150852 y MES: 150852 [04:54] Avestruz_ConPrisa
EstrellaDeMar\Agil has acertado 3 seguidas!! Puntos HOY: 150852, SEMANA: 150852 y MES: 150852
[04:54] Avestruz_ConPrisa R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898 [04:54] Avestruz_ConPrisa
R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898
[04:54] Avestruz_ConPrisa Tri.16582 Biologiaɳtephenwo˿Enyquehpaisvestჰ1rlarunicarcoloniardehbisontesveuropeosvconysolod1000rindividuos?r?r [04:54] Avestruz_ConPrisa
Tri.16582 Biologiaɳtephenwo˿Enyquehpaisvestჰ1rlarunicarcoloniardehbisontesveuropeosvconysolod1000rindividuos?r?r
[04:54] Avestruz_ConPrisa 1 Pista: ******* Pregunta de BONUS : 200000 Puntos [04:54] Avestruz_ConPrisa
1 Pista: ******* Pregunta de BONUS : 200000 Puntos
[04:54] Cabra_Pedante :o [04:54] Cabra_Pedante
:o
[04:54] Avestruz_ConPrisa 2 Pista: pol**** 30 segundos y 200000 Puntos [04:54] Avestruz_ConPrisa
2 Pista: pol**** 30 segundos y 200000 Puntos
[04:55] Cabra_Pedante Polonia [04:55] Cabra_Pedante
Polonia
[04:55] Avestruz_ConPrisa �Bien Cabra_Pedante!! Tu respuesta: "Polonia" es correcta y ganas �00000�12 puntos [04:55] Avestruz_ConPrisa
�Bien Cabra_Pedante!! Tu respuesta: "Polonia" es correcta y ganas �00000�12 puntos
[04:55] Avestruz_ConPrisa ACTION awards Cabra_Pedante with a +v for having over 15000 points [04:55] Avestruz_ConPrisa
ACTION awards Cabra_Pedante with a +v for having over 15000 points
[04:55] Avestruz_ConPrisa Cabra_Pedante has acertado 1 seguidas!! Puntos HOY: 200000, SEMANA: 200000 y MES: 200000 [04:55] Avestruz_ConPrisa
Cabra_Pedante has acertado 1 seguidas!! Puntos HOY: 200000, SEMANA: 200000 y MES: 200000
[04:55] EstrellaDeMar\Agil Es un chinazo [04:55] EstrellaDeMar\Agil
Es un chinazo
[04:55] Cabra_Pedante xD [04:55] Cabra_Pedante
xD
[04:55] EstrellaDeMar\Agil Viste [04:55] EstrellaDeMar\Agil
Viste
[04:55] EstrellaDeMar\Agil Es facil [04:55] EstrellaDeMar\Agil
Es facil
[04:55] Avestruz_ConPrisa If you think a Q&A is wrong, please call an OP [04:55] Avestruz_ConPrisa
If you think a Q&A is wrong, please call an OP
[04:55] Avestruz_ConPrisa Tri.16484 Politicaɂuzzati˿CONSULTAoQUEoLOSoPODERESoPڂLICOSoSOMETENoALoVOTOoPOPULARoDIRECTOo?o [04:55] Avestruz_ConPrisa
Tri.16484 Politicaɂuzzati˿CONSULTAoQUEoLOSoPODERESoPڂLICOSoSOMETENoALoVOTOoPOPULARoDIRECTOo?o
[04:55] Avestruz_ConPrisa 1 Pista: ********** Valor pregunta : 11873 Puntos [04:55] Avestruz_ConPrisa
1 Pista: ********** Valor pregunta : 11873 Puntos
[04:55] Avestruz_ConPrisa 2 Pista: ple******* 30 segundos y 11873 Puntos [04:55] Avestruz_ConPrisa
2 Pista: ple******* 30 segundos y 11873 Puntos
[04:55] EstrellaDeMar\Agil Plesbicito [04:55] EstrellaDeMar\Agil
Plesbicito
[04:55] Cabra_Pedante :o [04:55] Cabra_Pedante
:o
[04:55] EstrellaDeMar\Agil Plebicito [04:55] EstrellaDeMar\Agil
Plebicito
[04:55] Avestruz_ConPrisa 3 Pista: ple*i**i*o 15 segundos y 11873 Puntos [04:55] Avestruz_ConPrisa
3 Pista: ple*i**i*o 15 segundos y 11873 Puntos
[04:55] EstrellaDeMar\Agil Naaaaa [04:55] EstrellaDeMar\Agil
Naaaaa
[04:55] EstrellaDeMar\Agil Plebiscito [04:55] EstrellaDeMar\Agil
Plebiscito
[04:55] Avestruz_ConPrisa �EstrellaDeMar\Agil acert󡡠La respuesta era: "Plebiscito" y contest󠥮 �5.891 segundos. Se lleva: �1873�12 puntos [04:55] Avestruz_ConPrisa
�EstrellaDeMar\Agil acert󡡠La respuesta era: "Plebiscito" y contest󠥮 �5.891 segundos. Se lleva: �1873�12 puntos
[04:55] Avestruz_ConPrisa EstrellaDeMar\Agil has acertado 1 seguidas!! Puntos HOY: 162725, SEMANA: 162725 y MES: 162725 [04:55] Avestruz_ConPrisa
EstrellaDeMar\Agil has acertado 1 seguidas!! Puntos HOY: 162725, SEMANA: 162725 y MES: 162725
[04:55] EstrellaDeMar\Agil Ajajaj [04:55] EstrellaDeMar\Agil
Ajajaj
[04:55] Avestruz_ConPrisa R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226 [04:55] Avestruz_ConPrisa
R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226
[04:55] Avestruz_ConPrisa Tri.12845 Geografiaɓebosin˿Elfnombresdesqu郰1mregi󮃰1uitalianaqderivaqdes"largus"m(largo)myybarba?m?m [04:55] Avestruz_ConPrisa
Tri.12845 Geografiaɓebosin˿Elfnombresdesqu郰1mregi󮃰1uitalianaqderivaqdes"largus"m(largo)myybarba?m?m
[04:55] Avestruz_ConPrisa 1 Pista: ********* Valor pregunta : 12797 Puntos [04:55] Avestruz_ConPrisa
1 Pista: ********* Valor pregunta : 12797 Puntos
[04:56] Avestruz_ConPrisa 2 Pista: lom****** 30 segundos y 12797 Puntos [04:56] Avestruz_ConPrisa
2 Pista: lom****** 30 segundos y 12797 Puntos
[04:56] Avestruz_ConPrisa 3 Pista: lom*a**ia 15 segundos y 12797 Puntos [04:56] Avestruz_ConPrisa
3 Pista: lom*a**ia 15 segundos y 12797 Puntos
[04:56] Avestruz_ConPrisa Tiempo! La respuesta es -> lombardia <- [04:56] Avestruz_ConPrisa
Tiempo! La respuesta es -> lombardia <-
[04:56] Avestruz_ConPrisa For The Competitive Edge type !pingme [04:56] Avestruz_ConPrisa
For The Competitive Edge type !pingme
[04:56] Avestruz_ConPrisa Tri.2230 MitologiaɄivah˿DIOSsESCANDINAVOsESPOSOsDEsEDDAs?s [04:56] Avestruz_ConPrisa
Tri.2230 MitologiaɄivah˿DIOSsESCANDINAVOsESPOSOsDEsEDDAs?s
[04:56] Avestruz_ConPrisa 1 Pista: ** Valor pregunta : 20214 Puntos [04:56] Avestruz_ConPrisa
1 Pista: ** Valor pregunta : 20214 Puntos
[04:57] Avestruz_ConPrisa 2 Pista: ai 30 segundos y 20214 Puntos [04:57] Avestruz_ConPrisa
2 Pista: ai 30 segundos y 20214 Puntos
[04:57] EstrellaDeMar\Agil Ai [04:57] EstrellaDeMar\Agil
Ai
[04:57] Avestruz_ConPrisa �Absolutamente correcto EstrellaDeMar\Agil!! Acertaste "Ai" en �5.015 segundos y ganas �0214�12 puntos [04:57] Avestruz_ConPrisa
�Absolutamente correcto EstrellaDeMar\Agil!! Acertaste "Ai" en �5.015 segundos y ganas �0214�12 puntos
[04:57] Avestruz_ConPrisa EstrellaDeMar\Agil has acertado 2 seguidas!! Puntos HOY: 182939, SEMANA: 182939 y MES: 182939 [04:57] Avestruz_ConPrisa
EstrellaDeMar\Agil has acertado 2 seguidas!! Puntos HOY: 182939, SEMANA: 182939 y MES: 182939
[04:57] Cabra_Pedante :o [04:57] Cabra_Pedante
:o
[04:57] Avestruz_ConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [04:57] Avestruz_ConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[04:57] Avestruz_ConPrisa Tri.9060 Biologiaɂatval˿COMOfSEfLLAMANfLOSfANIMALESfQUEfCOMENfHOJAS?f?f [04:57] Avestruz_ConPrisa
Tri.9060 Biologiaɂatval˿COMOfSEfLLAMANfLOSfANIMALESfQUEfCOMENfHOJAS?f?f
[04:57] Avestruz_ConPrisa 1 Pista: ********* Valor pregunta : 24853 Puntos [04:57] Avestruz_ConPrisa
1 Pista: ********* Valor pregunta : 24853 Puntos
[04:57] Cabra_Pedante Herviboro [04:57] Cabra_Pedante
Herviboro
[04:57] Avestruz_ConPrisa 2 Pista: fil****** 30 segundos y 24853 Puntos [04:57] Avestruz_ConPrisa
2 Pista: fil****** 30 segundos y 24853 Puntos
[04:58] Cabra{Torpe me gusta el desmadre [04:58] Cabra{Torpe
me gusta el desmadre
[04:58] Avestruz_ConPrisa 3 Pista: filo*a*o* 15 segundos y 24853 Puntos [04:58] Avestruz_ConPrisa
3 Pista: filo*a*o* 15 segundos y 24853 Puntos
[04:58] Cabra_Pedante u.u [04:58] Cabra_Pedante
u.u
[04:58] EstrellaDeMar\Agil Filo [04:58] EstrellaDeMar\Agil
Filo
[04:58] Cabra{Torpe señoras tirando soda [04:58] Cabra{Torpe
señoras tirando soda
[04:58] EstrellaDeMar\Agil Nu se [04:58] EstrellaDeMar\Agil
Nu se
[04:58] Avestruz_ConPrisa Tiempo! La respuesta es -> filofagos <- [04:58] Avestruz_ConPrisa
Tiempo! La respuesta es -> filofagos <-
[04:58] EstrellaDeMar\Agil Na se pasa [04:58] EstrellaDeMar\Agil
Na se pasa
[04:58] Cabra{Torpe las fiestas llenas de soda [04:58] Cabra{Torpe
las fiestas llenas de soda
[04:58] Cabra{Torpe rios de soda [04:58] Cabra{Torpe
rios de soda
[04:58] Avestruz_ConPrisa R᮫ing MES: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 556254 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506 [04:58] Avestruz_ConPrisa
R᮫ing MES: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 556254 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: HETEROFLEXIBLE 339385 #8: KaZuMa_KiRyU 311343 #9: GaSpAriNa 263345 #10: siva- 221506
[04:58] Avestruz_ConPrisa Tri.20003 Cienciaɲaabe˿(Matemᴩcas)queuesmuntgruposabelianos?y [04:58] Avestruz_ConPrisa
Tri.20003 Cienciaɲaabe˿(Matemᴩcas)queuesmuntgruposabelianos?y
[04:58] Avestruz_ConPrisa 1 Pista: ** ***** *********** Valor pregunta : 20791 Puntos [04:58] Avestruz_ConPrisa
1 Pista: ** ***** *********** Valor pregunta : 20791 Puntos
[04:58] Cabra_Pedante bien tramposo el manito xd [04:58] Cabra_Pedante
bien tramposo el manito xd
[04:58] Cabra{Torpe que no pare de llegar la soda [04:58] Cabra{Torpe
que no pare de llegar la soda
[04:58] EstrellaDeMar\Agil De pana [04:58] EstrellaDeMar\Agil
De pana
[04:58] Avestruz_ConPrisa 2 Pista: un�**** *********** 30 segundos y 20791 Puntos [04:58] Avestruz_ConPrisa
2 Pista: un�**** *********** 30 segundos y 20791 Puntos
[04:58] Cabra{Torpe señoras embarazadas por doquier [04:58] Cabra{Torpe
señoras embarazadas por doquier
[04:58] Cabra_Pedante eres de venezuela Sirena? [04:58] Cabra_Pedante
eres de venezuela Sirena?
[04:58] Cabra_Pedante de panita :p [04:58] Cabra_Pedante
de panita :p
[04:58] Avestruz_ConPrisa 3 Pista: un�*u*o *o**u*a*i*o 15 segundos y 20791 Puntos [04:58] Avestruz_ConPrisa
3 Pista: un�*u*o *o**u*a*i*o 15 segundos y 20791 Puntos
[04:59] Avestruz_ConPrisa Tiempo! La respuesta es -> un�rupo�ommutativo <- [04:59] Avestruz_ConPrisa
Tiempo! La respuesta es -> un�rupo�ommutativo <-
[04:59] Avestruz_ConPrisa Please refrain from using Extreme Bad Language [04:59] Avestruz_ConPrisa
Please refrain from using Extreme Bad Language
[04:59] Avestruz_ConPrisa Tri.8249 MitologiaɒedTony˿Derqui鮃01rserenamor󃰱eSelene?e?e [04:59] Avestruz_ConPrisa
Tri.8249 MitologiaɒedTony˿Derqui鮃01rserenamor󃰱eSelene?e?e
[04:59] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 21092 Puntos [04:59] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 21092 Puntos
[04:59] Cabra_Pedante de minotauro [04:59] Cabra_Pedante
de minotauro
[04:59] Avestruz_ConPrisa 2 Pista: end***** 30 segundos y 21092 Puntos [04:59] Avestruz_ConPrisa
2 Pista: end***** 30 segundos y 21092 Puntos
[04:59] Cabra{Torpe es cierto que van a destruir israel? EstrellaDeMar\Agil [04:59] Cabra{Torpe
es cierto que van a destruir israel? EstrellaDeMar\Agil
[04:59] Cabra_Pedante de zeus [04:59] Cabra_Pedante
de zeus
[04:59] Avestruz_ConPrisa 3 Pista: endi*io* 15 segundos y 21092 Puntos [04:59] Avestruz_ConPrisa
3 Pista: endi*io* 15 segundos y 21092 Puntos
[04:59] EstrellaDeMar\Agil Prefiero no opinar Cabra{Torpe [04:59] EstrellaDeMar\Agil
Prefiero no opinar Cabra{Torpe
[05:00] Cabra{Torpe porqueee [05:00] Cabra{Torpe
porqueee
[05:00] EstrellaDeMar\Agil Cabra_Pedante yeah [05:00] EstrellaDeMar\Agil
Cabra_Pedante yeah
[05:00] Avestruz_ConPrisa Tiempo! La respuesta es -> endimion <- [05:00] Avestruz_ConPrisa
Tiempo! La respuesta es -> endimion <-
[05:00] Cabra{Torpe te tienen intervenidaaa!!! [05:00] Cabra{Torpe
te tienen intervenidaaa!!!
[05:00] EstrellaDeMar\Agil Nop [05:00] EstrellaDeMar\Agil
Nop
[05:00] Cabra_Pedante rayos :( [05:00] Cabra_Pedante
rayos :(
[05:00] Avestruz_ConPrisa This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa [05:00] Avestruz_ConPrisa
This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa
[05:00] Avestruz_ConPrisa Tri.623 MitologiaɔeLaRaNhA˿Egiptologia:pcuantosyhijosytuvoohorusy(cifra)p?p [05:00] Avestruz_ConPrisa
Tri.623 MitologiaɔeLaRaNhA˿Egiptologia:pcuantosyhijosytuvoohorusy(cifra)p?p
[05:00] Avestruz_ConPrisa 1 Pista: * Valor pregunta : 19060 Puntos [05:00] Avestruz_ConPrisa
1 Pista: * Valor pregunta : 19060 Puntos
[05:00] Cabra_Pedante 5 [05:00] Cabra_Pedante
5
[05:00] Avestruz_ConPrisa 2 Pista: 4 30 segundos y 19060 Puntos [05:00] Avestruz_ConPrisa
2 Pista: 4 30 segundos y 19060 Puntos
[05:00] EstrellaDeMar\Agil 4 [05:00] EstrellaDeMar\Agil
4
[05:00] Avestruz_ConPrisa �emuestra lo que sabes EstrellaDeMar\Agil! Has respondido "4" correctamente y eso te da: �9060�12 puntos [05:00] Avestruz_ConPrisa
�emuestra lo que sabes EstrellaDeMar\Agil! Has respondido "4" correctamente y eso te da: �9060�12 puntos
[05:00] Cabra_Pedante 4 [05:00] Cabra_Pedante
4
[05:00] Avestruz_ConPrisa EstrellaDeMar\Agil has acertado 3 seguidas!! Puntos HOY: 201999, SEMANA: 201999 y MES: 201999 [05:00] Avestruz_ConPrisa
EstrellaDeMar\Agil has acertado 3 seguidas!! Puntos HOY: 201999, SEMANA: 201999 y MES: 201999
[05:00] Cabra{Torpe eres petrolera , EstrellaDeMar\Agil ? [05:00] Cabra{Torpe
eres petrolera , EstrellaDeMar\Agil ?
[05:00] EstrellaDeMar\Agil Ajajaja [05:00] EstrellaDeMar\Agil
Ajajaja
[05:00] Cabra_Pedante xD [05:00] Cabra_Pedante
xD
[05:00] EstrellaDeMar\Agil Se [05:00] EstrellaDeMar\Agil
Se
[05:00] Cabra{Torpe regalame 2 3 buques [05:00] Cabra{Torpe
regalame 2 3 buques
[05:00] Avestruz_ConPrisa This WEEKS Top 11-20: - #11: Cabra_Pedante 200000 #12: EstrellaDeMar\Agil 182939 #13: ViajeroDeTiempo21 116913 #14: Botones 58004 #15: gonsi 38799 #16: LeCaTwaLk_z 23250 #17: solterita 22277 #18: Calvito_Klein 20510 #19: QuieroChat-0 13173 #20: Cosmo 7017 [05:00] Avestruz_ConPrisa
This WEEKS Top 11-20: - #11: Cabra_Pedante 200000 #12: EstrellaDeMar\Agil 182939 #13: ViajeroDeTiempo21 116913 #14: Botones 58004 #15: gonsi 38799 #16: LeCaTwaLk_z 23250 #17: solterita 22277 #18: Calvito_Klein 20510 #19: QuieroChat-0 13173 #20: Cosmo 7017
[05:00] Avestruz_ConPrisa Tri.2335 Economiaɦlipp_er˿Dexquexpaiszeszlafmonedafllamadaf"lek"?d?d [05:00] Avestruz_ConPrisa
Tri.2335 Economiaɦlipp_er˿Dexquexpaiszeszlafmonedafllamadaf"lek"?d?d
[05:00] Avestruz_ConPrisa 1 Pista: ******* Valor pregunta : 21232 Puntos [05:00] Avestruz_ConPrisa
1 Pista: ******* Valor pregunta : 21232 Puntos
[05:00] Cabra{Torpe quiero petroleo para dar en la fiesta [05:00] Cabra{Torpe
quiero petroleo para dar en la fiesta
[05:01] Avestruz_ConPrisa 2 Pista: alb**** 30 segundos y 21232 Puntos [05:01] Avestruz_ConPrisa
2 Pista: alb**** 30 segundos y 21232 Puntos
[05:01] EstrellaDeMar\Agil Jajaja chamo [05:01] EstrellaDeMar\Agil
Jajaja chamo
[05:01] Cabra_Pedante Albania [05:01] Cabra_Pedante
Albania
[05:01] Avestruz_ConPrisa �Bingo!! Cabra_Pedante dio la respuesta: "Albania" en �7.219 segundos e incrementa sus ganancias con �1232�12 puntos [05:01] Avestruz_ConPrisa
�Bingo!! Cabra_Pedante dio la respuesta: "Albania" en �7.219 segundos e incrementa sus ganancias con �1232�12 puntos
[05:01] Avestruz_ConPrisa ACTION awards Cabra_Pedante with a +v for having over 15000 points [05:01] Avestruz_ConPrisa
ACTION awards Cabra_Pedante with a +v for having over 15000 points
[05:01] Avestruz_ConPrisa Cabra_Pedante has acertado 1 seguidas!! Puntos HOY: 221232, SEMANA: 221232 y MES: 221232 [05:01] Avestruz_ConPrisa
Cabra_Pedante has acertado 1 seguidas!! Puntos HOY: 221232, SEMANA: 221232 y MES: 221232
[05:01] EstrellaDeMar\Agil Albania [05:01] EstrellaDeMar\Agil
Albania
[05:01] Cabra_Pedante te ganeee ksksks [05:01] Cabra_Pedante
te ganeee ksksks
[05:01] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [05:01] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[05:01] Avestruz_ConPrisa Tri.3848 Mitologiaɭ˿CONpQUEpMATERIALpSEpHACEpUNpGOLEMp?p [05:01] Avestruz_ConPrisa
Tri.3848 Mitologiaɭ˿CONpQUEpMATERIALpSEpHACEpUNpGOLEMp?p
[05:01] Avestruz_ConPrisa 1 Pista: ***** Pregunta de BONUS : 200000 Puntos [05:01] Avestruz_ConPrisa
1 Pista: ***** Pregunta de BONUS : 200000 Puntos
[05:01] Cabra{Torpe EstrellaDeMar\Agil, Exxon :) [05:01] Cabra{Torpe
EstrellaDeMar\Agil, Exxon :)
[05:01] Cabra_Pedante piedra [05:01] Cabra_Pedante
piedra
[05:01] Cabra_Pedante roca [05:01] Cabra_Pedante
roca
[05:01] Cabra{Torpe yo ya no juego trivias EstrellaDeMar\Agil [05:01] Cabra{Torpe
yo ya no juego trivias EstrellaDeMar\Agil
[05:01] Avestruz_ConPrisa 2 Pista: bar** 30 segundos y 200000 Puntos [05:01] Avestruz_ConPrisa
2 Pista: bar** 30 segundos y 200000 Puntos
[05:01] Cabra_Pedante barro [05:01] Cabra_Pedante
barro
[05:01] Avestruz_ConPrisa �Enhorabuena Cabra_Pedante!! Has contestado "barro" y por ello has ganado �00000�12 puntos [05:01] Avestruz_ConPrisa
�Enhorabuena Cabra_Pedante!! Has contestado "barro" y por ello has ganado �00000�12 puntos
[05:01] Avestruz_ConPrisa ACTION awards Cabra_Pedante with a +v for having over 15000 points [05:01] Avestruz_ConPrisa
ACTION awards Cabra_Pedante with a +v for having over 15000 points
[05:01] Avestruz_ConPrisa Cabra_Pedante has acertado 2 seguidas!! Puntos HOY: 421232, SEMANA: 421232 y MES: 421232 [05:01] Avestruz_ConPrisa
Cabra_Pedante has acertado 2 seguidas!! Puntos HOY: 421232, SEMANA: 421232 y MES: 421232
[05:01] Avestruz_ConPrisa This MONTHS Top 11-20: - #11: Cabra_Pedante 200000 #12: EstrellaDeMar\Agil 182939 #13: ViajeroDeTiempo21 116913 #14: Botones 58004 #15: gonsi 38799 #16: LeCaTwaLk_z 23250 #17: solterita 22277 #18: Calvito_Klein 20510 #19: QuieroChat-0 13173 #20: Cosmo 7017 [05:01] Avestruz_ConPrisa
This MONTHS Top 11-20: - #11: Cabra_Pedante 200000 #12: EstrellaDeMar\Agil 182939 #13: ViajeroDeTiempo21 116913 #14: Botones 58004 #15: gonsi 38799 #16: LeCaTwaLk_z 23250 #17: solterita 22277 #18: Calvito_Klein 20510 #19: QuieroChat-0 13173 #20: Cosmo 7017
[05:01] Avestruz_ConPrisa Tri.10557 Eros-Sexɇallifan˿INSUFICIENCIAzDEzLAzFUNCIONzTESTICULAR?z?z [05:01] Avestruz_ConPrisa
Tri.10557 Eros-Sexɇallifan˿INSUFICIENCIAzDEzLAzFUNCIONzTESTICULAR?z?z
[05:01] Avestruz_ConPrisa 1 Pista: ************* Valor pregunta : 9255 Puntos [05:01] Avestruz_ConPrisa
1 Pista: ************* Valor pregunta : 9255 Puntos
[05:01] Cabra_Pedante xD [05:01] Cabra_Pedante
xD
[05:02] Avestruz_ConPrisa 2 Pista: hip********** 30 segundos y 9255 Puntos [05:02] Avestruz_ConPrisa
2 Pista: hip********** 30 segundos y 9255 Puntos
[05:02] Avestruz_ConPrisa 3 Pista: hipo*o*a*i**o 15 segundos y 9255 Puntos [05:02] Avestruz_ConPrisa
3 Pista: hipo*o*a*i**o 15 segundos y 9255 Puntos
[05:02] Avestruz_ConPrisa Tiempo! La respuesta es -> hipogonadismo <- [05:02] Avestruz_ConPrisa
Tiempo! La respuesta es -> hipogonadismo <-
[05:02] Avestruz_ConPrisa R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516 [05:02] Avestruz_ConPrisa
R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516
[05:02] Avestruz_ConPrisa Tri.5939 EconomiaɊarreando˿Cualnesoelncodigotdeontologicotparazlazrealizacionfdeoestudiosodeomercadotymopinionfconfmasorelevancia?g?g [05:02] Avestruz_ConPrisa
Tri.5939 EconomiaɊarreando˿Cualnesoelncodigotdeontologicotparazlazrealizacionfdeoestudiosodeomercadotymopinionfconfmasorelevancia?g?g
[05:02] Avestruz_ConPrisa 1 Pista: ****** ************* ***/****** Valor pregunta : 11184 Puntos [05:02] Avestruz_ConPrisa
1 Pista: ****** ************* ***/****** Valor pregunta : 11184 Puntos
[05:02] EstrellaDeMar\Agil Welcome3 y esa vaina [05:02] EstrellaDeMar\Agil
Welcome3 y esa vaina
[05:02] EstrellaDeMar\Agil Que paso [05:02] EstrellaDeMar\Agil
Que paso
[05:03] Avestruz_ConPrisa 2 Pista: cod*** ************* ***/****** 30 segundos y 11184 Puntos [05:03] Avestruz_ConPrisa
2 Pista: cod*** ************* ***/****** 30 segundos y 11184 Puntos
[05:03] Cabra{Torpe es que deje de entrar unos días [05:03] Cabra{Torpe
es que deje de entrar unos días
[05:03] Cabra{Torpe y perdi el ritmo [05:03] Cabra{Torpe
y perdi el ritmo
[05:03] EstrellaDeMar\Agil Ahh y ahora no sabes [05:03] EstrellaDeMar\Agil
Ahh y ahora no sabes
[05:03] Cabra{Torpe entonces ya no quise volver a jugar [05:03] Cabra{Torpe
entonces ya no quise volver a jugar
[05:03] Avestruz_ConPrisa 3 Pista: codi*o i**e**a*io*a* i**/e*o*a* 15 segundos y 11184 Puntos [05:03] Avestruz_ConPrisa
3 Pista: codi*o i**e**a*io*a* i**/e*o*a* 15 segundos y 11184 Puntos
[05:03] EstrellaDeMar\Agil Ya entiendo [05:03] EstrellaDeMar\Agil
Ya entiendo
[05:03] Cabra_Pedante :o [05:03] Cabra_Pedante
:o
[05:03] Cabra{Torpe si, olvidé todas las respuestas :) [05:03] Cabra{Torpe
si, olvidé todas las respuestas :)
[05:03] EstrellaDeMar\Agil Bueno deberias [05:03] EstrellaDeMar\Agil
Bueno deberias
[05:03] Avestruz_ConPrisa Tiempo! La respuesta es -> codigo�nternacional�cc/esomar <- [05:03] Avestruz_ConPrisa
Tiempo! La respuesta es -> codigo�nternacional�cc/esomar <-
[05:03] EstrellaDeMar\Agil Hace falta eso te concentra y no pides tanta soda [05:03] EstrellaDeMar\Agil
Hace falta eso te concentra y no pides tanta soda
[05:03] Cabra{Torpe a veces la mejor respuesta es solamente la vida :) [05:03] Cabra{Torpe
a veces la mejor respuesta es solamente la vida :)
[05:03] EstrellaDeMar\Agil Yeah [05:03] EstrellaDeMar\Agil
Yeah
[05:03] Avestruz_ConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [05:03] Avestruz_ConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[05:03] Avestruz_ConPrisa Tri.783 Deporteɬeoplus˿Cuantosmequiposmhanyganadoulauligaudehf�tbolcenyelcsiglouXX?j?j [05:03] Avestruz_ConPrisa
Tri.783 Deporteɬeoplus˿Cuantosmequiposmhanyganadoulauligaudehf�tbolcenyelcsiglouXX?j?j
[05:03] Avestruz_ConPrisa 1 Pista: * Valor pregunta : 9655 Puntos [05:03] Avestruz_ConPrisa
1 Pista: * Valor pregunta : 9655 Puntos
[05:03] Cabra{Torpe jajajaj te va dar diabetes de tanta soda [05:03] Cabra{Torpe
jajajaj te va dar diabetes de tanta soda
[05:03] Avestruz_ConPrisa 2 Pista: 9 30 segundos y 9655 Puntos [05:03] Avestruz_ConPrisa
2 Pista: 9 30 segundos y 9655 Puntos
[05:04] Libelula-ConPrisa 📻 Finalizando emisión. Vuelve el AutoDJ. [05:04] Libelula-ConPrisa
📻 Finalizando emisión. Vuelve el AutoDJ.
[05:04] Avestruz_ConPrisa 3 Pista: 9 15 segundos y 9655 Puntos [05:04] Avestruz_ConPrisa
3 Pista: 9 15 segundos y 9655 Puntos
[05:04] Cabra_Pedante :o [05:04] Cabra_Pedante
:o
[05:04] Cabra{Torpe voy a emitir , EstrellaDeMar\Agil [05:04] Cabra{Torpe
voy a emitir , EstrellaDeMar\Agil
[05:04] Libelula-ConPrisa 🎙️ ¡Iniciando emisión! DJ: EstrellaDeMar\Agil | 🎶 tEoDiOpErOTeAmO [05:04] Libelula-ConPrisa
🎙️ ¡Iniciando emisión! DJ: EstrellaDeMar\Agil | 🎶 tEoDiOpErOTeAmO
[05:04] Cabra{Torpe dame la clave [05:04] Cabra{Torpe
dame la clave
[05:04] Avestruz_ConPrisa Tiempo! La respuesta es -> 9 <- [05:04] Avestruz_ConPrisa
Tiempo! La respuesta es -> 9 <-
[05:04] Cabra_Pedante siii Sirena al fin :D [05:04] Cabra_Pedante
siii Sirena al fin :D
[05:04] Avestruz_ConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [05:04] Avestruz_ConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[05:04] Avestruz_ConPrisa Tri.10216 MitologiaɈdosO˿DIOSzGRIEGOzDEzLOSzINFIERNOSz?z [05:04] Avestruz_ConPrisa
Tri.10216 MitologiaɈdosO˿DIOSzGRIEGOzDEzLOSzINFIERNOSz?z
[05:04] Avestruz_ConPrisa 1 Pista: ***** Valor pregunta : 10629 Puntos [05:04] Avestruz_ConPrisa
1 Pista: ***** Valor pregunta : 10629 Puntos
[05:04] Cabra_Pedante Hades [05:04] Cabra_Pedante
Hades
[05:04] Avestruz_ConPrisa �Suma y sigue Cabra_Pedante!! La respuesta: "Hades" incrementa tu marcador en �0629�12 puntos [05:04] Avestruz_ConPrisa
�Suma y sigue Cabra_Pedante!! La respuesta: "Hades" incrementa tu marcador en �0629�12 puntos
[05:04] Avestruz_ConPrisa ACTION awards Cabra_Pedante with a +v for having over 15000 points [05:04] Avestruz_ConPrisa
ACTION awards Cabra_Pedante with a +v for having over 15000 points
[05:04] Avestruz_ConPrisa Cabra_Pedante has acertado 3 seguidas!! Puntos HOY: 431861, SEMANA: 431861 y MES: 431861 [05:04] Avestruz_ConPrisa
Cabra_Pedante has acertado 3 seguidas!! Puntos HOY: 431861, SEMANA: 431861 y MES: 431861
[05:04] Avestruz_ConPrisa R᮫ing SEMANA: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 556254 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: Cabra_Pedante 431861 #8: HETEROFLEXIBLE 339385 #9: KaZuMa_KiRyU 311343 #10: GaSpAriNa 263345 [05:04] Avestruz_ConPrisa
R᮫ing SEMANA: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 556254 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: Cabra_Pedante 431861 #8: HETEROFLEXIBLE 339385 #9: KaZuMa_KiRyU 311343 #10: GaSpAriNa 263345
[05:04] Avestruz_ConPrisa Tri.1004 InformaticaɐEDROC˿ENnQUEnESTUPIDASnEMPRESASnPUEDESnENCONTRARTEnCARGOSnTANnRIMBOMBANTESnCOMOn"VICEPRESIDENTEnSEGUNDOnDEnSOFTWARE"nOn"GERENTEnDEnBASESnDEnDATOS"n?n?n [05:04] Avestruz_ConPrisa
Tri.1004 InformaticaɐEDROC˿ENnQUEnESTUPIDASnEMPRESASnPUEDESnENCONTRARTEnCARGOSnTANnRIMBOMBANTESnCOMOn"VICEPRESIDENTEnSEGUNDOnDEnSOFTWARE"nOn"GERENTEnDEnBASESnDEnDATOS"n?n?n
[05:04] Avestruz_ConPrisa 1 Pista: *********** Valor pregunta : 22080 Puntos [05:04] Avestruz_ConPrisa
1 Pista: *********** Valor pregunta : 22080 Puntos
[05:04] EstrellaDeMar\Agil Welcome3 ajaja na mejor trivia chamo [05:04] EstrellaDeMar\Agil
Welcome3 ajaja na mejor trivia chamo
[05:05] Cabra{Torpe jajajaj nooooo [05:05] Cabra{Torpe
jajajaj nooooo
[05:05] EstrellaDeMar\Agil Ea cancion la cante yo [05:05] EstrellaDeMar\Agil
Ea cancion la cante yo
[05:05] Cabra{Torpe emitir y fiesta [05:05] Cabra{Torpe
emitir y fiesta
[05:05] EstrellaDeMar\Agil Ajaja [05:05] EstrellaDeMar\Agil
Ajaja
[05:05] Avestruz_ConPrisa 2 Pista: CON******** 30 segundos y 22080 Puntos [05:05] Avestruz_ConPrisa
2 Pista: CON******** 30 segundos y 22080 Puntos
[05:05] Cabra{Torpe mi emision se llamara Radio Soda!!!! [05:05] Cabra{Torpe
mi emision se llamara Radio Soda!!!!
[05:05] Cabra{Torpe el burbujeo de la musica [05:05] Cabra{Torpe
el burbujeo de la musica
[05:05] Avestruz_ConPrisa 3 Pista: CON*U**O*A* 15 segundos y 22080 Puntos [05:05] Avestruz_ConPrisa
3 Pista: CON*U**O*A* 15 segundos y 22080 Puntos
[05:05] EstrellaDeMar\Agil Wow [05:05] EstrellaDeMar\Agil
Wow
[05:05] Cabra_Pedante :o [05:05] Cabra_Pedante
:o
[05:05] Avestruz_ConPrisa Tiempo! La respuesta es -> CONSULTORAS <- [05:05] Avestruz_ConPrisa
Tiempo! La respuesta es -> CONSULTORAS <-
[05:05] Cabra{Torpe vas a cantar EstrellaDeMar\Agil ? [05:05] Cabra{Torpe
vas a cantar EstrellaDeMar\Agil ?
[05:05] Avestruz_ConPrisa We feature over 50,000 Q&A ! [05:05] Avestruz_ConPrisa
We feature over 50,000 Q&A !
[05:05] Avestruz_ConPrisa Tri.15613 Fisica-QuimicaɃort˿CU�tEStELtELEMENTOtQU͍ICOtM�tABUNDANTEt(ENtPESO)tENtELtCUERPOtHUMANOt?t [05:05] Avestruz_ConPrisa
Tri.15613 Fisica-QuimicaɃort˿CU�tEStELtELEMENTOtQU͍ICOtM�tABUNDANTEt(ENtPESO)tENtELtCUERPOtHUMANOt?t
[05:05] Avestruz_ConPrisa 1 Pista: ******* Valor pregunta : 13796 Puntos [05:05] Avestruz_ConPrisa
1 Pista: ******* Valor pregunta : 13796 Puntos
[05:05] EstrellaDeMar\Agil Estoy cantandooooooooooooooo [05:05] EstrellaDeMar\Agil
Estoy cantandooooooooooooooo
[05:05] Cabra_Pedante Carbono [05:05] Cabra_Pedante
Carbono
[05:06] Avestruz_ConPrisa 2 Pista: oxi**** 30 segundos y 13796 Puntos [05:06] Avestruz_ConPrisa
2 Pista: oxi**** 30 segundos y 13796 Puntos
[05:06] Cabra{Torpe oir la dulce voz de una EstrellaDeMar\Agil y no poder del arbol desacirse [05:06] Cabra{Torpe
oir la dulce voz de una EstrellaDeMar\Agil y no poder del arbol desacirse
[05:06] Avestruz_ConPrisa 3 Pista: oxi*e*o 15 segundos y 13796 Puntos [05:06] Avestruz_ConPrisa
3 Pista: oxi*e*o 15 segundos y 13796 Puntos
[05:06] Cabra{Torpe es lo que llaman en la vida infierno [05:06] Cabra{Torpe
es lo que llaman en la vida infierno
[05:06] EstrellaDeMar\Agil Oxigeno [05:06] EstrellaDeMar\Agil
Oxigeno
[05:06] Avestruz_ConPrisa �Increible!! EstrellaDeMar\Agil contest󺠃04"Oxigeno" en �4.578 segundos, y ha ganado �3796�12 puntos [05:06] Avestruz_ConPrisa
�Increible!! EstrellaDeMar\Agil contest󺠃04"Oxigeno" en �4.578 segundos, y ha ganado �3796�12 puntos
[05:06] Avestruz_ConPrisa EstrellaDeMar\Agil has acertado 1 seguidas!! Puntos HOY: 215795, SEMANA: 215795 y MES: 215795 [05:06] Avestruz_ConPrisa
EstrellaDeMar\Agil has acertado 1 seguidas!! Puntos HOY: 215795, SEMANA: 215795 y MES: 215795
[05:06] EstrellaDeMar\Agil Te hac falta oxigeno chamo [05:06] EstrellaDeMar\Agil
Te hac falta oxigeno chamo
[05:06] Cabra{Torpe ajajajajajaj [05:06] Cabra{Torpe
ajajajajajaj
[05:06] Avestruz_ConPrisa Tri.10305 MiscelaneaɔeLaRaNhA˿Alpmalpcocineroflevestorban...k?k [05:06] Avestruz_ConPrisa
Tri.10305 MiscelaneaɔeLaRaNhA˿Alpmalpcocineroflevestorban...k?k
[05:06] Avestruz_ConPrisa 1 Pista: ***** *** ******** Pregunta de BONUS : 25000 Puntos [05:06] Avestruz_ConPrisa
1 Pista: ***** *** ******** Pregunta de BONUS : 25000 Puntos
[05:06] Cabra{Torpe mas vas a dar? [05:06] Cabra{Torpe
mas vas a dar?
[05:06] EstrellaDeMar\Agil ACTION le pone el oxigeno a Cabra{Torpe [05:06] EstrellaDeMar\Agil
ACTION le pone el oxigeno a Cabra{Torpe
[05:06] Cabra{Torpe jajajajajjaa [05:06] Cabra{Torpe
jajajajajjaa
[05:06] Avestruz_ConPrisa 2 Pista: has** *** ******** 30 segundos y 25000 Puntos [05:06] Avestruz_ConPrisa
2 Pista: has** *** ******** 30 segundos y 25000 Puntos
[05:07] Cabra{Torpe respiracion de boca a boca chamiiiita [05:07] Cabra{Torpe
respiracion de boca a boca chamiiiita
[05:07] EstrellaDeMar\Agil Ya listo sientate y respira oxigena el cerebro por favor [05:07] EstrellaDeMar\Agil
Ya listo sientate y respira oxigena el cerebro por favor
[05:07] EstrellaDeMar\Agil No [05:07] EstrellaDeMar\Agil
No
[05:07] Avestruz_ConPrisa 3 Pista: has*a *a* *u**a*a* 15 segundos y 25000 Puntos [05:07] Avestruz_ConPrisa
3 Pista: has*a *a* *u**a*a* 15 segundos y 25000 Puntos
[05:07] EstrellaDeMar\Agil Jamas [05:07] EstrellaDeMar\Agil
Jamas
[05:07] Cabra{Torpe jajajaj [05:07] Cabra{Torpe
jajajaj
[05:07] Cabra{Torpe voy a probar hasta lo que desayunaste [05:07] Cabra{Torpe
voy a probar hasta lo que desayunaste
[05:07] EstrellaDeMar\Agil Wacala [05:07] EstrellaDeMar\Agil
Wacala
[05:07] Avestruz_ConPrisa Tiempo! La respuesta es -> hasta�as�ucharas <- [05:07] Avestruz_ConPrisa
Tiempo! La respuesta es -> hasta�as�ucharas <-
[05:07] Cabra{Torpe jajajajajajaja [05:07] Cabra{Torpe
jajajajajajaja
[05:07] EstrellaDeMar\Agil Basta [05:07] EstrellaDeMar\Agil
Basta
[05:07] Avestruz_ConPrisa Tri.6212 InformaticaɌucky_LuK˿COMOrSErLLAMArALrCIRCUITOrQUErTRANSFORMArUNArSERIErDErNUMEROr(DIGITOS)rENrUNArONDArDErCUALQUIERrTIPOr?r [05:07] Avestruz_ConPrisa
Tri.6212 InformaticaɌucky_LuK˿COMOrSErLLAMArALrCIRCUITOrQUErTRANSFORMArUNArSERIErDErNUMEROr(DIGITOS)rENrUNArONDArDErCUALQUIERrTIPOr?r
[05:07] Avestruz_ConPrisa 1 Pista: ********* ******* ********* Valor pregunta : 15474 Puntos [05:07] Avestruz_ConPrisa
1 Pista: ********* ******* ********* Valor pregunta : 15474 Puntos
[05:07] Cabra_Pedante Nawara  u.u [05:07] Cabra_Pedante
Nawara  u.u
[05:07] Avestruz_ConPrisa 2 Pista: con****** ******* ********* 30 segundos y 15474 Puntos [05:07] Avestruz_ConPrisa
2 Pista: con****** ******* ********* 30 segundos y 15474 Puntos
[05:07] Cabra{Torpe estas bien loquita , binomia :D [05:07] Cabra{Torpe
estas bien loquita , binomia :D
[05:08] EstrellaDeMar\Agil Jajaajaj [05:08] EstrellaDeMar\Agil
Jajaajaj
[05:08] EstrellaDeMar\Agil Juega chamo [05:08] EstrellaDeMar\Agil
Juega chamo
[05:08] Avestruz_ConPrisa 3 Pista: con*e**o* *i*i*a* a*a*o*i*o 15 segundos y 15474 Puntos [05:08] Avestruz_ConPrisa
3 Pista: con*e**o* *i*i*a* a*a*o*i*o 15 segundos y 15474 Puntos
[05:08] Cabra{Torpe ya no siento el imṕetu [05:08] Cabra{Torpe
ya no siento el imṕetu
[05:08] Avestruz_ConPrisa Tiempo! La respuesta es -> conversor�igital�nalogico <- [05:08] Avestruz_ConPrisa
Tiempo! La respuesta es -> conversor�igital�nalogico <-
[05:08] Cabra{Torpe me las sé todas [05:08] Cabra{Torpe
me las sé todas
[05:08] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [05:08] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[05:08] Avestruz_ConPrisa Tri.13267 Literaturaɇlaston˿Ciudadeimaginariakcreadakporcellescritorcespa񯬃01lAntonioqMu񯺃01mMolinak?m [05:08] Avestruz_ConPrisa
Tri.13267 Literaturaɇlaston˿Ciudadeimaginariakcreadakporcellescritorcespa񯬃01lAntonioqMu񯺃01mMolinak?m
[05:08] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 21580 Puntos [05:08] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 21580 Puntos
[05:08] EstrellaDeMar\Agil Intenta dale soy tu fans en trivia [05:08] EstrellaDeMar\Agil
Intenta dale soy tu fans en trivia
[05:08] EstrellaDeMar\Agil No creo [05:08] EstrellaDeMar\Agil
No creo
[05:08] Avestruz_ConPrisa 2 Pista: mag*** 30 segundos y 21580 Puntos [05:08] Avestruz_ConPrisa
2 Pista: mag*** 30 segundos y 21580 Puntos
[05:08] Cabra{Torpe ademas si no juega mi founder fosforita no tiene sentido la vida [05:08] Cabra{Torpe
ademas si no juega mi founder fosforita no tiene sentido la vida
[05:09] Avestruz_ConPrisa 3 Pista: magi*a 15 segundos y 21580 Puntos [05:09] Avestruz_ConPrisa
3 Pista: magi*a 15 segundos y 21580 Puntos
[05:09] Avestruz_ConPrisa Tiempo! La respuesta es -> magina <- [05:09] Avestruz_ConPrisa
Tiempo! La respuesta es -> magina <-
[05:09] Cabra{Torpe ojala emitirera renault [05:09] Cabra{Torpe
ojala emitirera renault
[05:09] Avestruz_ConPrisa R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898 [05:09] Avestruz_ConPrisa
R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898
[05:09] Avestruz_ConPrisa Tri.7474 MiscelaneaɔeLaRaNhA˿Elcquevablabtiendabvabysvienev?z [05:09] Avestruz_ConPrisa
Tri.7474 MiscelaneaɔeLaRaNhA˿Elcquevablabtiendabvabysvienev?z
[05:09] Avestruz_ConPrisa 1 Pista: *** ***** ******** Valor pregunta : 21414 Puntos [05:09] Avestruz_ConPrisa
1 Pista: *** ***** ******** Valor pregunta : 21414 Puntos
[05:09] Cabra{Torpe entonces si seria una radio fantasma [05:09] Cabra{Torpe
entonces si seria una radio fantasma
[05:09] EstrellaDeMar\Agil ^^ [05:09] EstrellaDeMar\Agil
^^
[05:09] Avestruz_ConPrisa 2 Pista: dos ***** ******** 30 segundos y 21414 Puntos [05:09] Avestruz_ConPrisa
2 Pista: dos ***** ******** 30 segundos y 21414 Puntos
[05:09] Cabra{Torpe !tema [05:09] Cabra{Torpe
!tema
[05:09] Libelula-ConPrisa ♪ Sonando: Bruno Mars - Just the Way You Are - DjSinContenido_ [05:09] Libelula-ConPrisa
♪ Sonando: Bruno Mars - Just the Way You Are - DjSinContenido_
[05:09] Cabra{Torpe tuuuu cancion , EstrellaDeMar\Agil [05:09] Cabra{Torpe
tuuuu cancion , EstrellaDeMar\Agil
[05:09] Avestruz_ConPrisa 3 Pista: dos *o*a* *a**ie*e 15 segundos y 21414 Puntos [05:09] Avestruz_ConPrisa
3 Pista: dos *o*a* *a**ie*e 15 segundos y 21414 Puntos
[05:10] Avestruz_ConPrisa Tiempo! La respuesta es -> dos�osas�antiene <- [05:10] Avestruz_ConPrisa
Tiempo! La respuesta es -> dos�osas�antiene <-
[05:10] Avestruz_ConPrisa If you think a Q&A is wrong, please call an OP [05:10] Avestruz_ConPrisa
If you think a Q&A is wrong, please call an OP
[05:10] Avestruz_ConPrisa Tri.7003 Miscelaneaɓebosin˿C󭯃01vsezllamahelwlugarudezlahcasahdondezsezguardanbloswcomestibles?c?c [05:10] Avestruz_ConPrisa
Tri.7003 Miscelaneaɓebosin˿C󭯃01vsezllamahelwlugarudezlahcasahdondezsezguardanbloswcomestibles?c?c
[05:10] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 11196 Puntos [05:10] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 11196 Puntos
[05:10] Cabra_Pedante Alacena [05:10] Cabra_Pedante
Alacena
[05:10] Avestruz_ConPrisa 2 Pista: des***** 30 segundos y 11196 Puntos [05:10] Avestruz_ConPrisa
2 Pista: des***** 30 segundos y 11196 Puntos
[05:10] Avestruz_ConPrisa 3 Pista: des*e**a 15 segundos y 11196 Puntos [05:10] Avestruz_ConPrisa
3 Pista: des*e**a 15 segundos y 11196 Puntos
[05:10] Cabra_Pedante holaa Sirenitaaa [05:10] Cabra_Pedante
holaa Sirenitaaa
[05:11] Avestruz_ConPrisa Tiempo! La respuesta es -> despensa <- [05:11] Avestruz_ConPrisa
Tiempo! La respuesta es -> despensa <-
[05:11] Avestruz_ConPrisa R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226 [05:11] Avestruz_ConPrisa
R᮫ing por D́: - Domingo: Danielitto 3057578 Lunes: Gallina\Elocuente 1099384 Martes: Gallina\Elocuente 3056297 Miercoles: Oveja{ConPrisa 3064406 Jueves: Danielitto 2128886 Viernes: Oveja{ConPrisa 1238591 Sᢡdo: Gallina\Elocuente 1635226
[05:11] Avestruz_ConPrisa Tri.9869 Geografiaɓebosin˿CUALrSOBRA?(PISTA:rTodosbsonkdesiertosbafricanosbexceptolunolquexesbasiᴩco)rNubia,rSahara,rLibia,rKalahari,rGobi?r?r [05:11] Avestruz_ConPrisa
Tri.9869 Geografiaɓebosin˿CUALrSOBRA?(PISTA:rTodosbsonkdesiertosbafricanosbexceptolunolquexesbasiᴩco)rNubia,rSahara,rLibia,rKalahari,rGobi?r?r
[05:11] Avestruz_ConPrisa 1 Pista: **** Pregunta de BONUS : 50000 Puntos [05:11] Avestruz_ConPrisa
1 Pista: **** Pregunta de BONUS : 50000 Puntos
[05:11] Avestruz_ConPrisa 2 Pista: gob* 30 segundos y 50000 Puntos [05:11] Avestruz_ConPrisa
2 Pista: gob* 30 segundos y 50000 Puntos
[05:11] Avestruz_ConPrisa 3 Pista: gobi 15 segundos y 50000 Puntos [05:11] Avestruz_ConPrisa
3 Pista: gobi 15 segundos y 50000 Puntos
[05:12] Avestruz_ConPrisa Tiempo! La respuesta es -> gobi <- [05:12] Avestruz_ConPrisa
Tiempo! La respuesta es -> gobi <-
[05:12] Avestruz_ConPrisa For The Competitive Edge type !pingme [05:12] Avestruz_ConPrisa
For The Competitive Edge type !pingme
[05:12] Avestruz_ConPrisa Tri.12840 GeografiaɍARdeJAVA˿ENxQUɃ01xREGIӎxITALIANAxPODEMOSxVISITARxLAxCIUDADxDExCREMONA?x?x [05:12] Avestruz_ConPrisa
Tri.12840 GeografiaɍARdeJAVA˿ENxQUɃ01xREGIӎxITALIANAxPODEMOSxVISITARxLAxCIUDADxDExCREMONA?x?x
[05:12] Avestruz_ConPrisa 1 Pista: ********* Valor pregunta : 24973 Puntos [05:12] Avestruz_ConPrisa
1 Pista: ********* Valor pregunta : 24973 Puntos
[05:12] Avestruz_ConPrisa 2 Pista: lom****** 30 segundos y 24973 Puntos [05:12] Avestruz_ConPrisa
2 Pista: lom****** 30 segundos y 24973 Puntos
[05:12] Avestruz_ConPrisa 3 Pista: lom*a**ia 15 segundos y 24973 Puntos [05:12] Avestruz_ConPrisa
3 Pista: lom*a**ia 15 segundos y 24973 Puntos
[05:12] Avestruz_ConPrisa Tiempo! La respuesta es -> lombardia <- [05:12] Avestruz_ConPrisa
Tiempo! La respuesta es -> lombardia <-
[05:13] Avestruz_ConPrisa Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [05:13] Avestruz_ConPrisa
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[05:13] Avestruz_ConPrisa Tri.15845 PoliticaɊAVEA˿19rDErMAYOrDEr2000:rENrQUErPAISrFRACASArELrGOLPErDErESTADOrDELrGENERALrLINOrOVIEDOr?r [05:13] Avestruz_ConPrisa
Tri.15845 PoliticaɊAVEA˿19rDErMAYOrDEr2000:rENrQUErPAISrFRACASArELrGOLPErDErESTADOrDELrGENERALrLINOrOVIEDOr?r
[05:13] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 14516 Puntos [05:13] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 14516 Puntos
[05:13] Avestruz_ConPrisa 2 Pista: par***** 30 segundos y 14516 Puntos [05:13] Avestruz_ConPrisa
2 Pista: par***** 30 segundos y 14516 Puntos
[05:13] Avestruz_ConPrisa 3 Pista: para*ua* 15 segundos y 14516 Puntos [05:13] Avestruz_ConPrisa
3 Pista: para*ua* 15 segundos y 14516 Puntos
[05:13] Avestruz_ConPrisa Tiempo! La respuesta es -> paraguay <- [05:13] Avestruz_ConPrisa
Tiempo! La respuesta es -> paraguay <-
[05:14] Avestruz_ConPrisa R᮫ing MES: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 556254 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: Cabra_Pedante 431861 #8: HETEROFLEXIBLE 339385 #9: KaZuMa_KiRyU 311343 #10: GaSpAriNa 263345 [05:14] Avestruz_ConPrisa
R᮫ing MES: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 556254 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: Cabra_Pedante 431861 #8: HETEROFLEXIBLE 339385 #9: KaZuMa_KiRyU 311343 #10: GaSpAriNa 263345
[05:14] Avestruz_ConPrisa Tri.3761 Historiaɳubmarin˿C󭯃01msebllam󃰱geli�ltimomreyqbabilonio?g?g [05:14] Avestruz_ConPrisa
Tri.3761 Historiaɳubmarin˿C󭯃01msebllam󃰱geli�ltimomreyqbabilonio?g?g
[05:14] Avestruz_ConPrisa 1 Pista: ******** Valor pregunta : 19575 Puntos [05:14] Avestruz_ConPrisa
1 Pista: ******** Valor pregunta : 19575 Puntos
[05:14] Avestruz_ConPrisa 2 Pista: bal***** 30 segundos y 19575 Puntos [05:14] Avestruz_ConPrisa
2 Pista: bal***** 30 segundos y 19575 Puntos
[05:14] Avestruz_ConPrisa 3 Pista: bal*a*a* 15 segundos y 19575 Puntos [05:14] Avestruz_ConPrisa
3 Pista: bal*a*a* 15 segundos y 19575 Puntos
[05:14] Avestruz_ConPrisa Tiempo! La respuesta es -> baltasar <- [05:14] Avestruz_ConPrisa
Tiempo! La respuesta es -> baltasar <-
[05:15] Avestruz_ConPrisa Please refrain from using Extreme Bad Language [05:15] Avestruz_ConPrisa
Please refrain from using Extreme Bad Language
[05:15] Avestruz_ConPrisa Tri.276 PersonajesɈdosO˿Enmqueea񯃰1tmuriotNietzschee?y [05:15] Avestruz_ConPrisa
Tri.276 PersonajesɈdosO˿Enmqueea񯃰1tmuriotNietzschee?y
[05:15] Avestruz_ConPrisa 1 Pista: **** Valor pregunta : 20085 Puntos [05:15] Avestruz_ConPrisa
1 Pista: **** Valor pregunta : 20085 Puntos
[05:15] Avestruz_ConPrisa 2 Pista: 190* 30 segundos y 20085 Puntos [05:15] Avestruz_ConPrisa
2 Pista: 190* 30 segundos y 20085 Puntos
[05:15] Avestruz_ConPrisa 3 Pista: 190* 15 segundos y 20085 Puntos [05:15] Avestruz_ConPrisa
3 Pista: 190* 15 segundos y 20085 Puntos
[05:15] Avestruz_ConPrisa Tiempo! La respuesta es -> 1900 <- [05:15] Avestruz_ConPrisa
Tiempo! La respuesta es -> 1900 <-
[05:15] Avestruz_ConPrisa This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa [05:15] Avestruz_ConPrisa
This is #Mexico, I am your host Avestruz_ConPrisa, running Avestruz_ConPrisa
[05:15] Avestruz_ConPrisa Tri.10134 Informaticaɥlijah^^˿CU�ESsSONsLASsSIGLASsENsINGLɓsDELsINTERFACEsGR�ICOsDEsWINDOWSs?s [05:15] Avestruz_ConPrisa
Tri.10134 Informaticaɥlijah^^˿CU�ESsSONsLASsSIGLASsENsINGLɓsDELsINTERFACEsGR�ICOsDEsWINDOWSs?s
[05:15] Avestruz_ConPrisa 1 Pista: *** Valor pregunta : 22778 Puntos [05:15] Avestruz_ConPrisa
1 Pista: *** Valor pregunta : 22778 Puntos
[05:16] Avestruz_ConPrisa 2 Pista: gui 30 segundos y 22778 Puntos [05:16] Avestruz_ConPrisa
2 Pista: gui 30 segundos y 22778 Puntos
[05:16] Avestruz_ConPrisa 3 Pista: gui 15 segundos y 22778 Puntos [05:16] Avestruz_ConPrisa
3 Pista: gui 15 segundos y 22778 Puntos
[05:16] Avestruz_ConPrisa Tiempo! La respuesta es -> gui <- [05:16] Avestruz_ConPrisa
Tiempo! La respuesta es -> gui <-
[05:16] Libelula-ConPrisa DJ "EstrellaDeMar\Agil" abre peticiones [05:16] Libelula-ConPrisa
DJ "EstrellaDeMar\Agil" abre peticiones
[05:16] Avestruz_ConPrisa This WEEKS Top 11-20: - #11: siva- 221506 #12: EstrellaDeMar\Agil 215795 #13: ViajeroDeTiempo21 116913 #14: Botones 58004 #15: gonsi 38799 #16: LeCaTwaLk_z 23250 #17: solterita 22277 #18: Calvito_Klein 20510 #19: QuieroChat-0 13173 #20: Cosmo 7017 [05:16] Avestruz_ConPrisa
This WEEKS Top 11-20: - #11: siva- 221506 #12: EstrellaDeMar\Agil 215795 #13: ViajeroDeTiempo21 116913 #14: Botones 58004 #15: gonsi 38799 #16: LeCaTwaLk_z 23250 #17: solterita 22277 #18: Calvito_Klein 20510 #19: QuieroChat-0 13173 #20: Cosmo 7017
[05:16] Avestruz_ConPrisa Tri.3381 InformaticaɃhArLiEs˿CuandoddefinesdunxpunterodenxC++kquewdebesdponerxdelantewdelmnombrewdewlalvariablew?k [05:16] Avestruz_ConPrisa
Tri.3381 InformaticaɃhArLiEs˿CuandoddefinesdunxpunterodenxC++kquewdebesdponerxdelantewdelmnombrewdewlalvariablew?k
[05:16] Avestruz_ConPrisa 1 Pista: ********* Valor pregunta : 9330 Puntos [05:16] Avestruz_ConPrisa
1 Pista: ********* Valor pregunta : 9330 Puntos
[05:17] Avestruz_ConPrisa 2 Pista: ast****** 30 segundos y 9330 Puntos [05:17] Avestruz_ConPrisa
2 Pista: ast****** 30 segundos y 9330 Puntos
[05:17] Avestruz_ConPrisa 3 Pista: aste*i**o 15 segundos y 9330 Puntos [05:17] Avestruz_ConPrisa
3 Pista: aste*i**o 15 segundos y 9330 Puntos
[05:17] Avestruz_ConPrisa Tiempo! La respuesta es -> asterisco <- [05:17] Avestruz_ConPrisa
Tiempo! La respuesta es -> asterisco <-
[05:17] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [05:17] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[05:17] Avestruz_ConPrisa Tri.7012 CineɁcuarios˿ENdQUEdPELICULAdUNdCHAVALdPUEDEdVERdVISIONESdSOBREdLAdMUERTEd?d [05:17] Avestruz_ConPrisa
Tri.7012 CineɁcuarios˿ENdQUEdPELICULAdUNdCHAVALdPUEDEdVERdVISIONESdSOBREdLAdMUERTEd?d
[05:17] Avestruz_ConPrisa 1 Pista: ******* ***** Valor pregunta : 12026 Puntos [05:17] Avestruz_ConPrisa
1 Pista: ******* ***** Valor pregunta : 12026 Puntos
[05:18] Avestruz_ConPrisa 2 Pista: des**** ***** 30 segundos y 12026 Puntos [05:18] Avestruz_ConPrisa
2 Pista: des**** ***** 30 segundos y 12026 Puntos
[05:18] Avestruz_ConPrisa 3 Pista: des*i*o *i*a* 15 segundos y 12026 Puntos [05:18] Avestruz_ConPrisa
3 Pista: des*i*o *i*a* 15 segundos y 12026 Puntos
[05:18] Avestruz_ConPrisa Tiempo! La respuesta es -> destino�inal <- [05:18] Avestruz_ConPrisa
Tiempo! La respuesta es -> destino�inal <-
[05:18] Avestruz_ConPrisa This MONTHS Top 11-20: - #11: siva- 221506 #12: EstrellaDeMar\Agil 215795 #13: ViajeroDeTiempo21 116913 #14: Botones 58004 #15: gonsi 38799 #16: LeCaTwaLk_z 23250 #17: solterita 22277 #18: Calvito_Klein 20510 #19: QuieroChat-0 13173 #20: Cosmo 7017 [05:18] Avestruz_ConPrisa
This MONTHS Top 11-20: - #11: siva- 221506 #12: EstrellaDeMar\Agil 215795 #13: ViajeroDeTiempo21 116913 #14: Botones 58004 #15: gonsi 38799 #16: LeCaTwaLk_z 23250 #17: solterita 22277 #18: Calvito_Klein 20510 #19: QuieroChat-0 13173 #20: Cosmo 7017
[05:18] Avestruz_ConPrisa Tri.13114 ArteɓHeLeNe˿AnQUeuREINADOnFRANCeSnCORRESPONDEnELnDESARROLLOnDELnROCOCOn?n [05:18] Avestruz_ConPrisa
Tri.13114 ArteɓHeLeNe˿AnQUeuREINADOnFRANCeSnCORRESPONDEnELnDESARROLLOnDELnROCOCOn?n
[05:18] Avestruz_ConPrisa 1 Pista: **** ** Valor pregunta : 10525 Puntos [05:18] Avestruz_ConPrisa
1 Pista: **** ** Valor pregunta : 10525 Puntos
[05:18] Avestruz_ConPrisa 2 Pista: lui* ** 30 segundos y 10525 Puntos [05:18] Avestruz_ConPrisa
2 Pista: lui* ** 30 segundos y 10525 Puntos
[05:19] Avestruz_ConPrisa 3 Pista: lui* ** 15 segundos y 10525 Puntos [05:19] Avestruz_ConPrisa
3 Pista: lui* ** 15 segundos y 10525 Puntos
[05:19] Avestruz_ConPrisa Tiempo! La respuesta es -> luis�v <- [05:19] Avestruz_ConPrisa
Tiempo! La respuesta es -> luis�v <-
[05:19] Avestruz_ConPrisa R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516 [05:19] Avestruz_ConPrisa
R᮫ing �ltima SEMANA: #1: Oveja{ConPrisa 10195486 #2: Gallina\Elocuente 5939773 #3: Danielitto 2670516
[05:19] Avestruz_ConPrisa Tri.7886 Arteɬusie˿Cuᬃ01jesneljg鮥rogmusicaljquewnaci󃰱oconreljestrenogdewPanryetorosndeljmaestrogBarbieri?o?o [05:19] Avestruz_ConPrisa
Tri.7886 Arteɬusie˿Cuᬃ01jesneljg鮥rogmusicaljquewnaci󃰱oconreljestrenogdewPanryetorosndeljmaestrogBarbieri?o?o
[05:19] Avestruz_ConPrisa 1 Pista: ** ****** ***** Valor pregunta : 10738 Puntos [05:19] Avestruz_ConPrisa
1 Pista: ** ****** ***** Valor pregunta : 10738 Puntos
[05:19] Avestruz_ConPrisa 2 Pista: el�***** ***** 30 segundos y 10738 Puntos [05:19] Avestruz_ConPrisa
2 Pista: el�***** ***** 30 segundos y 10738 Puntos
[05:20] Avestruz_ConPrisa 3 Pista: el�e*e*o **i*o 15 segundos y 10738 Puntos [05:20] Avestruz_ConPrisa
3 Pista: el�e*e*o **i*o 15 segundos y 10738 Puntos
[05:20] Avestruz_ConPrisa Tiempo! La respuesta es -> el�enero�hico <- [05:20] Avestruz_ConPrisa
Tiempo! La respuesta es -> el�enero�hico <-
[05:20] Avestruz_ConPrisa Top10 Players ( Weekly & Monthly ) are Auto-Voiced [05:20] Avestruz_ConPrisa
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[05:20] Avestruz_ConPrisa Tri.20064 MiscelaneaɅME^˿ADEMASzDEzUNzARTEFACTOzEXPLOSIVO...߃01zQUEzESzBOMBAz?z [05:20] Avestruz_ConPrisa
Tri.20064 MiscelaneaɅME^˿ADEMASzDEzUNzARTEFACTOzEXPLOSIVO...߃01zQUEzESzBOMBAz?z
[05:20] Avestruz_ConPrisa 1 Pista: *** **** ** ****** Valor pregunta : 23153 Puntos [05:20] Avestruz_ConPrisa
1 Pista: *** **** ** ****** Valor pregunta : 23153 Puntos
[05:20] Avestruz_ConPrisa 2 Pista: una **** ** ****** 30 segundos y 23153 Puntos [05:20] Avestruz_ConPrisa
2 Pista: una **** ** ****** 30 segundos y 23153 Puntos
[05:21] Avestruz_ConPrisa 3 Pista: una i**a *e a**i*a 15 segundos y 23153 Puntos [05:21] Avestruz_ConPrisa
3 Pista: una i**a *e a**i*a 15 segundos y 23153 Puntos
[05:21] Avestruz_ConPrisa Tiempo! La respuesta es -> una�sla�e�frica <- [05:21] Avestruz_ConPrisa
Tiempo! La respuesta es -> una�sla�e�frica <-
[05:21] Avestruz_ConPrisa Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [05:21] Avestruz_ConPrisa
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[05:21] Avestruz_ConPrisa Tri.9273 GeografiaɍARdeJAVA˿CU�qESqELqPAISqM�qEXTENSOqDEqEUROPAqOCCIDENTAL,qCONq543.965qKMҿq?q [05:21] Avestruz_ConPrisa
Tri.9273 GeografiaɍARdeJAVA˿CU�qESqELqPAISqM�qEXTENSOqDEqEUROPAqOCCIDENTAL,qCONq543.965qKMҿq?q
[05:21] Avestruz_ConPrisa 1 Pista: ******* Valor pregunta : 19068 Puntos [05:21] Avestruz_ConPrisa
1 Pista: ******* Valor pregunta : 19068 Puntos
[05:21] Avestruz_ConPrisa 2 Pista: fra**** 30 segundos y 19068 Puntos [05:21] Avestruz_ConPrisa
2 Pista: fra**** 30 segundos y 19068 Puntos
[05:21] Avestruz_ConPrisa 3 Pista: fra**ia 15 segundos y 19068 Puntos [05:21] Avestruz_ConPrisa
3 Pista: fra**ia 15 segundos y 19068 Puntos
[05:22] Avestruz_ConPrisa Tiempo! La respuesta es -> francia <- [05:22] Avestruz_ConPrisa
Tiempo! La respuesta es -> francia <-
[05:22] Avestruz_ConPrisa R᮫ing SEMANA: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 556254 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: Cabra_Pedante 431861 #8: HETEROFLEXIBLE 339385 #9: KaZuMa_KiRyU 311343 #10: GaSpAriNa 263345 [05:22] Avestruz_ConPrisa
R᮫ing SEMANA: - #1: Gallina\Elocuente 6962534 #2: Danielitto 4093466 #3: Oveja{ConPrisa 2380897 #4: Ketzy 556254 #5: Caracol_ConBravura 523835 #6: Alii 491671 #7: Cabra_Pedante 431861 #8: HETEROFLEXIBLE 339385 #9: KaZuMa_KiRyU 311343 #10: GaSpAriNa 263345
[05:22] Avestruz_ConPrisa Tri.14723 Arteɏrigenes˿AbQUeaDINAST́bDEBEMOSbLAbALHAMBRAb?b [05:22] Avestruz_ConPrisa
Tri.14723 Arteɏrigenes˿AbQUeaDINAST́bDEBEMOSbLAbALHAMBRAb?b
[05:22] Avestruz_ConPrisa 1 Pista: ****** Valor pregunta : 24505 Puntos [05:22] Avestruz_ConPrisa
1 Pista: ****** Valor pregunta : 24505 Puntos
[05:22] Avestruz_ConPrisa 2 Pista: naz*** 30 segundos y 24505 Puntos [05:22] Avestruz_ConPrisa
2 Pista: naz*** 30 segundos y 24505 Puntos
[05:22] Avestruz_ConPrisa 3 Pista: naza*i 15 segundos y 24505 Puntos [05:22] Avestruz_ConPrisa
3 Pista: naza*i 15 segundos y 24505 Puntos
[05:23] Avestruz_ConPrisa Tiempo! La respuesta es -> nazari <- [05:23] Avestruz_ConPrisa
Tiempo! La respuesta es -> nazari <-
[05:23] Avestruz_ConPrisa We feature over 50,000 Q&A ! [05:23] Avestruz_ConPrisa
We feature over 50,000 Q&A !
[05:23] Avestruz_ConPrisa Tri.13058 Cancionesɂruce˿AfquejdiscokdejBrucejSpringsteenoperteneciaslascanciono"BetteroDays"f?f [05:23] Avestruz_ConPrisa
Tri.13058 Cancionesɂruce˿AfquejdiscokdejBrucejSpringsteenoperteneciaslascanciono"BetteroDays"f?f
[05:23] Avestruz_ConPrisa 1 Pista: ***** **** Pregunta de BONUS : 25000 Puntos [05:23] Avestruz_ConPrisa
1 Pista: ***** **** Pregunta de BONUS : 25000 Puntos
[05:23] Avestruz_ConPrisa 2 Pista: luc** **** 30 segundos y 25000 Puntos [05:23] Avestruz_ConPrisa
2 Pista: luc** **** 30 segundos y 25000 Puntos
[05:23] Avestruz_ConPrisa 3 Pista: luc** *o** 15 segundos y 25000 Puntos [05:23] Avestruz_ConPrisa
3 Pista: luc** *o** 15 segundos y 25000 Puntos
[05:24] Avestruz_ConPrisa Tiempo! La respuesta es -> lucky�own <- [05:24] Avestruz_ConPrisa
Tiempo! La respuesta es -> lucky�own <-
[05:24] Avestruz_ConPrisa Tri.13675 DeporteɂOOM˿COMOoSEoDENOMINAoELoPABELLONoDELoUNICAJAoMALAGAoDEoBALONCESTOo?o [05:24] Avestruz_ConPrisa
Tri.13675 DeporteɂOOM˿COMOoSEoDENOMINAoELoPABELLONoDELoUNICAJAoMALAGAoDEoBALONCESTOo?o
[05:24] Avestruz_ConPrisa 1 Pista: ****** ******* Valor pregunta : 7785 Puntos [05:24] Avestruz_ConPrisa
1 Pista: ****** ******* Valor pregunta : 7785 Puntos
[05:24] Avestruz_ConPrisa 2 Pista: mar*** ******* 30 segundos y 7785 Puntos [05:24] Avestruz_ConPrisa
2 Pista: mar*** ******* 30 segundos y 7785 Puntos
[05:24] Avestruz_ConPrisa 3 Pista: mar*i* *a**e*a 15 segundos y 7785 Puntos [05:24] Avestruz_ConPrisa
3 Pista: mar*i* *a**e*a 15 segundos y 7785 Puntos
[05:25] Avestruz_ConPrisa Tiempo! La respuesta es -> martin�arpena <- [05:25] Avestruz_ConPrisa
Tiempo! La respuesta es -> martin�arpena <-
[05:25] Avestruz_ConPrisa Tri.17798 CineɉRC-Domain.org˿ComoasedllamabarelpcomicvquedescribiarJoeyrLaurendAdamsbend"PersiguiendoaarAmy"v?v [05:25] Avestruz_ConPrisa
Tri.17798 CineɉRC-Domain.org˿ComoasedllamabarelpcomicvquedescribiarJoeyrLaurendAdamsbend"PersiguiendoaarAmy"v?v
[05:25] Avestruz_ConPrisa 1 Pista: ****** ************** Valor pregunta : 16664 Puntos [05:25] Avestruz_ConPrisa
1 Pista: ****** ************** Valor pregunta : 16664 Puntos
[05:25] Avestruz_ConPrisa 2 Pista: rut*** ************** 30 segundos y 16664 Puntos [05:25] Avestruz_ConPrisa
2 Pista: rut*** ************** 30 segundos y 16664 Puntos
[05:25] Avestruz_ConPrisa 3 Pista: ruti*a i*io*i***a*i*a 15 segundos y 16664 Puntos [05:25] Avestruz_ConPrisa
3 Pista: ruti*a i*io*i***a*i*a 15 segundos y 16664 Puntos
[05:25] Avestruz_ConPrisa Tiempo! La respuesta es -> rutina�diosincrasica <- [05:25] Avestruz_ConPrisa
Tiempo! La respuesta es -> rutina�diosincrasica <-
[05:26] Avestruz_ConPrisa Please remember this is a FREE service, Please do not complain [05:26] Avestruz_ConPrisa
Please remember this is a FREE service, Please do not complain
[05:26] Avestruz_ConPrisa Tri.15546 Fisica-QuimicaɔeLaRaNhA˅lectr󮩣a:nߕnwcircuitozquesgeneraaunaase񡬃01malternaaaapartirmdesunaase񡬃01mcontinuaaesvun...n?n [05:26] Avestruz_ConPrisa
Tri.15546 Fisica-QuimicaɔeLaRaNhA˅lectr󮩣a:nߕnwcircuitozquesgeneraaunaase񡬃01malternaaaapartirmdesunaase񡬃01mcontinuaaesvun...n?n
[05:26] Avestruz_ConPrisa 1 Pista: ********* Valor pregunta : 16421 Puntos [05:26] Avestruz_ConPrisa
1 Pista: ********* Valor pregunta : 16421 Puntos
[05:26] Avestruz_ConPrisa 2 Pista: osc****** 30 segundos y 16421 Puntos [05:26] Avestruz_ConPrisa
2 Pista: osc****** 30 segundos y 16421 Puntos
[05:26] Avestruz_ConPrisa 3 Pista: osci*a*o* 15 segundos y 16421 Puntos [05:26] Avestruz_ConPrisa
3 Pista: osci*a*o* 15 segundos y 16421 Puntos
[05:26] Avestruz_ConPrisa Tiempo! La respuesta es -> oscilador <- [05:26] Avestruz_ConPrisa
Tiempo! La respuesta es -> oscilador <-
[05:27] Avestruz_ConPrisa R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898 [05:27] Avestruz_ConPrisa
R᮫ing �ltimo MES: #1: Oveja{ConPrisa 30671411 #2: Cabra{Torpe 23569079 #3: Gallina\Elocuente 16976126 #4: Danielitto 14420182 #5: Karen 13500898
[05:27] Avestruz_ConPrisa Tri.19645 Biologiaɍonteso˿Cualiesselimayorereptili?i [05:27] Avestruz_ConPrisa
Tri.19645 Biologiaɍonteso˿Cualiesselimayorereptili?i
[05:27] Avestruz_ConPrisa 1 Pista: ******* **** Valor pregunta : 13905 Puntos [05:27] Avestruz_ConPrisa
1 Pista: ******* **** Valor pregunta : 13905 Puntos
[05:27] Avestruz_ConPrisa 2 Pista: tor**** **** 30 segundos y 13905 Puntos [05:27] Avestruz_ConPrisa
2 Pista: tor**** **** 30 segundos y 13905 Puntos
[05:27] Avestruz_ConPrisa 3 Pista: tor*u*a *au* 15 segundos y 13905 Puntos [05:27] Avestruz_ConPrisa
3 Pista: tor*u*a *au* 15 segundos y 13905 Puntos
[05:27] Avestruz_ConPrisa Tiempo! La respuesta es -> tortuga�aud <- [05:27] Avestruz_ConPrisa
Tiempo! La respuesta es -> tortuga�aud <-
[05:27] Avestruz_ConPrisa Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar [05:27] Avestruz_ConPrisa
Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar
| Compartir en: