Story from #mexico 10/01/2026 20:46 27 views

Hour Nick Message Message
[20:46] Cocodrilo\ConBravura Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas [20:46] Cocodrilo\ConBravura
Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas
[20:46] Flamenco-Real !jugar [20:46] Flamenco-Real
!jugar
[20:46] Buho-Transparente EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!! [20:46] Buho-Transparente
EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!!
[20:46] Buho-Transparente R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [20:46] Buho-Transparente
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[20:46] Buho-Transparente Tri.16183 Mitologiaɫissu˿ElgcazadoryActeonxfueedevoradoaporysusnpropios...b?b [20:46] Buho-Transparente
Tri.16183 Mitologiaɫissu˿ElgcazadoryActeonxfueedevoradoaporysusnpropios...b?b
[20:46] Buho-Transparente 1 Pista: ****** Valor pregunta : 9425 Puntos [20:46] Buho-Transparente
1 Pista: ****** Valor pregunta : 9425 Puntos
[20:47] Buho-Transparente 2 Pista: per*** 30 segundos y 9425 Puntos [20:47] Buho-Transparente
2 Pista: per*** 30 segundos y 9425 Puntos
[20:47] Avestruz-Feroz perros [20:47] Avestruz-Feroz
perros
[20:47] Buho-Transparente �Increible!! Avestruz-Feroz contest󺠃04"perros" en �9.188 segundos, y ha ganado �425�12 puntos [20:47] Buho-Transparente
�Increible!! Avestruz-Feroz contest󺠃04"perros" en �9.188 segundos, y ha ganado �425�12 puntos
[20:47] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [20:47] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[20:47] Buho-Transparente Avestruz-Feroz has acertado 1 seguidas!! Puntos HOY: 605999, SEMANA: 1830968 y MES: 1830968 [20:47] Buho-Transparente
Avestruz-Feroz has acertado 1 seguidas!! Puntos HOY: 605999, SEMANA: 1830968 y MES: 1830968
[20:47] Buho-Transparente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [20:47] Buho-Transparente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[20:47] Buho-Transparente 1 Pista: ****** *** ******* Valor pregunta : 16245 Puntos [20:47] Buho-Transparente
1 Pista: ****** *** ******* Valor pregunta : 16245 Puntos
[20:47] Buho-Transparente 2 Pista: mus*** *** ******* 30 segundos y 16245 Puntos [20:47] Buho-Transparente
2 Pista: mus*** *** ******* 30 segundos y 16245 Puntos
[20:47] Buho-Transparente 3 Pista: musi*a *e* *o*a*o* 15 segundos y 16245 Puntos [20:47] Buho-Transparente
3 Pista: musi*a *e* *o*a*o* 15 segundos y 16245 Puntos
[20:48] Buho-Transparente Tiempo! La respuesta es -> musica�el�orazon <- [20:48] Buho-Transparente
Tiempo! La respuesta es -> musica�el�orazon <-
[20:48] Buho-Transparente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [20:48] Buho-Transparente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[20:48] Buho-Transparente Tri.17831 Politicaɐrometeus˿C󭯃01yserllamacellsecretarioygeneralldellA.C.N.U.R.l?l [20:48] Buho-Transparente
Tri.17831 Politicaɐrometeus˿C󭯃01yserllamacellsecretarioygeneralldellA.C.N.U.R.l?l
[20:48] Buho-Transparente 1 Pista: ****** ***** Valor pregunta : 12550 Puntos [20:48] Buho-Transparente
1 Pista: ****** ***** Valor pregunta : 12550 Puntos
[20:48] Buho-Transparente 2 Pista: sad*** ***** 30 segundos y 12550 Puntos [20:48] Buho-Transparente
2 Pista: sad*** ***** 30 segundos y 12550 Puntos
[20:48] Buho-Transparente 3 Pista: sada*o o*a*a 15 segundos y 12550 Puntos [20:48] Buho-Transparente
3 Pista: sada*o o*a*a 15 segundos y 12550 Puntos
[20:49] Buho-Transparente Tiempo! La respuesta es -> sadako�gata <- [20:49] Buho-Transparente
Tiempo! La respuesta es -> sadako�gata <-
[20:49] Buho-Transparente R᮫ing SEMANA: - #1: Ardilla\Insufrible 20736835 #2: Flamenco-Real 18994285 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15102023 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154 [20:49] Buho-Transparente
R᮫ing SEMANA: - #1: Ardilla\Insufrible 20736835 #2: Flamenco-Real 18994285 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15102023 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154
[20:49] Buho-Transparente Tri.13931 Eros-Sexɡkivasha˿C󭯃01asenconocenpopularmentenanlanandropausia?f?f [20:49] Buho-Transparente
Tri.13931 Eros-Sexɡkivasha˿C󭯃01asenconocenpopularmentenanlanandropausia?f?f
[20:49] Buho-Transparente 1 Pista: ********** ********* Valor pregunta : 13420 Puntos [20:49] Buho-Transparente
1 Pista: ********** ********* Valor pregunta : 13420 Puntos
[20:49] Buho-Transparente 2 Pista: men******* ********* 30 segundos y 13420 Puntos [20:49] Buho-Transparente
2 Pista: men******* ********* 30 segundos y 13420 Puntos
[20:49] Buho-Transparente 3 Pista: meno*au*ia *a**u*i*a 15 segundos y 13420 Puntos [20:49] Buho-Transparente
3 Pista: meno*au*ia *a**u*i*a 15 segundos y 13420 Puntos
[20:50] Buho-Transparente Tiempo! La respuesta es -> menopausia�asculina <- [20:50] Buho-Transparente
Tiempo! La respuesta es -> menopausia�asculina <-
[20:50] Buho-Transparente We feature over 50,000 Q&A ! [20:50] Buho-Transparente
We feature over 50,000 Q&A !
[20:50] Buho-Transparente Tri.11278 Cineɭartuniki˿ACTORpPROTAGONOSTApDEpYANKIpDANDYp?p [20:50] Buho-Transparente
Tri.11278 Cineɭartuniki˿ACTORpPROTAGONOSTApDEpYANKIpDANDYp?p
[20:50] Buho-Transparente 1 Pista: ***** ****** Valor pregunta : 13701 Puntos [20:50] Buho-Transparente
1 Pista: ***** ****** Valor pregunta : 13701 Puntos
[20:50] Buho-Transparente 2 Pista: jam** ****** 30 segundos y 13701 Puntos [20:50] Buho-Transparente
2 Pista: jam** ****** 30 segundos y 13701 Puntos
[20:50] Buho-Transparente 3 Pista: jame* *a**e* 15 segundos y 13701 Puntos [20:50] Buho-Transparente
3 Pista: jame* *a**e* 15 segundos y 13701 Puntos
[20:50] Buho-Transparente Tiempo! La respuesta es -> james�agney <- [20:50] Buho-Transparente
Tiempo! La respuesta es -> james�agney <-
[20:51] Buho-Transparente R᮫ing de HOY: - #1: Ardilla\Insufrible 2947836 #2: TigreSinRespeto 1603046 #3: Alitas 695281 #4: Avestruz-Feroz 605999 #5: Flamenco-Real 218896 #6: Sirena__ 204402 #7: AlbertoA 143662 #8: kitana_- 139952 #9: Lord 100000 #10: Cubanito 21944 [20:51] Buho-Transparente
R᮫ing de HOY: - #1: Ardilla\Insufrible 2947836 #2: TigreSinRespeto 1603046 #3: Alitas 695281 #4: Avestruz-Feroz 605999 #5: Flamenco-Real 218896 #6: Sirena__ 204402 #7: AlbertoA 143662 #8: kitana_- 139952 #9: Lord 100000 #10: Cubanito 21944
[20:51] Buho-Transparente Tri.14607 Cineɉcia˿ConyquecpeliculaedebutodenyeljcineclaecantantecGloriaeStefanyqueclecvaliodsutdecimoterceraenominacionyaelosmoscarsmaeMeryljStreep?s?s [20:51] Buho-Transparente
Tri.14607 Cineɉcia˿ConyquecpeliculaedebutodenyeljcineclaecantantecGloriaeStefanyqueclecvaliodsutdecimoterceraenominacionyaelosmoscarsmaeMeryljStreep?s?s
[20:51] Buho-Transparente 1 Pista: ****** *** ******* Valor pregunta : 19485 Puntos [20:51] Buho-Transparente
1 Pista: ****** *** ******* Valor pregunta : 19485 Puntos
[20:51] Buho-Transparente 2 Pista: mus*** *** ******* 30 segundos y 19485 Puntos [20:51] Buho-Transparente
2 Pista: mus*** *** ******* 30 segundos y 19485 Puntos
[20:51] Avestruz-Feroz ??? [20:51] Avestruz-Feroz
???
[20:51] Buho-Transparente 3 Pista: musi*a *e* *o*a*o* 15 segundos y 19485 Puntos [20:51] Buho-Transparente
3 Pista: musi*a *e* *o*a*o* 15 segundos y 19485 Puntos
[20:51] Buho-Transparente Tiempo! La respuesta es -> musica�el�orazon <- [20:51] Buho-Transparente
Tiempo! La respuesta es -> musica�el�orazon <-
[20:52] Buho-Transparente Tri.6017 Idiomasɦlipp_er˿FRANCES--->ESPAяL:seqmangerfdeqbaiserss?s [20:52] Buho-Transparente
Tri.6017 Idiomasɦlipp_er˿FRANCES--->ESPAяL:seqmangerfdeqbaiserss?s
[20:52] Buho-Transparente 1 Pista: ******* * ***** Pregunta de BONUS : 100000 Puntos [20:52] Buho-Transparente
1 Pista: ******* * ***** Pregunta de BONUS : 100000 Puntos
[20:52] Buho-Transparente 2 Pista: com**** * ***** 30 segundos y 100000 Puntos [20:52] Buho-Transparente
2 Pista: com**** * ***** 30 segundos y 100000 Puntos
[20:52] Buho-Transparente 3 Pista: come**e a *e*o* 15 segundos y 100000 Puntos [20:52] Buho-Transparente
3 Pista: come**e a *e*o* 15 segundos y 100000 Puntos
[20:52] Buho-Transparente Tiempo! La respuesta es -> comerse��esos <- [20:52] Buho-Transparente
Tiempo! La respuesta es -> comerse��esos <-
[20:53] Buho-Transparente Please remember this is a FREE service, Please do not complain [20:53] Buho-Transparente
Please remember this is a FREE service, Please do not complain
[20:53] Buho-Transparente Tri.11071 MitologiaɄivah˿DIOSAsGRIEGAsQUEsSIMBOLIZAsLAsVELOCIDADs?s [20:53] Buho-Transparente
Tri.11071 MitologiaɄivah˿DIOSAsGRIEGAsQUEsSIMBOLIZAsLAsVELOCIDADs?s
[20:53] Buho-Transparente 1 Pista: **** Valor pregunta : 13147 Puntos [20:53] Buho-Transparente
1 Pista: **** Valor pregunta : 13147 Puntos
[20:53] Buho-Transparente 2 Pista: iri* 30 segundos y 13147 Puntos [20:53] Buho-Transparente
2 Pista: iri* 30 segundos y 13147 Puntos
[20:53] Avestruz-Feroz iris [20:53] Avestruz-Feroz
iris
[20:53] Buho-Transparente �As�e hace Avestruz-Feroz!! Contestaste "iris" en �3.75 segundos y sumas �3147�12 puntos [20:53] Buho-Transparente
�As�e hace Avestruz-Feroz!! Contestaste "iris" en �3.75 segundos y sumas �3147�12 puntos
[20:53] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [20:53] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[20:53] Buho-Transparente Avestruz-Feroz has acertado 2 seguidas!! Puntos HOY: 619146, SEMANA: 1844115 y MES: 1844115 [20:53] Buho-Transparente
Avestruz-Feroz has acertado 2 seguidas!! Puntos HOY: 619146, SEMANA: 1844115 y MES: 1844115
[20:53] Buho-Transparente R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [20:53] Buho-Transparente
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[20:53] Buho-Transparente Tri.19856 PersonajesɍARdeJAVA˿DEkQUɃ01kENFERMEDADkMURIӃ01kFRANZkKAFKAkAkLOSk40kAяS?k?k [20:53] Buho-Transparente
Tri.19856 PersonajesɍARdeJAVA˿DEkQUɃ01kENFERMEDADkMURIӃ01kFRANZkKAFKAkAkLOSk40kAяS?k?k
[20:53] Buho-Transparente 1 Pista: ************ Valor pregunta : 9388 Puntos [20:53] Buho-Transparente
1 Pista: ************ Valor pregunta : 9388 Puntos
[20:53] Buho-Transparente 2 Pista: tub********* 30 segundos y 9388 Puntos [20:53] Buho-Transparente
2 Pista: tub********* 30 segundos y 9388 Puntos
[20:54] Buho-Transparente 3 Pista: tube**u*o*i* 15 segundos y 9388 Puntos [20:54] Buho-Transparente
3 Pista: tube**u*o*i* 15 segundos y 9388 Puntos
[20:54] Buho-Transparente Tiempo! La respuesta es -> tuberculosis <- [20:54] Buho-Transparente
Tiempo! La respuesta es -> tuberculosis <-
[20:54] Avestruz-Feroz tuberculosis [20:54] Avestruz-Feroz
tuberculosis
[20:54] Buho-Transparente If you think a Q&A is wrong, please call an OP [20:54] Buho-Transparente
If you think a Q&A is wrong, please call an OP
[20:54] Buho-Transparente Tri.5394 Medicina-Saludɍonteso˿Enwquegorganotestablabcircunvolucionwdegbroccab?u [20:54] Buho-Transparente
Tri.5394 Medicina-Saludɍonteso˿Enwquegorganotestablabcircunvolucionwdegbroccab?u
[20:54] Buho-Transparente 1 Pista: ******* Valor pregunta : 14628 Puntos [20:54] Buho-Transparente
1 Pista: ******* Valor pregunta : 14628 Puntos
[20:54] Buho-Transparente 2 Pista: cer**** 30 segundos y 14628 Puntos [20:54] Buho-Transparente
2 Pista: cer**** 30 segundos y 14628 Puntos
[20:54] Avestruz-Feroz cerebro [20:54] Avestruz-Feroz
cerebro
[20:54] Buho-Transparente �Muy bien Avestruz-Feroz!! Acertaste "cerebro" en tan s󬯠�4.187 segundos y por eso has ganado: �4628�12 puntos [20:54] Buho-Transparente
�Muy bien Avestruz-Feroz!! Acertaste "cerebro" en tan s󬯠�4.187 segundos y por eso has ganado: �4628�12 puntos
[20:54] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [20:54] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[20:54] Buho-Transparente Avestruz-Feroz has acertado 3 seguidas!! Puntos HOY: 633774, SEMANA: 1858743 y MES: 1858743 [20:54] Buho-Transparente
Avestruz-Feroz has acertado 3 seguidas!! Puntos HOY: 633774, SEMANA: 1858743 y MES: 1858743
[20:55] Buho-Transparente R᮫ing por D́: - Domingo: TigreSinRespeto 8389382 Lunes: Ardilla\Insufrible 439202 Martes: Ardilla\Insufrible 3723143 Miercoles: Ardilla\Insufrible 2928711 Jueves: Flamenco-Real 511120 Viernes: Ardilla\Insufrible 3683447 Sᢡdo: * 0 [20:55] Buho-Transparente
R᮫ing por D́: - Domingo: TigreSinRespeto 8389382 Lunes: Ardilla\Insufrible 439202 Martes: Ardilla\Insufrible 3723143 Miercoles: Ardilla\Insufrible 2928711 Jueves: Flamenco-Real 511120 Viernes: Ardilla\Insufrible 3683447 Sᢡdo: * 0
[20:55] Buho-Transparente Tri.12255 EconomiaɞIrati˿Enrinvestigaci󮃰1rdenmercadosnestait飮icaipermitenlaiobtenci󮃰1rdeninformaci󮃰1rsinrquenseanrconscientesndensuhcolaboraci󮃰1r?g [20:55] Buho-Transparente
Tri.12255 EconomiaɞIrati˿Enrinvestigaci󮃰1rdenmercadosnestait飮icaipermitenlaiobtenci󮃰1rdeninformaci󮃰1rsinrquenseanrconscientesndensuhcolaboraci󮃰1r?g
[20:55] Buho-Transparente 1 Pista: ** *********** Valor pregunta : 12914 Puntos [20:55] Buho-Transparente
1 Pista: ** *********** Valor pregunta : 12914 Puntos
[20:55] Buho-Transparente 2 Pista: la�********** 30 segundos y 12914 Puntos [20:55] Buho-Transparente
2 Pista: la�********** 30 segundos y 12914 Puntos
[20:55] Buho-Transparente 3 Pista: la�**e**a*io* 15 segundos y 12914 Puntos [20:55] Buho-Transparente
3 Pista: la�**e**a*io* 15 segundos y 12914 Puntos
[20:55] Buho-Transparente Tiempo! La respuesta es -> la�bservacion <- [20:55] Buho-Transparente
Tiempo! La respuesta es -> la�bservacion <-
[20:55] Buho-Transparente For The Competitive Edge type !pingme [20:55] Buho-Transparente
For The Competitive Edge type !pingme
[20:55] Buho-Transparente Tri.3362 Miscelaneaɴamzarian˿Jud�01voriundovdeeEuropapCentralyywOrientaly?r [20:55] Buho-Transparente
Tri.3362 Miscelaneaɴamzarian˿Jud�01voriundovdeeEuropapCentralyywOrientaly?r
[20:55] Buho-Transparente 1 Pista: ******** Valor pregunta : 12195 Puntos [20:55] Buho-Transparente
1 Pista: ******** Valor pregunta : 12195 Puntos
[20:56] Buho-Transparente 2 Pista: ask***** 30 segundos y 12195 Puntos [20:56] Buho-Transparente
2 Pista: ask***** 30 segundos y 12195 Puntos
[20:56] Buho-Transparente 3 Pista: aske*a*i 15 segundos y 12195 Puntos [20:56] Buho-Transparente
3 Pista: aske*a*i 15 segundos y 12195 Puntos
[20:56] Buho-Transparente Tiempo! La respuesta es -> askenazi <- [20:56] Buho-Transparente
Tiempo! La respuesta es -> askenazi <-
[20:56] Buho-Transparente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [20:56] Buho-Transparente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[20:56] Buho-Transparente Tri.7140 Idiomasɴjmm.com˅nmfranc鳺a"Dios"a?a [20:56] Buho-Transparente
Tri.7140 Idiomasɴjmm.com˅nmfranc鳺a"Dios"a?a
[20:56] Buho-Transparente 1 Pista: **** Valor pregunta : 12290 Puntos [20:56] Buho-Transparente
1 Pista: **** Valor pregunta : 12290 Puntos
[20:57] Buho-Transparente 2 Pista: die* 30 segundos y 12290 Puntos [20:57] Buho-Transparente
2 Pista: die* 30 segundos y 12290 Puntos
[20:57] Avestruz-Feroz dies [20:57] Avestruz-Feroz
dies
[20:57] Avestruz-Feroz diez [20:57] Avestruz-Feroz
diez
[20:57] Avestruz-Feroz dien [20:57] Avestruz-Feroz
dien
[20:57] Buho-Transparente 3 Pista: dieu 15 segundos y 12290 Puntos [20:57] Buho-Transparente
3 Pista: dieu 15 segundos y 12290 Puntos
[20:57] Avestruz-Feroz dieu [20:57] Avestruz-Feroz
dieu
[20:57] Buho-Transparente �Absolutamente correcto Avestruz-Feroz!! Acertaste "dieu" en �3.297 segundos y ganas �2290�12 puntos [20:57] Buho-Transparente
�Absolutamente correcto Avestruz-Feroz!! Acertaste "dieu" en �3.297 segundos y ganas �2290�12 puntos
[20:57] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [20:57] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[20:57] Buho-Transparente Avestruz-Feroz has acertado 4 seguidas!! Puntos HOY: 646064, SEMANA: 1871033 y MES: 1871033 [20:57] Buho-Transparente
Avestruz-Feroz has acertado 4 seguidas!! Puntos HOY: 646064, SEMANA: 1871033 y MES: 1871033
[20:57] Buho-Transparente R᮫ing MES: - #1: Ardilla\Insufrible 17065272 #2: Flamenco-Real 16761569 #3: Rana}ConTimidez 16651319 #4: TigreSinRespeto 15102023 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: Alitas 4100139 #8: SMAW 4012154 #9: LaCamelia 3029384 #10: Avestruz-Feroz 1858743 [20:57] Buho-Transparente
R᮫ing MES: - #1: Ardilla\Insufrible 17065272 #2: Flamenco-Real 16761569 #3: Rana}ConTimidez 16651319 #4: TigreSinRespeto 15102023 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: Alitas 4100139 #8: SMAW 4012154 #9: LaCamelia 3029384 #10: Avestruz-Feroz 1858743
[20:57] Buho-Transparente Tri.7236 Politicaɳkyfox˿H.WOTTONxESCRIBIOxUNxEMBAJADORxESxUNAxPERSONAxHONESTAxQUExSExENVIAxAxMENTIRxALxEXTRANJERO.xSExREFIERExAxLA...x?x [20:57] Buho-Transparente
Tri.7236 Politicaɳkyfox˿H.WOTTONxESCRIBIOxUNxEMBAJADORxESxUNAxPERSONAxHONESTAxQUExSExENVIAxAxMENTIRxALxEXTRANJERO.xSExREFIERExAxLA...x?x
[20:57] Buho-Transparente 1 Pista: ********** Valor pregunta : 18919 Puntos [20:57] Buho-Transparente
1 Pista: ********** Valor pregunta : 18919 Puntos
[20:57] Buho-Transparente 2 Pista: dip******* 30 segundos y 18919 Puntos [20:57] Buho-Transparente
2 Pista: dip******* 30 segundos y 18919 Puntos
[20:58] Buho-Transparente 3 Pista: dip*o*a*ia 15 segundos y 18919 Puntos [20:58] Buho-Transparente
3 Pista: dip*o*a*ia 15 segundos y 18919 Puntos
[20:58] Avestruz-Feroz diplomacia [20:58] Avestruz-Feroz
diplomacia
[20:58] Buho-Transparente �As�e hace Avestruz-Feroz!! Contestaste "diplomacia" en �6.047 segundos y sumas �8919�12 puntos [20:58] Buho-Transparente
�As�e hace Avestruz-Feroz!! Contestaste "diplomacia" en �6.047 segundos y sumas �8919�12 puntos
[20:58] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [20:58] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[20:58] Buho-Transparente Avestruz-Feroz has acertado 5 seguidas!! Puntos HOY: 664983, SEMANA: 1889952 y MES: 1889952 [20:58] Buho-Transparente
Avestruz-Feroz has acertado 5 seguidas!! Puntos HOY: 664983, SEMANA: 1889952 y MES: 1889952
[20:58] Buho-Transparente Please refrain from using Extreme Bad Language [20:58] Buho-Transparente
Please refrain from using Extreme Bad Language
[20:58] Buho-Transparente Tri.9670 LiteraturaɂRUJI˿AdQUEdMOVIMIENTOdLITERARIOdPERTENECEdRAMIROdDEdMAEZTUd?d [20:58] Buho-Transparente
Tri.9670 LiteraturaɂRUJI˿AdQUEdMOVIMIENTOdLITERARIOdPERTENECEdRAMIROdDEdMAEZTUd?d
[20:58] Buho-Transparente 1 Pista: ********** *** ** Valor pregunta : 15317 Puntos [20:58] Buho-Transparente
1 Pista: ********** *** ** Valor pregunta : 15317 Puntos
[20:58] Buho-Transparente 2 Pista: gen******* *** ** 30 segundos y 15317 Puntos [20:58] Buho-Transparente
2 Pista: gen******* *** ** 30 segundos y 15317 Puntos
[20:58] Avestruz-Feroz generacion del 28 [20:58] Avestruz-Feroz
generacion del 28
[20:58] Buho-Transparente 3 Pista: gene*a*io* *e* ** 15 segundos y 15317 Puntos [20:58] Buho-Transparente
3 Pista: gene*a*io* *e* ** 15 segundos y 15317 Puntos
[20:59] Buho-Transparente Tiempo! La respuesta es -> generacion�el�8 <- [20:59] Buho-Transparente
Tiempo! La respuesta es -> generacion�el�8 <-
[20:59] Buho-Transparente This is #Mexico, I am your host Buho-Transparente, running Buho-Transparente [20:59] Buho-Transparente
This is #Mexico, I am your host Buho-Transparente, running Buho-Transparente
[20:59] Buho-Transparente Tri.1387 Informaticaɐax˿Empresafcreadorafdelkprogramaf3DqStudiowMAXq?q [20:59] Buho-Transparente
Tri.1387 Informaticaɐax˿Empresafcreadorafdelkprogramaf3DqStudiowMAXq?q
[20:59] Buho-Transparente 1 Pista: ******* Valor pregunta : 24395 Puntos [20:59] Buho-Transparente
1 Pista: ******* Valor pregunta : 24395 Puntos
[20:59] Buho-Transparente 2 Pista: Kin**** 30 segundos y 24395 Puntos [20:59] Buho-Transparente
2 Pista: Kin**** 30 segundos y 24395 Puntos
[20:59] Buho-Transparente 3 Pista: Kine*i* 15 segundos y 24395 Puntos [20:59] Buho-Transparente
3 Pista: Kine*i* 15 segundos y 24395 Puntos
[21:00] Buho-Transparente Tiempo! La respuesta es -> Kinetix <- [21:00] Buho-Transparente
Tiempo! La respuesta es -> Kinetix <-
[21:00] Buho-Transparente This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Avestruz-Feroz 1871033 #13: Sirena__ 1207677 #14: LeCaTwaLk_z 1185079 #15: Chornobyl 873565 #16: etewsgy 695960 #17: kitana_- 692692 #18: julia__ 611502 #19: karen-62 535210 #20: AlbertoA 475137 [21:00] Buho-Transparente
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Avestruz-Feroz 1871033 #13: Sirena__ 1207677 #14: LeCaTwaLk_z 1185079 #15: Chornobyl 873565 #16: etewsgy 695960 #17: kitana_- 692692 #18: julia__ 611502 #19: karen-62 535210 #20: AlbertoA 475137
[21:00] Buho-Transparente Tri.13244 GeografiaɁcuarios˿ENrQUErCIUDADrESPA񏌁rSErENCUENTRArLArMAYORrPLAZArDErTOROSr?r [21:00] Buho-Transparente
Tri.13244 GeografiaɁcuarios˿ENrQUErCIUDADrESPA񏌁rSErENCUENTRArLArMAYORrPLAZArDErTOROSr?r
[21:00] Buho-Transparente 1 Pista: ****** Valor pregunta : 6997 Puntos [21:00] Buho-Transparente
1 Pista: ****** Valor pregunta : 6997 Puntos
[21:00] Avestruz-Feroz madrid [21:00] Avestruz-Feroz
madrid
[21:00] Buho-Transparente �Increible!! Avestruz-Feroz contest󺠃04"madrid" en �0.359 segundos, y ha ganado �997�12 puntos [21:00] Buho-Transparente
�Increible!! Avestruz-Feroz contest󺠃04"madrid" en �0.359 segundos, y ha ganado �997�12 puntos
[21:00] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [21:00] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[21:00] Buho-Transparente Avestruz-Feroz has acertado 6 seguidas!! Puntos HOY: 671980, SEMANA: 1896949 y MES: 1896949 [21:00] Buho-Transparente
Avestruz-Feroz has acertado 6 seguidas!! Puntos HOY: 671980, SEMANA: 1896949 y MES: 1896949
[21:00] Buho-Transparente Please remember this is a FREE service, Please do not complain [21:00] Buho-Transparente
Please remember this is a FREE service, Please do not complain
[21:00] Buho-Transparente 1 Pista: ******* Valor pregunta : 5682 Puntos [21:00] Buho-Transparente
1 Pista: ******* Valor pregunta : 5682 Puntos
[21:00] Buho-Transparente 2 Pista: igu**** 30 segundos y 5682 Puntos [21:00] Buho-Transparente
2 Pista: igu**** 30 segundos y 5682 Puntos
[21:01] Buho-Transparente 3 Pista: igua*e* 15 segundos y 5682 Puntos [21:01] Buho-Transparente
3 Pista: igua*e* 15 segundos y 5682 Puntos
[21:01] Avestruz-Feroz igualrd [21:01] Avestruz-Feroz
igualrd
[21:01] Avestruz-Feroz iguales [21:01] Avestruz-Feroz
iguales
[21:01] Buho-Transparente �Eso es Avestruz-Feroz!! Dijiste: "iguales" y ello te ha valido: �682�12 puntos [21:01] Buho-Transparente
�Eso es Avestruz-Feroz!! Dijiste: "iguales" y ello te ha valido: �682�12 puntos
[21:01] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [21:01] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[21:01] Buho-Transparente Avestruz-Feroz has acertado 7 seguidas!! Puntos HOY: 677662, SEMANA: 1902631 y MES: 1902631 [21:01] Buho-Transparente
Avestruz-Feroz has acertado 7 seguidas!! Puntos HOY: 677662, SEMANA: 1902631 y MES: 1902631
[21:01] Buho-Transparente This MONTHS Top 11-20: - #11: Sirena__ 938571 #12: Chornobyl 873565 #13: kitana_- 682987 #14: julia__ 611502 #15: Cubanito 581548 #16: karen-62 535210 #17: AlbertoA 475137 #18: KaZuMa_KiRyU 435575 #19: karen-53 342268 #20: karen- 298704 [21:01] Buho-Transparente
This MONTHS Top 11-20: - #11: Sirena__ 938571 #12: Chornobyl 873565 #13: kitana_- 682987 #14: julia__ 611502 #15: Cubanito 581548 #16: karen-62 535210 #17: AlbertoA 475137 #18: KaZuMa_KiRyU 435575 #19: karen-53 342268 #20: karen- 298704
[21:01] Buho-Transparente Tri.14324 PoliticaɊAVEA˿16oDEoMAYOoDEo1997:oQUEoDICTADORoABANDONAoELoPODERoDELoZAIREoYoSEoEXILIAo?o [21:01] Buho-Transparente
Tri.14324 PoliticaɊAVEA˿16oDEoMAYOoDEo1997:oQUEoDICTADORoABANDONAoELoPODERoDELoZAIREoYoSEoEXILIAo?o
[21:01] Buho-Transparente 1 Pista: ****** **** **** Valor pregunta : 13417 Puntos [21:01] Buho-Transparente
1 Pista: ****** **** **** Valor pregunta : 13417 Puntos
[21:01] Buho-Transparente 2 Pista: mob*** **** **** 30 segundos y 13417 Puntos [21:01] Buho-Transparente
2 Pista: mob*** **** **** 30 segundos y 13417 Puntos
[21:01] Buho-Transparente 3 Pista: mobu*u *e*e *e*o 15 segundos y 13417 Puntos [21:01] Buho-Transparente
3 Pista: mobu*u *e*e *e*o 15 segundos y 13417 Puntos
[21:02] Buho-Transparente Tiempo! La respuesta es -> mobutu�ese�eko <- [21:02] Buho-Transparente
Tiempo! La respuesta es -> mobutu�ese�eko <-
[21:02] Buho-Transparente R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [21:02] Buho-Transparente
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[21:02] Buho-Transparente Tri.20798 Literaturaɲaziel9˿Deaqueasiglovesslaunovelaupicaresca?p?p [21:02] Buho-Transparente
Tri.20798 Literaturaɲaziel9˿Deaqueasiglovesslaunovelaupicaresca?p?p
[21:02] Buho-Transparente 1 Pista: *** Valor pregunta : 15001 Puntos [21:02] Buho-Transparente
1 Pista: *** Valor pregunta : 15001 Puntos
[21:02] Buho-Transparente 2 Pista: xvi 30 segundos y 15001 Puntos [21:02] Buho-Transparente
2 Pista: xvi 30 segundos y 15001 Puntos
[21:02] Buho-Transparente 3 Pista: xvi 15 segundos y 15001 Puntos [21:02] Buho-Transparente
3 Pista: xvi 15 segundos y 15001 Puntos
[21:03] Buho-Transparente Tiempo! La respuesta es -> xvi <- [21:03] Buho-Transparente
Tiempo! La respuesta es -> xvi <-
[21:03] Buho-Transparente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [21:03] Buho-Transparente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[21:03] Buho-Transparente Tri.7929 DeporteɔDI˿CUALxERAxELxAPODOxDExPACOxLLORENTExENxELxVESTUARIOxBLANCOx?x [21:03] Buho-Transparente
Tri.7929 DeporteɔDI˿CUALxERAxELxAPODOxDExPACOxLLORENTExENxELxVESTUARIOxBLANCOx?x
[21:03] Buho-Transparente 1 Pista: ** ******* Valor pregunta : 18430 Puntos [21:03] Buho-Transparente
1 Pista: ** ******* Valor pregunta : 18430 Puntos
[21:03] Buho-Transparente 2 Pista: el�****** 30 segundos y 18430 Puntos [21:03] Buho-Transparente
2 Pista: el�****** 30 segundos y 18430 Puntos
[21:03] Buho-Transparente 3 Pista: el�e**u*a 15 segundos y 18430 Puntos [21:03] Buho-Transparente
3 Pista: el�e**u*a 15 segundos y 18430 Puntos
[21:03] Buho-Transparente Tiempo! La respuesta es -> el�echuga <- [21:03] Buho-Transparente
Tiempo! La respuesta es -> el�echuga <-
[21:04] Buho-Transparente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [21:04] Buho-Transparente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[21:04] Buho-Transparente Tri.19052 Cienciaɳtephenwo˿Enhquezrioyestჰ1selgmayorbdiquezdezregulaci󮃰1hmovilgdelgmundo?s?s [21:04] Buho-Transparente
Tri.19052 Cienciaɳtephenwo˿Enhquezrioyestჰ1selgmayorbdiquezdezregulaci󮃰1hmovilgdelgmundo?s?s
[21:04] Buho-Transparente 1 Pista: ******* Pregunta de BONUS : 100000 Puntos [21:04] Buho-Transparente
1 Pista: ******* Pregunta de BONUS : 100000 Puntos
[21:04] Buho-Transparente 2 Pista: tam**** 30 segundos y 100000 Puntos [21:04] Buho-Transparente
2 Pista: tam**** 30 segundos y 100000 Puntos
[21:04] Buho-Transparente 3 Pista: tame*i* 15 segundos y 100000 Puntos [21:04] Buho-Transparente
3 Pista: tame*i* 15 segundos y 100000 Puntos
[21:04] Buho-Transparente Tiempo! La respuesta es -> tamesis <- [21:04] Buho-Transparente
Tiempo! La respuesta es -> tamesis <-
[21:05] Buho-Transparente R᮫ing SEMANA: - #1: Ardilla\Insufrible 20736835 #2: Flamenco-Real 18994285 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15102023 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154 [21:05] Buho-Transparente
R᮫ing SEMANA: - #1: Ardilla\Insufrible 20736835 #2: Flamenco-Real 18994285 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15102023 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154
[21:05] Buho-Transparente Tri.12680 PersonajesɍARdeJAVA˿CU�kESkELkSIGNOkDELkZODIACOkDEkLOSkSIGUIENTESkPERSONAJESkCɌEBRES:kLUCIANOkPAVAROTTI,kMARGARETkTHATCHER,kPEDROkALMODӖARkYkMICHAELkDOUGLAS?k?k [21:05] Buho-Transparente
Tri.12680 PersonajesɍARdeJAVA˿CU�kESkELkSIGNOkDELkZODIACOkDEkLOSkSIGUIENTESkPERSONAJESkCɌEBRES:kLUCIANOkPAVAROTTI,kMARGARETkTHATCHER,kPEDROkALMODӖARkYkMICHAELkDOUGLAS?k?k
[21:05] Buho-Transparente 1 Pista: ***** Valor pregunta : 17303 Puntos [21:05] Buho-Transparente
1 Pista: ***** Valor pregunta : 17303 Puntos
[21:05] Buho-Transparente 2 Pista: lib** 30 segundos y 17303 Puntos [21:05] Buho-Transparente
2 Pista: lib** 30 segundos y 17303 Puntos
[21:05] Buho-Transparente 3 Pista: lib*a 15 segundos y 17303 Puntos [21:05] Buho-Transparente
3 Pista: lib*a 15 segundos y 17303 Puntos
[21:05] Buho-Transparente Tiempo! La respuesta es -> libra <- [21:05] Buho-Transparente
Tiempo! La respuesta es -> libra <-
[21:06] Buho-Transparente We feature over 50,000 Q&A ! [21:06] Buho-Transparente
We feature over 50,000 Q&A !
[21:06] Buho-Transparente Tri.15550 Musicaɴjmm.com˿Elpm᳃01pimportanteeyoveteranoigrupoideefolksvasco.r?r [21:06] Buho-Transparente
Tri.15550 Musicaɴjmm.com˿Elpm᳃01pimportanteeyoveteranoigrupoideefolksvasco.r?r
[21:06] Buho-Transparente 1 Pista: ******* Valor pregunta : 11771 Puntos [21:06] Buho-Transparente
1 Pista: ******* Valor pregunta : 11771 Puntos
[21:06] Buho-Transparente Trivial parado por Jugador! [21:06] Buho-Transparente
Trivial parado por Jugador!
[21:06] Cocodrilo\ConBravura Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas [21:06] Cocodrilo\ConBravura
Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas
[21:06] Flamenco-Real !jugar [21:06] Flamenco-Real
!jugar
[21:06] Buho-Transparente EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!! [21:06] Buho-Transparente
EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!!
[21:06] Buho-Transparente R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [21:06] Buho-Transparente
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[21:06] Buho-Transparente Tri.2801 GeografiaɁcuarios˿CUALyESyLAySEGUNDAyREGIONyMASyGRANDEyDEyESPA񁃰1y?y [21:06] Buho-Transparente
Tri.2801 GeografiaɁcuarios˿CUALyESyLAySEGUNDAyREGIONyMASyGRANDEyDEyESPA񁃰1y?y
[21:06] Buho-Transparente 1 Pista: ********* Valor pregunta : 20303 Puntos [21:06] Buho-Transparente
1 Pista: ********* Valor pregunta : 20303 Puntos
[21:06] Buho-Transparente 2 Pista: and****** 30 segundos y 20303 Puntos [21:06] Buho-Transparente
2 Pista: and****** 30 segundos y 20303 Puntos
[21:06] Flamenco-Real andalucia [21:06] Flamenco-Real
andalucia
[21:06] Buho-Transparente �emuestra lo que sabes Flamenco-Real! Has respondido "andalucia" correctamente y eso te da: �0303�12 puntos [21:06] Buho-Transparente
�emuestra lo que sabes Flamenco-Real! Has respondido "andalucia" correctamente y eso te da: �0303�12 puntos
[21:06] Buho-Transparente Flamenco-Real has acertado 1 seguidas!! Puntos HOY: 239199, SEMANA: 19014588 y MES: 16781872 [21:06] Buho-Transparente
Flamenco-Real has acertado 1 seguidas!! Puntos HOY: 239199, SEMANA: 19014588 y MES: 16781872
[21:07] Buho-Transparente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [21:07] Buho-Transparente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[21:07] Buho-Transparente Tri.12760 Cienciaɖivian˿DerquertresppartespestaxformadaxlaxTierrax?i?i [21:07] Buho-Transparente
Tri.12760 Cienciaɖivian˿DerquertresppartespestaxformadaxlaxTierrax?i?i
[21:07] Buho-Transparente 1 Pista: ********* ********** * ********* Valor pregunta : 12295 Puntos [21:07] Buho-Transparente
1 Pista: ********* ********** * ********* Valor pregunta : 12295 Puntos
[21:07] Buho-Transparente 2 Pista: lit****** ********** * ********* 30 segundos y 12295 Puntos [21:07] Buho-Transparente
2 Pista: lit****** ********** * ********* 30 segundos y 12295 Puntos
[21:07] Buho-Transparente 3 Pista: lito**e*a *i**o**e*a * a**o**e*a 15 segundos y 12295 Puntos [21:07] Buho-Transparente
3 Pista: lito**e*a *i**o**e*a * a**o**e*a 15 segundos y 12295 Puntos
[21:07] Buho-Transparente Tiempo! La respuesta es -> litosfera�idrosfera��tmosfera <- [21:07] Buho-Transparente
Tiempo! La respuesta es -> litosfera�idrosfera��tmosfera <-
[21:08] Buho-Transparente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [21:08] Buho-Transparente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[21:08] Buho-Transparente Tri.2007 Gastronomiaɒolo˿Cualuesseluprincipaluingredientevdevlammahonesam?e [21:08] Buho-Transparente
Tri.2007 Gastronomiaɒolo˿Cualuesseluprincipaluingredientevdevlammahonesam?e
[21:08] Buho-Transparente 1 Pista: ****** Valor pregunta : 14220 Puntos [21:08] Buho-Transparente
1 Pista: ****** Valor pregunta : 14220 Puntos
[21:08] Buho-Transparente 2 Pista: ace*** 30 segundos y 14220 Puntos [21:08] Buho-Transparente
2 Pista: ace*** 30 segundos y 14220 Puntos
[21:08] Flamenco-Real aceite [21:08] Flamenco-Real
aceite
[21:08] Buho-Transparente �Increible!! Flamenco-Real contest󺠃04"aceite" en �7.359 segundos, y ha ganado �4220�12 puntos [21:08] Buho-Transparente
�Increible!! Flamenco-Real contest󺠃04"aceite" en �7.359 segundos, y ha ganado �4220�12 puntos
[21:08] Buho-Transparente Flamenco-Real has acertado 2 seguidas!! Puntos HOY: 253419, SEMANA: 19028808 y MES: 16796092 [21:08] Buho-Transparente
Flamenco-Real has acertado 2 seguidas!! Puntos HOY: 253419, SEMANA: 19028808 y MES: 16796092
[21:08] Buho-Transparente R᮫ing SEMANA: - #1: Ardilla\Insufrible 20736835 #2: Flamenco-Real 19028808 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15102023 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154 [21:08] Buho-Transparente
R᮫ing SEMANA: - #1: Ardilla\Insufrible 20736835 #2: Flamenco-Real 19028808 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15102023 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154
[21:08] Buho-Transparente Tri.5487 Arteɬusie˿Comoctieneelaunarizilaupir᭩deedeeGiz騿i?i [21:08] Buho-Transparente
Tri.5487 Arteɬusie˿Comoctieneelaunarizilaupir᭩deedeeGiz騿i?i
[21:08] Buho-Transparente 1 Pista: ***** Valor pregunta : 22081 Puntos [21:08] Buho-Transparente
1 Pista: ***** Valor pregunta : 22081 Puntos
[21:08] Buho-Transparente 2 Pista: cha** 30 segundos y 22081 Puntos [21:08] Buho-Transparente
2 Pista: cha** 30 segundos y 22081 Puntos
[21:09] Avestruz-Feroz chata [21:09] Avestruz-Feroz
chata
[21:09] Buho-Transparente �Muy bien Avestruz-Feroz!! Acertaste "chata" en tan s󬯠�9.969 segundos y por eso has ganado: �2081�12 puntos [21:09] Buho-Transparente
�Muy bien Avestruz-Feroz!! Acertaste "chata" en tan s󬯠�9.969 segundos y por eso has ganado: �2081�12 puntos
[21:09] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [21:09] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[21:09] Buho-Transparente Avestruz-Feroz has acertado 1 seguidas!! Puntos HOY: 699743, SEMANA: 1924712 y MES: 1924712 [21:09] Buho-Transparente
Avestruz-Feroz has acertado 1 seguidas!! Puntos HOY: 699743, SEMANA: 1924712 y MES: 1924712
[21:09] Buho-Transparente We feature over 50,000 Q&A ! [21:09] Buho-Transparente
We feature over 50,000 Q&A !
[21:09] Buho-Transparente Tri.17565 Arteɴarra˿EnrquebestiloctienebcontinuidadhelnBarroco?w?w [21:09] Buho-Transparente
Tri.17565 Arteɴarra˿EnrquebestiloctienebcontinuidadhelnBarroco?w?w
[21:09] Buho-Transparente 1 Pista: ****** Valor pregunta : 13072 Puntos [21:09] Buho-Transparente
1 Pista: ****** Valor pregunta : 13072 Puntos
[21:09] Buho-Transparente 2 Pista: roc*** 30 segundos y 13072 Puntos [21:09] Buho-Transparente
2 Pista: roc*** 30 segundos y 13072 Puntos
[21:09] Buho-Transparente 3 Pista: roco*o 15 segundos y 13072 Puntos [21:09] Buho-Transparente
3 Pista: roco*o 15 segundos y 13072 Puntos
[21:09] Avestruz-Feroz rococo [21:09] Avestruz-Feroz
rococo
[21:09] Buho-Transparente �Enhorabuena Avestruz-Feroz!! Has contestado "rococo" y por ello has ganado �3072�12 puntos [21:09] Buho-Transparente
�Enhorabuena Avestruz-Feroz!! Has contestado "rococo" y por ello has ganado �3072�12 puntos
[21:09] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [21:09] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[21:09] Buho-Transparente Avestruz-Feroz has acertado 2 seguidas!! Puntos HOY: 712815, SEMANA: 1937784 y MES: 1937784 [21:09] Buho-Transparente
Avestruz-Feroz has acertado 2 seguidas!! Puntos HOY: 712815, SEMANA: 1937784 y MES: 1937784
[21:10] Buho-Transparente R᮫ing de HOY: - #1: Ardilla\Insufrible 2947836 #2: TigreSinRespeto 1603046 #3: Avestruz-Feroz 712815 #4: Alitas 695281 #5: Flamenco-Real 253419 #6: Sirena__ 204402 #7: AlbertoA 143662 #8: kitana_- 139952 #9: Lord 100000 #10: Cubanito 21944 [21:10] Buho-Transparente
R᮫ing de HOY: - #1: Ardilla\Insufrible 2947836 #2: TigreSinRespeto 1603046 #3: Avestruz-Feroz 712815 #4: Alitas 695281 #5: Flamenco-Real 253419 #6: Sirena__ 204402 #7: AlbertoA 143662 #8: kitana_- 139952 #9: Lord 100000 #10: Cubanito 21944
[21:10] Buho-Transparente Tri.2797 Idiomasɳtephewo˿Gallegod-castellanod"rison"?l?l [21:10] Buho-Transparente
Tri.2797 Idiomasɳtephewo˿Gallegod-castellanod"rison"?l?l
[21:10] Buho-Transparente 1 Pista: ***** Valor pregunta : 19822 Puntos [21:10] Buho-Transparente
1 Pista: ***** Valor pregunta : 19822 Puntos
[21:10] Buho-Transparente 2 Pista: anc** 30 segundos y 19822 Puntos [21:10] Buho-Transparente
2 Pista: anc** 30 segundos y 19822 Puntos
[21:10] Avestruz-Feroz ancla [21:10] Avestruz-Feroz
ancla
[21:10] Buho-Transparente �Bien Avestruz-Feroz!! Tu respuesta: "ancla" es correcta y ganas �9822�12 puntos [21:10] Buho-Transparente
�Bien Avestruz-Feroz!! Tu respuesta: "ancla" es correcta y ganas �9822�12 puntos
[21:10] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [21:10] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[21:10] Buho-Transparente Avestruz-Feroz has acertado 3 seguidas!! Puntos HOY: 732637, SEMANA: 1957606 y MES: 1957606 [21:10] Buho-Transparente
Avestruz-Feroz has acertado 3 seguidas!! Puntos HOY: 732637, SEMANA: 1957606 y MES: 1957606
[21:10] Buho-Transparente Tri.2431 Cineɬusie˨1929)nQuizჰ1nlajprimerajpel�lajnorteamericanajquesintentajdignificareajlosjnegros,naproximᮤosesajsuqmundowconvrespeto.ߔ�lo?n?n [21:10] Buho-Transparente
Tri.2431 Cineɬusie˨1929)nQuizჰ1nlajprimerajpel�lajnorteamericanajquesintentajdignificareajlosjnegros,naproximᮤosesajsuqmundowconvrespeto.ߔ�lo?n?n
[21:10] Buho-Transparente 1 Pista: ******* Valor pregunta : 15451 Puntos [21:10] Buho-Transparente
1 Pista: ******* Valor pregunta : 15451 Puntos
[21:10] Buho-Transparente 2 Pista: ale**** 30 segundos y 15451 Puntos [21:10] Buho-Transparente
2 Pista: ale**** 30 segundos y 15451 Puntos
[21:11] Buho-Transparente 3 Pista: ale*u*a 15 segundos y 15451 Puntos [21:11] Buho-Transparente
3 Pista: ale*u*a 15 segundos y 15451 Puntos
[21:11] Avestruz-Feroz aleluya [21:11] Avestruz-Feroz
aleluya
[21:11] Buho-Transparente �Increible!! Avestruz-Feroz contest󺠃04"aleluya" en �6.688 segundos, y ha ganado �5451�12 puntos [21:11] Buho-Transparente
�Increible!! Avestruz-Feroz contest󺠃04"aleluya" en �6.688 segundos, y ha ganado �5451�12 puntos
[21:11] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [21:11] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[21:11] Buho-Transparente Avestruz-Feroz has acertado 4 seguidas!! Puntos HOY: 748088, SEMANA: 1973057 y MES: 1973057 [21:11] Buho-Transparente
Avestruz-Feroz has acertado 4 seguidas!! Puntos HOY: 748088, SEMANA: 1973057 y MES: 1973057
[21:11] Buho-Transparente Please remember this is a FREE service, Please do not complain [21:11] Buho-Transparente
Please remember this is a FREE service, Please do not complain
[21:11] Buho-Transparente Tri.1212 Idiomasɴjmm.com˿ContieneflaeX:zPrincipio,zintroducci󮃰1doupre᭢uloudefunaeobraeliteraria.z?z [21:11] Buho-Transparente
Tri.1212 Idiomasɴjmm.com˿ContieneflaeX:zPrincipio,zintroducci󮃰1doupre᭢uloudefunaeobraeliteraria.z?z
[21:11] Buho-Transparente 1 Pista: ******* Valor pregunta : 7755 Puntos [21:11] Buho-Transparente
1 Pista: ******* Valor pregunta : 7755 Puntos
[21:11] Buho-Transparente 2 Pista: Exo**** 30 segundos y 7755 Puntos [21:11] Buho-Transparente
2 Pista: Exo**** 30 segundos y 7755 Puntos
[21:11] Buho-Transparente 3 Pista: Exo**io 15 segundos y 7755 Puntos [21:11] Buho-Transparente
3 Pista: Exo**io 15 segundos y 7755 Puntos
[21:12] Buho-Transparente Tiempo! La respuesta es -> Exordio <- [21:12] Buho-Transparente
Tiempo! La respuesta es -> Exordio <-
[21:12] Buho-Transparente R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [21:12] Buho-Transparente
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[21:12] Buho-Transparente Tri.13685 Idiomasɦlipp_er˿ESPAяL--->LATIN:martesh?h [21:12] Buho-Transparente
Tri.13685 Idiomasɦlipp_er˿ESPAяL--->LATIN:martesh?h
[21:12] Buho-Transparente 1 Pista: ****** Valor pregunta : 8440 Puntos [21:12] Buho-Transparente
1 Pista: ****** Valor pregunta : 8440 Puntos
[21:12] Buho-Transparente 2 Pista: mar*** 30 segundos y 8440 Puntos [21:12] Buho-Transparente
2 Pista: mar*** 30 segundos y 8440 Puntos
[21:12] Buho-Transparente 3 Pista: mar*i* 15 segundos y 8440 Puntos [21:12] Buho-Transparente
3 Pista: mar*i* 15 segundos y 8440 Puntos
[21:13] Buho-Transparente Tiempo! La respuesta es -> martis <- [21:13] Buho-Transparente
Tiempo! La respuesta es -> martis <-
[21:13] Buho-Transparente If you think a Q&A is wrong, please call an OP [21:13] Buho-Transparente
If you think a Q&A is wrong, please call an OP
[21:13] Buho-Transparente Tri.12656 Fisica-QuimicaɃort˿ComoqSEvLLAMAvLAvLEYvQUEvESTABLECEvLAvRELACIӎvENTREvLAvFUERZAvAPLICADAvAvUNvRESORTEvYvLAvELONGACIӎvPROVOCADAvPORvLAvACCIӎvDEvESAvFUERZAv?v [21:13] Buho-Transparente
Tri.12656 Fisica-QuimicaɃort˿ComoqSEvLLAMAvLAvLEYvQUEvESTABLECEvLAvRELACIӎvENTREvLAvFUERZAvAPLICADAvAvUNvRESORTEvYvLAvELONGACIӎvPROVOCADAvPORvLAvACCIӎvDEvESAvFUERZAv?v
[21:13] Buho-Transparente 1 Pista: *** ** ***** Pregunta de BONUS : 50000 Puntos [21:13] Buho-Transparente
1 Pista: *** ** ***** Pregunta de BONUS : 50000 Puntos
[21:13] Buho-Transparente 2 Pista: ley ** ***** 30 segundos y 50000 Puntos [21:13] Buho-Transparente
2 Pista: ley ** ***** 30 segundos y 50000 Puntos
[21:13] Buho-Transparente 3 Pista: ley *e *oo*e 15 segundos y 50000 Puntos [21:13] Buho-Transparente
3 Pista: ley *e *oo*e 15 segundos y 50000 Puntos
[21:13] Buho-Transparente Tiempo! La respuesta es -> ley�e�ooke <- [21:13] Buho-Transparente
Tiempo! La respuesta es -> ley�e�ooke <-
[21:14] Buho-Transparente R᮫ing por D́: - Domingo: TigreSinRespeto 8389382 Lunes: Ardilla\Insufrible 439202 Martes: Ardilla\Insufrible 3723143 Miercoles: Ardilla\Insufrible 2928711 Jueves: Flamenco-Real 511120 Viernes: Ardilla\Insufrible 3683447 Sᢡdo: * 0 [21:14] Buho-Transparente
R᮫ing por D́: - Domingo: TigreSinRespeto 8389382 Lunes: Ardilla\Insufrible 439202 Martes: Ardilla\Insufrible 3723143 Miercoles: Ardilla\Insufrible 2928711 Jueves: Flamenco-Real 511120 Viernes: Ardilla\Insufrible 3683447 Sᢡdo: * 0
[21:14] Buho-Transparente Tri.6550 Mitologiaɭartuniki˿DEIDADmROMANAmQUEmCUIDABAmAmLOSmNI񏓃01mDURMIENTESm?m [21:14] Buho-Transparente
Tri.6550 Mitologiaɭartuniki˿DEIDADmROMANAmQUEmCUIDABAmAmLOSmNI񏓃01mDURMIENTESm?m
[21:14] Buho-Transparente 1 Pista: **** Valor pregunta : 13331 Puntos [21:14] Buho-Transparente
1 Pista: **** Valor pregunta : 13331 Puntos
[21:14] Buho-Transparente 2 Pista: cub* 30 segundos y 13331 Puntos [21:14] Buho-Transparente
2 Pista: cub* 30 segundos y 13331 Puntos
[21:14] Avestruz-Feroz cuba [21:14] Avestruz-Feroz
cuba
[21:14] Buho-Transparente �Est᳠que lo tiras Avestruz-Feroz!! ߃󭯠supiste que "cuba" era la respuesta? Venga, �3331�12 puntos suben a tu marcador [21:14] Buho-Transparente
�Est᳠que lo tiras Avestruz-Feroz!! ߃󭯠supiste que "cuba" era la respuesta? Venga, �3331�12 puntos suben a tu marcador
[21:14] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [21:14] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[21:14] Buho-Transparente Avestruz-Feroz has acertado 5 seguidas!! Puntos HOY: 761419, SEMANA: 1986388 y MES: 1986388 [21:14] Buho-Transparente
Avestruz-Feroz has acertado 5 seguidas!! Puntos HOY: 761419, SEMANA: 1986388 y MES: 1986388
[21:14] Buho-Transparente For The Competitive Edge type !pingme [21:14] Buho-Transparente
For The Competitive Edge type !pingme
[21:14] Buho-Transparente Tri.17102 Cotilleo-TVɴjmm.com˿Engqu郰1kseriebaparec�01belupersonajebKuntabKinte?k?k [21:14] Buho-Transparente
Tri.17102 Cotilleo-TVɴjmm.com˿Engqu郰1kseriebaparec�01belupersonajebKuntabKinte?k?k
[21:14] Buho-Transparente 1 Pista: ****** Valor pregunta : 24697 Puntos [21:14] Buho-Transparente
1 Pista: ****** Valor pregunta : 24697 Puntos
[21:14] Buho-Transparente 2 Pista: rai*** 30 segundos y 24697 Puntos [21:14] Buho-Transparente
2 Pista: rai*** 30 segundos y 24697 Puntos
[21:15] Buho-Transparente 3 Pista: rai*e* 15 segundos y 24697 Puntos [21:15] Buho-Transparente
3 Pista: rai*e* 15 segundos y 24697 Puntos
[21:15] Buho-Transparente Tiempo! La respuesta es -> raices <- [21:15] Buho-Transparente
Tiempo! La respuesta es -> raices <-
[21:15] Buho-Transparente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [21:15] Buho-Transparente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[21:15] Buho-Transparente Tri.2614 InformaticaɻOpeR}˿Conwqueycombinacionwdeyteclaswseyconsiguey΃01w?w [21:15] Buho-Transparente
Tri.2614 InformaticaɻOpeR}˿Conwqueycombinacionwdeyteclaswseyconsiguey΃01w?w
[21:15] Buho-Transparente 1 Pista: *** *** Valor pregunta : 19261 Puntos [21:15] Buho-Transparente
1 Pista: *** *** Valor pregunta : 19261 Puntos
[21:15] Buho-Transparente 2 Pista: alt *** 30 segundos y 19261 Puntos [21:15] Buho-Transparente
2 Pista: alt *** 30 segundos y 19261 Puntos
[21:16] Buho-Transparente 3 Pista: alt *** 15 segundos y 19261 Puntos [21:16] Buho-Transparente
3 Pista: alt *** 15 segundos y 19261 Puntos
[21:16] Buho-Transparente Tiempo! La respuesta es -> alt�69 <- [21:16] Buho-Transparente
Tiempo! La respuesta es -> alt�69 <-
[21:16] Buho-Transparente R᮫ing MES: - #1: Ardilla\Insufrible 17065272 #2: Flamenco-Real 16796092 #3: Rana}ConTimidez 16651319 #4: TigreSinRespeto 15102023 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: Alitas 4100139 #8: SMAW 4012154 #9: LaCamelia 3029384 #10: Avestruz-Feroz 1986388 [21:16] Buho-Transparente
R᮫ing MES: - #1: Ardilla\Insufrible 17065272 #2: Flamenco-Real 16796092 #3: Rana}ConTimidez 16651319 #4: TigreSinRespeto 15102023 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: Alitas 4100139 #8: SMAW 4012154 #9: LaCamelia 3029384 #10: Avestruz-Feroz 1986388
[21:16] Buho-Transparente Tri.14261 Musicaɴjmm.com˿Envlosainiciosa(a񯳃01a60)wdeoqu郰1wcorrienteomusicalsfueronvfigurasaclaveoTerrywRileywywLayMonteoYounga?w [21:16] Buho-Transparente
Tri.14261 Musicaɴjmm.com˿Envlosainiciosa(a񯳃01a60)wdeoqu郰1wcorrienteomusicalsfueronvfigurasaclaveoTerrywRileywywLayMonteoYounga?w
[21:16] Buho-Transparente 1 Pista: *********** Valor pregunta : 7668 Puntos [21:16] Buho-Transparente
1 Pista: *********** Valor pregunta : 7668 Puntos
[21:16] Buho-Transparente 2 Pista: min******** 30 segundos y 7668 Puntos [21:16] Buho-Transparente
2 Pista: min******** 30 segundos y 7668 Puntos
[21:17] Buho-Transparente 3 Pista: mini*a*i**o 15 segundos y 7668 Puntos [21:17] Buho-Transparente
3 Pista: mini*a*i**o 15 segundos y 7668 Puntos
[21:17] Buho-Transparente Tiempo! La respuesta es -> minimalismo <- [21:17] Buho-Transparente
Tiempo! La respuesta es -> minimalismo <-
[21:17] Buho-Transparente Please refrain from using Extreme Bad Language [21:17] Buho-Transparente
Please refrain from using Extreme Bad Language
[21:17] Buho-Transparente Tri.9735 Personajesɴjmm.com˿Famosoyhispanistagingl鳃01vquehvivi󃰱henglasvAlpujarrasvgranadinas.h?h [21:17] Buho-Transparente
Tri.9735 Personajesɴjmm.com˿Famosoyhispanistagingl鳃01vquehvivi󃰱henglasvAlpujarrasvgranadinas.h?h
[21:17] Buho-Transparente 1 Pista: ****** ****** Valor pregunta : 12264 Puntos [21:17] Buho-Transparente
1 Pista: ****** ****** Valor pregunta : 12264 Puntos
[21:17] Buho-Transparente 2 Pista: ger*** ****** 30 segundos y 12264 Puntos [21:17] Buho-Transparente
2 Pista: ger*** ****** 30 segundos y 12264 Puntos
[21:18] Buho-Transparente 3 Pista: gera** **e*a* 15 segundos y 12264 Puntos [21:18] Buho-Transparente
3 Pista: gera** **e*a* 15 segundos y 12264 Puntos
[21:18] Buho-Transparente Tiempo! La respuesta es -> gerald�renan <- [21:18] Buho-Transparente
Tiempo! La respuesta es -> gerald�renan <-
[21:18] Buho-Transparente This is #Mexico, I am your host Buho-Transparente, running Buho-Transparente [21:18] Buho-Transparente
This is #Mexico, I am your host Buho-Transparente, running Buho-Transparente
[21:18] Buho-Transparente Tri.15202 Economiaɒandi˿Cuᬃ01wesfladmonedaddeiPer�?c?c [21:18] Buho-Transparente
Tri.15202 Economiaɒandi˿Cuᬃ01wesfladmonedaddeiPer�?c?c
[21:18] Buho-Transparente 1 Pista: ***** *** Valor pregunta : 21181 Puntos [21:18] Buho-Transparente
1 Pista: ***** *** Valor pregunta : 21181 Puntos
[21:18] Buho-Transparente 2 Pista: nue** *** 30 segundos y 21181 Puntos [21:18] Buho-Transparente
2 Pista: nue** *** 30 segundos y 21181 Puntos
[21:18] TigreSinRespeto nuevo sol [21:18] TigreSinRespeto
nuevo sol
[21:18] Buho-Transparente �Bien TigreSinRespeto!! Tu respuesta: "nuevo sol" es correcta y ganas �1181�12 puntos [21:18] Buho-Transparente
�Bien TigreSinRespeto!! Tu respuesta: "nuevo sol" es correcta y ganas �1181�12 puntos
[21:18] Buho-Transparente TigreSinRespeto has acertado 1 seguidas!! Puntos HOY: 1624227, SEMANA: 15123204 y MES: 15123204 [21:18] Buho-Transparente
TigreSinRespeto has acertado 1 seguidas!! Puntos HOY: 1624227, SEMANA: 15123204 y MES: 15123204
[21:18] Buho-Transparente This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Avestruz-Feroz 1986388 #13: Sirena__ 1207677 #14: LeCaTwaLk_z 1185079 #15: Chornobyl 873565 #16: etewsgy 695960 #17: kitana_- 692692 #18: julia__ 611502 #19: karen-62 535210 #20: AlbertoA 475137 [21:18] Buho-Transparente
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Avestruz-Feroz 1986388 #13: Sirena__ 1207677 #14: LeCaTwaLk_z 1185079 #15: Chornobyl 873565 #16: etewsgy 695960 #17: kitana_- 692692 #18: julia__ 611502 #19: karen-62 535210 #20: AlbertoA 475137
[21:18] Buho-Transparente Tri.15983 Personajesɖivian˿Adqu郰1dm�sicoqespa񯬃01yconcedi󃰱delypresidenteoKennedyylaemedallaepresidencialydeolaeLibertad?d?d [21:18] Buho-Transparente
Tri.15983 Personajesɖivian˿Adqu郰1dm�sicoqespa񯬃01yconcedi󃰱delypresidenteoKennedyylaemedallaepresidencialydeolaeLibertad?d?d
[21:18] Buho-Transparente 1 Pista: *** ****** Valor pregunta : 14419 Puntos [21:18] Buho-Transparente
1 Pista: *** ****** Valor pregunta : 14419 Puntos
[21:19] Buho-Transparente 2 Pista: pau ****** 30 segundos y 14419 Puntos [21:19] Buho-Transparente
2 Pista: pau ****** 30 segundos y 14419 Puntos
[21:19] Buho-Transparente 3 Pista: pau *a*a** 15 segundos y 14419 Puntos [21:19] Buho-Transparente
3 Pista: pau *a*a** 15 segundos y 14419 Puntos
[21:19] Buho-Transparente Tiempo! La respuesta es -> pau�asals <- [21:19] Buho-Transparente
Tiempo! La respuesta es -> pau�asals <-
[21:19] Buho-Transparente Please remember this is a FREE service, Please do not complain [21:19] Buho-Transparente
Please remember this is a FREE service, Please do not complain
[21:19] Buho-Transparente Tri.12343 Medicina-Saludɖivian˿Cuᬃ01heszlatvitaminatcuyond馩citsprovocatconjuntivitis?h?h [21:19] Buho-Transparente
Tri.12343 Medicina-Saludɖivian˿Cuᬃ01heszlatvitaminatcuyond馩citsprovocatconjuntivitis?h?h
[21:19] Buho-Transparente 1 Pista: ** ******** * Valor pregunta : 15391 Puntos [21:19] Buho-Transparente
1 Pista: ** ******** * Valor pregunta : 15391 Puntos
[21:20] Buho-Transparente 2 Pista: la�******* * 30 segundos y 15391 Puntos [21:20] Buho-Transparente
2 Pista: la�******* * 30 segundos y 15391 Puntos
[21:20] TigreSinRespeto la vitamina A [21:20] TigreSinRespeto
la vitamina A
[21:20] Buho-Transparente �Enhorabuena TigreSinRespeto!! Has contestado "la vitamina A" y por ello has ganado �5391�12 puntos [21:20] Buho-Transparente
�Enhorabuena TigreSinRespeto!! Has contestado "la vitamina A" y por ello has ganado �5391�12 puntos
[21:20] Buho-Transparente TigreSinRespeto has acertado 2 seguidas!! Puntos HOY: 1639618, SEMANA: 15138595 y MES: 15138595 [21:20] Buho-Transparente
TigreSinRespeto has acertado 2 seguidas!! Puntos HOY: 1639618, SEMANA: 15138595 y MES: 15138595
[21:20] Buho-Transparente This MONTHS Top 11-20: - #11: Sirena__ 938571 #12: Chornobyl 873565 #13: kitana_- 682987 #14: julia__ 611502 #15: Cubanito 581548 #16: karen-62 535210 #17: AlbertoA 475137 #18: KaZuMa_KiRyU 435575 #19: karen-53 342268 #20: karen- 298704 [21:20] Buho-Transparente
This MONTHS Top 11-20: - #11: Sirena__ 938571 #12: Chornobyl 873565 #13: kitana_- 682987 #14: julia__ 611502 #15: Cubanito 581548 #16: karen-62 535210 #17: AlbertoA 475137 #18: KaZuMa_KiRyU 435575 #19: karen-53 342268 #20: karen- 298704
[21:20] Buho-Transparente Tri.10224 LiteraturaɍARdeJAVA˕NAaDEaLASaFORMASaM�aBELLASaDEaLAaLITERATURAaJAPONESA:aSEaTRATAaDEaUNaPOEMAaCORTOaDEaDIECISIETEaS͌ABAS,aDISTRIBǗASaENaTRESaVERSOS.aSUELEaSERaUNaRELATOaDESCRIPTIVO,aCASIaSIEMPREaUNaPAISAJE.a߄EaQUɃ01aSEaTRATA?a?a [21:20] Buho-Transparente
Tri.10224 LiteraturaɍARdeJAVA˕NAaDEaLASaFORMASaM�aBELLASaDEaLAaLITERATURAaJAPONESA:aSEaTRATAaDEaUNaPOEMAaCORTOaDEaDIECISIETEaS͌ABAS,aDISTRIBǗASaENaTRESaVERSOS.aSUELEaSERaUNaRELATOaDESCRIPTIVO,aCASIaSIEMPREaUNaPAISAJE.a߄EaQUɃ01aSEaTRATA?a?a
[21:20] Buho-Transparente 1 Pista: ***** Valor pregunta : 22043 Puntos [21:20] Buho-Transparente
1 Pista: ***** Valor pregunta : 22043 Puntos
[21:20] Buho-Transparente 2 Pista: hai** 30 segundos y 22043 Puntos [21:20] Buho-Transparente
2 Pista: hai** 30 segundos y 22043 Puntos
[21:20] TigreSinRespeto haiku [21:20] TigreSinRespeto
haiku
[21:20] Buho-Transparente �Eso es TigreSinRespeto!! Dijiste: "haiku" y ello te ha valido: �2043�12 puntos [21:20] Buho-Transparente
�Eso es TigreSinRespeto!! Dijiste: "haiku" y ello te ha valido: �2043�12 puntos
[21:20] Buho-Transparente TigreSinRespeto has acertado 3 seguidas!! Puntos HOY: 1661661, SEMANA: 15160638 y MES: 15160638 [21:20] Buho-Transparente
TigreSinRespeto has acertado 3 seguidas!! Puntos HOY: 1661661, SEMANA: 15160638 y MES: 15160638
[21:20] Buho-Transparente R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [21:20] Buho-Transparente
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[21:20] Buho-Transparente Tri.17503 Medicina-SaludɄRAKULL˿Dondegsegformawlaweritropoyetina?a?a [21:20] Buho-Transparente
Tri.17503 Medicina-SaludɄRAKULL˿Dondegsegformawlaweritropoyetina?a?a
[21:20] Buho-Transparente 1 Pista: **񪪪* Valor pregunta : 21510 Puntos [21:20] Buho-Transparente
1 Pista: **񪪪* Valor pregunta : 21510 Puntos
[21:21] TigreSinRespeto ri񯮥s [21:21] TigreSinRespeto
ri񯮥s
[21:21] Buho-Transparente �Est᳠que lo tiras TigreSinRespeto!! ߃󭯠supiste que "ri񯮥s" era la respuesta? Venga, �1510�12 puntos suben a tu marcador [21:21] Buho-Transparente
�Est᳠que lo tiras TigreSinRespeto!! ߃󭯠supiste que "ri񯮥s" era la respuesta? Venga, �1510�12 puntos suben a tu marcador
[21:21] Buho-Transparente TigreSinRespeto has acertado 4 seguidas!! Puntos HOY: 1683171, SEMANA: 15182148 y MES: 15182148 [21:21] Buho-Transparente
TigreSinRespeto has acertado 4 seguidas!! Puntos HOY: 1683171, SEMANA: 15182148 y MES: 15182148
[21:21] Buho-Transparente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [21:21] Buho-Transparente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[21:21] Buho-Transparente Tri.5975 Idiomasɐsico666˰ersonaxqueqtomaxparteqenrunrcoloquiojojconversaci󮃰1r?s [21:21] Buho-Transparente
Tri.5975 Idiomasɐsico666˰ersonaxqueqtomaxparteqenrunrcoloquiojojconversaci󮃰1r?s
[21:21] Buho-Transparente 1 Pista: ********* Valor pregunta : 8352 Puntos [21:21] Buho-Transparente
1 Pista: ********* Valor pregunta : 8352 Puntos
[21:21] Buho-Transparente 2 Pista: col****** 30 segundos y 8352 Puntos [21:21] Buho-Transparente
2 Pista: col****** 30 segundos y 8352 Puntos
[21:21] TigreSinRespeto colocutor [21:21] TigreSinRespeto
colocutor
[21:21] Buho-Transparente �Enhorabuena TigreSinRespeto!! Has contestado "colocutor" y por ello has ganado �352�12 puntos [21:21] Buho-Transparente
�Enhorabuena TigreSinRespeto!! Has contestado "colocutor" y por ello has ganado �352�12 puntos
[21:21] Buho-Transparente TigreSinRespeto has acertado 5 seguidas!! Puntos HOY: 1691523, SEMANA: 15190500 y MES: 15190500 [21:21] Buho-Transparente
TigreSinRespeto has acertado 5 seguidas!! Puntos HOY: 1691523, SEMANA: 15190500 y MES: 15190500
[21:21] Buho-Transparente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [21:21] Buho-Transparente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[21:21] Buho-Transparente Tri.4546 Cancionesɤassler˿Degqui鮃01desl"Brilliantfdisguise"?n?n [21:21] Buho-Transparente
Tri.4546 Cancionesɤassler˿Degqui鮃01desl"Brilliantfdisguise"?n?n
[21:21] Buho-Transparente 1 Pista: ***** *********** Valor pregunta : 5100 Puntos [21:21] Buho-Transparente
1 Pista: ***** *********** Valor pregunta : 5100 Puntos
[21:22] Buho-Transparente 2 Pista: bru** *********** 30 segundos y 5100 Puntos [21:22] Buho-Transparente
2 Pista: bru** *********** 30 segundos y 5100 Puntos
[21:22] Buho-Transparente 3 Pista: bru*e ***i****ee* 15 segundos y 5100 Puntos [21:22] Buho-Transparente
3 Pista: bru*e ***i****ee* 15 segundos y 5100 Puntos
[21:22] Buho-Transparente Tiempo! La respuesta es -> bruce�pringsteen <- [21:22] Buho-Transparente
Tiempo! La respuesta es -> bruce�pringsteen <-
[21:22] Buho-Transparente R᮫ing SEMANA: - #1: Ardilla\Insufrible 20736835 #2: Flamenco-Real 19028808 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15190500 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154 [21:22] Buho-Transparente
R᮫ing SEMANA: - #1: Ardilla\Insufrible 20736835 #2: Flamenco-Real 19028808 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15190500 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154
[21:22] Buho-Transparente Tri.19596 Geografiaɭartuniki˿CIUDADoAFRICANAoFUNDADAoPORoLOSoBEREBERESoENoELoA񏃰1o1077oYoCERCANAoALoRiOoNiGERo?o [21:22] Buho-Transparente
Tri.19596 Geografiaɭartuniki˿CIUDADoAFRICANAoFUNDADAoPORoLOSoBEREBERESoENoELoA񏃰1o1077oYoCERCANAoALoRiOoNiGERo?o
[21:22] Buho-Transparente 1 Pista: ******** Valor pregunta : 8561 Puntos [21:22] Buho-Transparente
1 Pista: ******** Valor pregunta : 8561 Puntos
[21:23] Buho-Transparente 2 Pista: tom***** 30 segundos y 8561 Puntos [21:23] Buho-Transparente
2 Pista: tom***** 30 segundos y 8561 Puntos
[21:23] Buho-Transparente 3 Pista: tom*u**u 15 segundos y 8561 Puntos [21:23] Buho-Transparente
3 Pista: tom*u**u 15 segundos y 8561 Puntos
[21:23] Buho-Transparente Tiempo! La respuesta es -> tombuctu <- [21:23] Buho-Transparente
Tiempo! La respuesta es -> tombuctu <-
[21:23] Buho-Transparente We feature over 50,000 Q&A ! [21:23] Buho-Transparente
We feature over 50,000 Q&A !
[21:23] Buho-Transparente Tri.5616 DeporteɔDI˿CUALjERAjELjNOMBREjDEPORTIVOjDEjJOSEjANGELjRUIZj?j [21:23] Buho-Transparente
Tri.5616 DeporteɔDI˿CUALjERAjELjNOMBREjDEPORTIVOjDEjJOSEjANGELjRUIZj?j
[21:23] Buho-Transparente 1 Pista: ***** Valor pregunta : 11895 Puntos [21:23] Buho-Transparente
1 Pista: ***** Valor pregunta : 11895 Puntos
[21:24] Buho-Transparente 2 Pista: cho** 30 segundos y 11895 Puntos [21:24] Buho-Transparente
2 Pista: cho** 30 segundos y 11895 Puntos
[21:24] Buho-Transparente 3 Pista: cho*o 15 segundos y 11895 Puntos [21:24] Buho-Transparente
3 Pista: cho*o 15 segundos y 11895 Puntos
[21:24] Avestruz-Feroz choto [21:24] Avestruz-Feroz
choto
[21:24] Avestruz-Feroz chobo [21:24] Avestruz-Feroz
chobo
[21:24] Avestruz-Feroz choro [21:24] Avestruz-Feroz
choro
[21:24] Buho-Transparente Tiempo! La respuesta es -> cholo <- [21:24] Buho-Transparente
Tiempo! La respuesta es -> cholo <-
[21:24] Buho-Transparente R᮫ing de HOY: - #1: Ardilla\Insufrible 2947836 #2: TigreSinRespeto 1691523 #3: Avestruz-Feroz 761419 #4: Alitas 695281 #5: Flamenco-Real 253419 #6: Sirena__ 204402 #7: AlbertoA 143662 #8: kitana_- 139952 #9: Lord 100000 #10: Cubanito 21944 [21:24] Buho-Transparente
R᮫ing de HOY: - #1: Ardilla\Insufrible 2947836 #2: TigreSinRespeto 1691523 #3: Avestruz-Feroz 761419 #4: Alitas 695281 #5: Flamenco-Real 253419 #6: Sirena__ 204402 #7: AlbertoA 143662 #8: kitana_- 139952 #9: Lord 100000 #10: Cubanito 21944
[21:24] Buho-Transparente Tri.8945 Politicaɬatigoo˿Eniqu郰1jmesjyia񯃰1ksenfirm󃰱jelrTratadokdenlaaUni󮃰1iEuropeaa?j [21:24] Buho-Transparente
Tri.8945 Politicaɬatigoo˿Eniqu郰1jmesjyia񯃰1ksenfirm󃰱jelrTratadokdenlaaUni󮃰1iEuropeaa?j
[21:24] Buho-Transparente 1 Pista: ******* **** Valor pregunta : 13005 Puntos [21:24] Buho-Transparente
1 Pista: ******* **** Valor pregunta : 13005 Puntos
[21:24] Buho-Transparente 2 Pista: feb**** **** 30 segundos y 13005 Puntos [21:24] Buho-Transparente
2 Pista: feb**** **** 30 segundos y 13005 Puntos
[21:25] Buho-Transparente 3 Pista: feb*e*o **** 15 segundos y 13005 Puntos [21:25] Buho-Transparente
3 Pista: feb*e*o **** 15 segundos y 13005 Puntos
[21:25] Buho-Transparente Tiempo! La respuesta es -> febrero�992 <- [21:25] Buho-Transparente
Tiempo! La respuesta es -> febrero�992 <-
[21:25] Buho-Transparente Tri.10154 Musicaɲimrock˿"Guardameilastvacas"mestunalcomposicionddeimusicalclasicalpara,mqueiinstrumentoumusical"m?m [21:25] Buho-Transparente
Tri.10154 Musicaɲimrock˿"Guardameilastvacas"mestunalcomposicionddeimusicalclasicalpara,mqueiinstrumentoumusical"m?m
[21:25] Buho-Transparente 1 Pista: ******** Valor pregunta : 15285 Puntos [21:25] Buho-Transparente
1 Pista: ******** Valor pregunta : 15285 Puntos
[21:25] Buho-Transparente 2 Pista: gui***** 30 segundos y 15285 Puntos [21:25] Buho-Transparente
2 Pista: gui***** 30 segundos y 15285 Puntos
[21:26] Buho-Transparente 3 Pista: gui*a**a 15 segundos y 15285 Puntos [21:26] Buho-Transparente
3 Pista: gui*a**a 15 segundos y 15285 Puntos
[21:26] Avestruz-Feroz guitarra [21:26] Avestruz-Feroz
guitarra
[21:26] Buho-Transparente �Avestruz-Feroz acert󡡠La respuesta era: "guitarra" y contest󠥮 �2.922 segundos. Se lleva: �5285�12 puntos [21:26] Buho-Transparente
�Avestruz-Feroz acert󡡠La respuesta era: "guitarra" y contest󠥮 �2.922 segundos. Se lleva: �5285�12 puntos
[21:26] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [21:26] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[21:26] Buho-Transparente Avestruz-Feroz has acertado 1 seguidas!! Puntos HOY: 776704, SEMANA: 2001673 y MES: 2001673 [21:26] Buho-Transparente
Avestruz-Feroz has acertado 1 seguidas!! Puntos HOY: 776704, SEMANA: 2001673 y MES: 2001673
[21:26] Cocodrilo\ConBravura Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas [21:26] Cocodrilo\ConBravura
Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas
[21:26] Buho-Transparente Please remember this is a FREE service, Please do not complain [21:26] Buho-Transparente
Please remember this is a FREE service, Please do not complain
[21:26] Buho-Transparente Tri.19323 MusicaɓESINO˿Decqu郰1lgrupoqdecrockmesxellvocalistamChrisxRobinsonv?l [21:26] Buho-Transparente
Tri.19323 MusicaɓESINO˿Decqu郰1lgrupoqdecrockmesxellvocalistamChrisxRobinsonv?l
[21:26] Buho-Transparente 1 Pista: *** ***** ****** Valor pregunta : 15733 Puntos [21:26] Buho-Transparente
1 Pista: *** ***** ****** Valor pregunta : 15733 Puntos
[21:26] Buho-Transparente 2 Pista: the ***** ****** 30 segundos y 15733 Puntos [21:26] Buho-Transparente
2 Pista: the ***** ****** 30 segundos y 15733 Puntos
[21:26] Buho-Transparente 3 Pista: the **a** **o*e* 15 segundos y 15733 Puntos [21:26] Buho-Transparente
3 Pista: the **a** **o*e* 15 segundos y 15733 Puntos
[21:27] Buho-Transparente Tiempo! La respuesta es -> the�lack�rowes <- [21:27] Buho-Transparente
Tiempo! La respuesta es -> the�lack�rowes <-
[21:27] Buho-Transparente R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [21:27] Buho-Transparente
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[21:27] Buho-Transparente Tri.6453 Biologiaɐsico666ˡqueafamiliaypertenecenalaskcigalas?o?o [21:27] Buho-Transparente
Tri.6453 Biologiaɐsico666ˡqueafamiliaypertenecenalaskcigalas?o?o
[21:27] Buho-Transparente 1 Pista: ********** Valor pregunta : 23209 Puntos [21:27] Buho-Transparente
1 Pista: ********** Valor pregunta : 23209 Puntos
[21:27] Buho-Transparente 2 Pista: cru******* 30 segundos y 23209 Puntos [21:27] Buho-Transparente
2 Pista: cru******* 30 segundos y 23209 Puntos
[21:27] Buho-Transparente 3 Pista: cru**a*eo* 15 segundos y 23209 Puntos [21:27] Buho-Transparente
3 Pista: cru**a*eo* 15 segundos y 23209 Puntos
[21:27] Avestruz-Feroz crustaceos [21:27] Avestruz-Feroz
crustaceos
[21:27] Buho-Transparente �Suma y sigue Avestruz-Feroz!! La respuesta: "crustaceos" incrementa tu marcador en �3209�12 puntos [21:27] Buho-Transparente
�Suma y sigue Avestruz-Feroz!! La respuesta: "crustaceos" incrementa tu marcador en �3209�12 puntos
[21:27] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [21:27] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[21:27] Buho-Transparente Avestruz-Feroz has acertado 2 seguidas!! Puntos HOY: 799913, SEMANA: 2024882 y MES: 2024882 [21:27] Buho-Transparente
Avestruz-Feroz has acertado 2 seguidas!! Puntos HOY: 799913, SEMANA: 2024882 y MES: 2024882
[21:28] Buho-Transparente If you think a Q&A is wrong, please call an OP [21:28] Buho-Transparente
If you think a Q&A is wrong, please call an OP
[21:28] Buho-Transparente Tri.14912 Cancionesɴjmm.comˌapcanci󮃰1lm᳃01jconocidapdezMoodyrBlues.q?q [21:28] Buho-Transparente
Tri.14912 Cancionesɴjmm.comˌapcanci󮃰1lm᳃01jconocidapdezMoodyrBlues.q?q
[21:28] Buho-Transparente 1 Pista: ****** ** ***** ***** Valor pregunta : 23185 Puntos [21:28] Buho-Transparente
1 Pista: ****** ** ***** ***** Valor pregunta : 23185 Puntos
[21:28] Buho-Transparente 2 Pista: nig*** ** ***** ***** 30 segundos y 23185 Puntos [21:28] Buho-Transparente
2 Pista: nig*** ** ***** ***** 30 segundos y 23185 Puntos
[21:28] Buho-Transparente 3 Pista: nig*** i* **i*e *a*i* 15 segundos y 23185 Puntos [21:28] Buho-Transparente
3 Pista: nig*** i* **i*e *a*i* 15 segundos y 23185 Puntos
[21:28] Buho-Transparente Tiempo! La respuesta es -> nights�n�hite�atin <- [21:28] Buho-Transparente
Tiempo! La respuesta es -> nights�n�hite�atin <-
[21:29] Buho-Transparente R᮫ing por D́: - Domingo: TigreSinRespeto 8389382 Lunes: Ardilla\Insufrible 439202 Martes: Ardilla\Insufrible 3723143 Miercoles: Ardilla\Insufrible 2928711 Jueves: Flamenco-Real 511120 Viernes: Ardilla\Insufrible 3683447 Sᢡdo: * 0 [21:29] Buho-Transparente
R᮫ing por D́: - Domingo: TigreSinRespeto 8389382 Lunes: Ardilla\Insufrible 439202 Martes: Ardilla\Insufrible 3723143 Miercoles: Ardilla\Insufrible 2928711 Jueves: Flamenco-Real 511120 Viernes: Ardilla\Insufrible 3683447 Sᢡdo: * 0
[21:29] Buho-Transparente Tri.17788 GeografiaɍARdeJAVA˿ENcQUɃ01cPA͓cSEcHALLAcLAcCIUDADcDEcPERM?c?c [21:29] Buho-Transparente
Tri.17788 GeografiaɍARdeJAVA˿ENcQUɃ01cPA͓cSEcHALLAcLAcCIUDADcDEcPERM?c?c
[21:29] Buho-Transparente 1 Pista: ***** Valor pregunta : 13042 Puntos [21:29] Buho-Transparente
1 Pista: ***** Valor pregunta : 13042 Puntos
[21:29] Buho-Transparente 2 Pista: rus** 30 segundos y 13042 Puntos [21:29] Buho-Transparente
2 Pista: rus** 30 segundos y 13042 Puntos
[21:29] Buho-Transparente 3 Pista: rusia 15 segundos y 13042 Puntos [21:29] Buho-Transparente
3 Pista: rusia 15 segundos y 13042 Puntos
[21:29] Buho-Transparente Tiempo! La respuesta es -> rusia <- [21:29] Buho-Transparente
Tiempo! La respuesta es -> rusia <-
[21:29] Buho-Transparente For The Competitive Edge type !pingme [21:29] Buho-Transparente
For The Competitive Edge type !pingme
[21:29] Buho-Transparente Tri.4734 Miscelaneaɓebosin˿(Adivinanzas)Unawletrawconsonante,qunawvirtudrteologal,qsenmezclantypentuntinstantendantbebidawsingular?q?q [21:29] Buho-Transparente
Tri.4734 Miscelaneaɓebosin˿(Adivinanzas)Unawletrawconsonante,qunawvirtudrteologal,qsenmezclantypentuntinstantendantbebidawsingular?q?q
[21:29] Buho-Transparente 1 Pista: **** Pregunta de BONUS : 50000 Puntos [21:29] Buho-Transparente
1 Pista: **** Pregunta de BONUS : 50000 Puntos
[21:30] Buho-Transparente 2 Pista: caf* 30 segundos y 50000 Puntos [21:30] Buho-Transparente
2 Pista: caf* 30 segundos y 50000 Puntos
[21:30] Buho-Transparente 3 Pista: cafe 15 segundos y 50000 Puntos [21:30] Buho-Transparente
3 Pista: cafe 15 segundos y 50000 Puntos
[21:30] Avestruz-Feroz cafe [21:30] Avestruz-Feroz
cafe
[21:30] Buho-Transparente �Muy bien Avestruz-Feroz!! Acertaste "cafe" en tan s󬯠�4.594 segundos y por eso has ganado: �0000�12 puntos [21:30] Buho-Transparente
�Muy bien Avestruz-Feroz!! Acertaste "cafe" en tan s󬯠�4.594 segundos y por eso has ganado: �0000�12 puntos
[21:30] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [21:30] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[21:30] Buho-Transparente Avestruz-Feroz has acertado 3 seguidas!! Puntos HOY: 849913, SEMANA: 2074882 y MES: 2074882 [21:30] Buho-Transparente
Avestruz-Feroz has acertado 3 seguidas!! Puntos HOY: 849913, SEMANA: 2074882 y MES: 2074882
[21:30] Buho-Transparente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [21:30] Buho-Transparente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[21:30] Buho-Transparente Tri.19934 Cancionesɉngusetia˿DeyquienwesqelgtemanMissqSarajevon?i [21:30] Buho-Transparente
Tri.19934 Cancionesɉngusetia˿DeyquienwesqelgtemanMissqSarajevon?i
[21:30] Buho-Transparente 1 Pista: ** Valor pregunta : 8789 Puntos [21:30] Buho-Transparente
1 Pista: ** Valor pregunta : 8789 Puntos
[21:30] Buho-Transparente 2 Pista: u2 30 segundos y 8789 Puntos [21:30] Buho-Transparente
2 Pista: u2 30 segundos y 8789 Puntos
[21:31] Avestruz-Feroz u2 [21:31] Avestruz-Feroz
u2
[21:31] Buho-Transparente �Enhorabuena Avestruz-Feroz!! Has contestado "u2" y por ello has ganado �789�12 puntos [21:31] Buho-Transparente
�Enhorabuena Avestruz-Feroz!! Has contestado "u2" y por ello has ganado �789�12 puntos
[21:31] Buho-Transparente ACTION awards Avestruz-Feroz with a +v for having over 15000 points [21:31] Buho-Transparente
ACTION awards Avestruz-Feroz with a +v for having over 15000 points
[21:31] Buho-Transparente Avestruz-Feroz has acertado 4 seguidas!! Puntos HOY: 858702, SEMANA: 2083671 y MES: 2083671 [21:31] Buho-Transparente
Avestruz-Feroz has acertado 4 seguidas!! Puntos HOY: 858702, SEMANA: 2083671 y MES: 2083671
[21:31] Buho-Transparente R᮫ing MES: - #1: Ardilla\Insufrible 17065272 #2: Flamenco-Real 16796092 #3: Rana}ConTimidez 16651319 #4: TigreSinRespeto 15190500 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: Alitas 4100139 #8: SMAW 4012154 #9: LaCamelia 3029384 #10: Avestruz-Feroz 2074882 [21:31] Buho-Transparente
R᮫ing MES: - #1: Ardilla\Insufrible 17065272 #2: Flamenco-Real 16796092 #3: Rana}ConTimidez 16651319 #4: TigreSinRespeto 15190500 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: Alitas 4100139 #8: SMAW 4012154 #9: LaCamelia 3029384 #10: Avestruz-Feroz 2074882
[21:31] Buho-Transparente Tri.4560 Arteɳhanodin˿DeequienhesdobrahlahC�pulahdeeSantahMariahdeirFiorir?q [21:31] Buho-Transparente
Tri.4560 Arteɳhanodin˿DeequienhesdobrahlahC�pulahdeeSantahMariahdeirFiorir?q
[21:31] Buho-Transparente 1 Pista: ************ Valor pregunta : 16235 Puntos [21:31] Buho-Transparente
1 Pista: ************ Valor pregunta : 16235 Puntos
[21:31] Buho-Transparente 2 Pista: bru********* 30 segundos y 16235 Puntos [21:31] Buho-Transparente
2 Pista: bru********* 30 segundos y 16235 Puntos
[21:31] Buho-Transparente 3 Pista: bru*e**e***i 15 segundos y 16235 Puntos [21:31] Buho-Transparente
3 Pista: bru*e**e***i 15 segundos y 16235 Puntos
[21:31] Buho-Transparente Tiempo! La respuesta es -> brunelleschi <- [21:31] Buho-Transparente
Tiempo! La respuesta es -> brunelleschi <-
[21:32] Buho-Transparente Please refrain from using Extreme Bad Language [21:32] Buho-Transparente
Please refrain from using Extreme Bad Language
[21:32] Buho-Transparente Tri.14628 ArteɍARdeJAVA˿CӍOeSEeLLAMӃ01eELeGRUPOeDEePINTORESeFRANCESESeDEeLAeڌTIMAeDɃADAeDELeSIGLOeXIX,eCUYOeNOMBREeSIGNIFICAeENeHEBREOe"PROFETA",eYeQUEeUTILIZARONeELeCROMATISMOeDEeLOSeIMPRESIONISTASeJUNTOeCONeLASeEVOCACIONESeDEeLOSeSIMBOLISTAS?e?e [21:32] Buho-Transparente
Tri.14628 ArteɍARdeJAVA˿CӍOeSEeLLAMӃ01eELeGRUPOeDEePINTORESeFRANCESESeDEeLAeڌTIMAeDɃADAeDELeSIGLOeXIX,eCUYOeNOMBREeSIGNIFICAeENeHEBREOe"PROFETA",eYeQUEeUTILIZARONeELeCROMATISMOeDEeLOSeIMPRESIONISTASeJUNTOeCONeLASeEVOCACIONESeDEeLOSeSIMBOLISTAS?e?e
[21:32] Buho-Transparente 1 Pista: **** Valor pregunta : 13367 Puntos [21:32] Buho-Transparente
1 Pista: **** Valor pregunta : 13367 Puntos
[21:32] Buho-Transparente 2 Pista: nab* 30 segundos y 13367 Puntos [21:32] Buho-Transparente
2 Pista: nab* 30 segundos y 13367 Puntos
[21:32] Buho-Transparente 3 Pista: nabi 15 segundos y 13367 Puntos [21:32] Buho-Transparente
3 Pista: nabi 15 segundos y 13367 Puntos
[21:32] Buho-Transparente Tiempo! La respuesta es -> nabi <- [21:32] Buho-Transparente
Tiempo! La respuesta es -> nabi <-
[21:33] Buho-Transparente This is #Mexico, I am your host Buho-Transparente, running Buho-Transparente [21:33] Buho-Transparente
This is #Mexico, I am your host Buho-Transparente, running Buho-Transparente
[21:33] Buho-Transparente Tri.4781 CienciaɁigua˿Comowsebdenominaeeljdiametrowdeljca񳮃01zenzlasaarmasadebfuegow?f [21:33] Buho-Transparente
Tri.4781 CienciaɁigua˿Comowsebdenominaeeljdiametrowdeljca񳮃01zenzlasaarmasadebfuegow?f
[21:33] Buho-Transparente 1 Pista: ******* Pregunta de BONUS : 25000 Puntos [21:33] Buho-Transparente
1 Pista: ******* Pregunta de BONUS : 25000 Puntos
[21:33] Buho-Transparente 2 Pista: cal**** 30 segundos y 25000 Puntos [21:33] Buho-Transparente
2 Pista: cal**** 30 segundos y 25000 Puntos
[21:33] Buho-Transparente 3 Pista: cali**e 15 segundos y 25000 Puntos [21:33] Buho-Transparente
3 Pista: cali**e 15 segundos y 25000 Puntos
[21:33] Buho-Transparente Tiempo! La respuesta es -> calibre <- [21:33] Buho-Transparente
Tiempo! La respuesta es -> calibre <-
[21:34] Buho-Transparente This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Avestruz-Feroz 2083671 #13: Sirena__ 1207677 #14: LeCaTwaLk_z 1185079 #15: Chornobyl 873565 #16: etewsgy 695960 #17: kitana_- 692692 #18: julia__ 611502 #19: karen-62 535210 #20: AlbertoA 475137 [21:34] Buho-Transparente
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Avestruz-Feroz 2083671 #13: Sirena__ 1207677 #14: LeCaTwaLk_z 1185079 #15: Chornobyl 873565 #16: etewsgy 695960 #17: kitana_- 692692 #18: julia__ 611502 #19: karen-62 535210 #20: AlbertoA 475137
[21:34] Buho-Transparente Tri.1791 Informaticaɴjmm.com˿C󭯃01jsexllamapelnping�inojmascotapdexLinux?u?u [21:34] Buho-Transparente
Tri.1791 Informaticaɴjmm.com˿C󭯃01jsexllamapelnping�inojmascotapdexLinux?u?u
[21:34] Buho-Transparente 1 Pista: *** Valor pregunta : 23396 Puntos [21:34] Buho-Transparente
1 Pista: *** Valor pregunta : 23396 Puntos
[21:34] Ardilla\Insufrible ahhhhh miiiii pierrrrnaaaaaa [21:34] Ardilla\Insufrible
ahhhhh miiiii pierrrrnaaaaaa
[21:34] Ardilla\Insufrible mi piernaaaa [21:34] Ardilla\Insufrible
mi piernaaaa
[21:34] Ardilla\Insufrible jajajajaja [21:34] Ardilla\Insufrible
jajajajaja
[21:34] Buho-Transparente 2 Pista: Tux 30 segundos y 23396 Puntos [21:34] Buho-Transparente
2 Pista: Tux 30 segundos y 23396 Puntos
[21:34] Ardilla\Insufrible tux [21:34] Ardilla\Insufrible
tux
[21:34] Buho-Transparente �Bingo!! Ardilla\Insufrible dio la respuesta: "tux" en �8.438 segundos e incrementa sus ganancias con �3396�12 puntos [21:34] Buho-Transparente
�Bingo!! Ardilla\Insufrible dio la respuesta: "tux" en �8.438 segundos e incrementa sus ganancias con �3396�12 puntos
[21:34] Buho-Transparente ACTION awards Ardilla\Insufrible with a +v for having over 15000 points [21:34] Buho-Transparente
ACTION awards Ardilla\Insufrible with a +v for having over 15000 points
[21:34] Buho-Transparente Ardilla\Insufrible has acertado 1 seguidas!! Puntos HOY: 2971232, SEMANA: 20760231 y MES: 17088668 [21:34] Buho-Transparente
Ardilla\Insufrible has acertado 1 seguidas!! Puntos HOY: 2971232, SEMANA: 20760231 y MES: 17088668
[21:34] Buho-Transparente Please remember this is a FREE service, Please do not complain [21:34] Buho-Transparente
Please remember this is a FREE service, Please do not complain
[21:34] Buho-Transparente Tri.19509 Mitologiaɭartuniki˿DIOSwAZTECAwDEwLAwLLUVIAw?w [21:34] Buho-Transparente
Tri.19509 Mitologiaɭartuniki˿DIOSwAZTECAwDEwLAwLLUVIAw?w
[21:34] Buho-Transparente 1 Pista: ****** Valor pregunta : 17207 Puntos [21:34] Buho-Transparente
1 Pista: ****** Valor pregunta : 17207 Puntos
[21:34] Ardilla\Insufrible tlaloc [21:34] Ardilla\Insufrible
tlaloc
[21:34] Buho-Transparente �emuestra lo que sabes Ardilla\Insufrible! Has respondido "tlaloc" correctamente y eso te da: �7207�12 puntos [21:34] Buho-Transparente
�emuestra lo que sabes Ardilla\Insufrible! Has respondido "tlaloc" correctamente y eso te da: �7207�12 puntos
[21:34] Buho-Transparente ACTION awards Ardilla\Insufrible with a +v for having over 15000 points [21:34] Buho-Transparente
ACTION awards Ardilla\Insufrible with a +v for having over 15000 points
[21:34] Buho-Transparente Ardilla\Insufrible has acertado 2 seguidas!! Puntos HOY: 2988439, SEMANA: 20777438 y MES: 17105875 [21:34] Buho-Transparente
Ardilla\Insufrible has acertado 2 seguidas!! Puntos HOY: 2988439, SEMANA: 20777438 y MES: 17105875
[21:34] Buho-Transparente This MONTHS Top 11-20: - #11: Sirena__ 938571 #12: Chornobyl 873565 #13: kitana_- 682987 #14: julia__ 611502 #15: Cubanito 581548 #16: karen-62 535210 #17: AlbertoA 475137 #18: KaZuMa_KiRyU 435575 #19: karen-53 342268 #20: karen- 298704 [21:34] Buho-Transparente
This MONTHS Top 11-20: - #11: Sirena__ 938571 #12: Chornobyl 873565 #13: kitana_- 682987 #14: julia__ 611502 #15: Cubanito 581548 #16: karen-62 535210 #17: AlbertoA 475137 #18: KaZuMa_KiRyU 435575 #19: karen-53 342268 #20: karen- 298704
[21:34] Buho-Transparente Tri.6211 Medicina-SaludɁlkaid˿CONqQUEqTIPOqDEqLENTESqSEqCORRIGEqLAqHIPERMETROPIA?q?q [21:34] Buho-Transparente
Tri.6211 Medicina-SaludɁlkaid˿CONqQUEqTIPOqDEqLENTESqSEqCORRIGEqLAqHIPERMETROPIA?q?q
[21:34] Buho-Transparente 1 Pista: ************ Pregunta de BONUS : 50000 Puntos [21:34] Buho-Transparente
1 Pista: ************ Pregunta de BONUS : 50000 Puntos
[21:35] Buho-Transparente 2 Pista: con********* 30 segundos y 50000 Puntos [21:35] Buho-Transparente
2 Pista: con********* 30 segundos y 50000 Puntos
[21:35] Buho-Transparente 3 Pista: con*e**e**e* 15 segundos y 50000 Puntos [21:35] Buho-Transparente
3 Pista: con*e**e**e* 15 segundos y 50000 Puntos
[21:35] Buho-Transparente Tiempo! La respuesta es -> convergentes <- [21:35] Buho-Transparente
Tiempo! La respuesta es -> convergentes <-
[21:35] Buho-Transparente R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [21:35] Buho-Transparente
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[21:35] Buho-Transparente Tri.6244 GeografiaɔeLaRaNhA˿C󭯃01iseillamasactualmenteilasciudadcdeiCorduba?g?g [21:35] Buho-Transparente
Tri.6244 GeografiaɔeLaRaNhA˿C󭯃01iseillamasactualmenteilasciudadcdeiCorduba?g?g
[21:35] Buho-Transparente 1 Pista: ******* Pregunta de BONUS : 25000 Puntos [21:35] Buho-Transparente
1 Pista: ******* Pregunta de BONUS : 25000 Puntos
[21:35] Buho-Transparente 2 Pista: cor**** 30 segundos y 25000 Puntos [21:35] Buho-Transparente
2 Pista: cor**** 30 segundos y 25000 Puntos
[21:36] TigreSinRespeto nooo vidaaaaaaaaaaa [21:36] TigreSinRespeto
nooo vidaaaaaaaaaaa
[21:36] Buho-Transparente 3 Pista: cor*o*a 15 segundos y 25000 Puntos [21:36] Buho-Transparente
3 Pista: cor*o*a 15 segundos y 25000 Puntos
[21:36] Buho-Transparente Tiempo! La respuesta es -> cordoba <- [21:36] Buho-Transparente
Tiempo! La respuesta es -> cordoba <-
[21:36] Buho-Transparente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [21:36] Buho-Transparente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[21:36] Buho-Transparente Tri.5315 Economiaɬusieˍonedasxdeltmundo:yMonedajdesGhanaj?y [21:36] Buho-Transparente
Tri.5315 Economiaɬusieˍonedasxdeltmundo:yMonedajdesGhanaj?y
[21:36] Buho-Transparente 1 Pista: **** Valor pregunta : 9538 Puntos [21:36] Buho-Transparente
1 Pista: **** Valor pregunta : 9538 Puntos
[21:36] Buho-Transparente 2 Pista: ced* 30 segundos y 9538 Puntos [21:36] Buho-Transparente
2 Pista: ced* 30 segundos y 9538 Puntos
[21:37] Buho-Transparente 3 Pista: cedi 15 segundos y 9538 Puntos [21:37] Buho-Transparente
3 Pista: cedi 15 segundos y 9538 Puntos
[21:37] Buho-Transparente Tiempo! La respuesta es -> cedi <- [21:37] Buho-Transparente
Tiempo! La respuesta es -> cedi <-
[21:37] Buho-Transparente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [21:37] Buho-Transparente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[21:37] Buho-Transparente Tri.4028 CineɅLCHUPAO˿COMOgSEgLLAMAgELgACTORgQUEgHIZOgDEgMORTADELOg?g [21:37] Buho-Transparente
Tri.4028 CineɅLCHUPAO˿COMOgSEgLLAMAgELgACTORgQUEgHIZOgDEgMORTADELOg?g
[21:37] Buho-Transparente 1 Pista: ****** ****** Pregunta de BONUS : 100000 Puntos [21:37] Buho-Transparente
1 Pista: ****** ****** Pregunta de BONUS : 100000 Puntos
[21:37] Buho-Transparente 2 Pista: ben*** ****** 30 segundos y 100000 Puntos [21:37] Buho-Transparente
2 Pista: ben*** ****** 30 segundos y 100000 Puntos
[21:38] Buho-Transparente 3 Pista: beni*o *o*i*o 15 segundos y 100000 Puntos [21:38] Buho-Transparente
3 Pista: beni*o *o*i*o 15 segundos y 100000 Puntos
[21:38] Buho-Transparente Tiempo! La respuesta es -> benito�ocino <- [21:38] Buho-Transparente
Tiempo! La respuesta es -> benito�ocino <-
[21:38] Buho-Transparente R᮫ing SEMANA: - #1: Ardilla\Insufrible 20777438 #2: Flamenco-Real 19028808 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15190500 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154 [21:38] Buho-Transparente
R᮫ing SEMANA: - #1: Ardilla\Insufrible 20777438 #2: Flamenco-Real 19028808 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15190500 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154
[21:38] Buho-Transparente Tri.2394 MusicaɃort˿DondenbuscabancpisoaTarzancydsuuputarmadren?c [21:38] Buho-Transparente
Tri.2394 MusicaɃort˿DondenbuscabancpisoaTarzancydsuuputarmadren?c
[21:38] Buho-Transparente 1 Pista: ********** Valor pregunta : 24539 Puntos [21:38] Buho-Transparente
1 Pista: ********** Valor pregunta : 24539 Puntos
[21:38] Buho-Transparente 2 Pista: alc******* 30 segundos y 24539 Puntos [21:38] Buho-Transparente
2 Pista: alc******* 30 segundos y 24539 Puntos
[21:38] Buho-Transparente 3 Pista: alco*e**a* 15 segundos y 24539 Puntos [21:38] Buho-Transparente
3 Pista: alco*e**a* 15 segundos y 24539 Puntos
[21:39] Buho-Transparente Tiempo! La respuesta es -> alcobendas <- [21:39] Buho-Transparente
Tiempo! La respuesta es -> alcobendas <-
[21:39] Buho-Transparente We feature over 50,000 Q&A ! [21:39] Buho-Transparente
We feature over 50,000 Q&A !
[21:39] Buho-Transparente Tri.3795 ArteɊAVEA˿1-2-1900:mENmQUEmCIUDADmCELEBRAmPABLOmPICASSOmSUmPRIMERAmEXPOSICIONmINDIVIDUALm?m [21:39] Buho-Transparente
Tri.3795 ArteɊAVEA˿1-2-1900:mENmQUEmCIUDADmCELEBRAmPABLOmPICASSOmSUmPRIMERAmEXPOSICIONmINDIVIDUALm?m
[21:39] Buho-Transparente 1 Pista: ********* Valor pregunta : 20083 Puntos [21:39] Buho-Transparente
1 Pista: ********* Valor pregunta : 20083 Puntos
[21:39] Buho-Transparente 2 Pista: bar****** 30 segundos y 20083 Puntos [21:39] Buho-Transparente
2 Pista: bar****** 30 segundos y 20083 Puntos
[21:39] Buho-Transparente 3 Pista: bar*e*o*a 15 segundos y 20083 Puntos [21:39] Buho-Transparente
3 Pista: bar*e*o*a 15 segundos y 20083 Puntos
[21:40] Buho-Transparente Tiempo! La respuesta es -> barcelona <- [21:40] Buho-Transparente
Tiempo! La respuesta es -> barcelona <-
[21:40] Buho-Transparente R᮫ing de HOY: - #1: Ardilla\Insufrible 2988439 #2: TigreSinRespeto 1691523 #3: Avestruz-Feroz 858702 #4: Alitas 695281 #5: Flamenco-Real 253419 #6: Sirena__ 204402 #7: AlbertoA 143662 #8: kitana_- 139952 #9: Lord 100000 #10: Cubanito 21944 [21:40] Buho-Transparente
R᮫ing de HOY: - #1: Ardilla\Insufrible 2988439 #2: TigreSinRespeto 1691523 #3: Avestruz-Feroz 858702 #4: Alitas 695281 #5: Flamenco-Real 253419 #6: Sirena__ 204402 #7: AlbertoA 143662 #8: kitana_- 139952 #9: Lord 100000 #10: Cubanito 21944
[21:40] Buho-Transparente Tri.20241 Biologiaɐsico666ˣonchaqdellosomoluscoso?w [21:40] Buho-Transparente
Tri.20241 Biologiaɐsico666ˣonchaqdellosomoluscoso?w
[21:40] Buho-Transparente 1 Pista: ***** Valor pregunta : 18934 Puntos [21:40] Buho-Transparente
1 Pista: ***** Valor pregunta : 18934 Puntos
[21:40] Buho-Transparente 2 Pista: val** 30 segundos y 18934 Puntos [21:40] Buho-Transparente
2 Pista: val** 30 segundos y 18934 Puntos
[21:40] Buho-Transparente 3 Pista: val*a 15 segundos y 18934 Puntos [21:40] Buho-Transparente
3 Pista: val*a 15 segundos y 18934 Puntos
[21:41] Buho-Transparente Tiempo! La respuesta es -> valva <- [21:41] Buho-Transparente
Tiempo! La respuesta es -> valva <-
[21:41] Buho-Transparente Tri.8143 EconomiaɊarreando˿C󭯃01csevdenominadlademisi󮃰1odevunot�locbajocladparorecibi鮤osevalivencimientocsunvaloronominal?i?i [21:41] Buho-Transparente
Tri.8143 EconomiaɊarreando˿C󭯃01csevdenominadlademisi󮃰1odevunot�locbajocladparorecibi鮤osevalivencimientocsunvaloronominal?i?i
[21:41] Buho-Transparente 1 Pista: ******* ** ********* * ** ***** Valor pregunta : 9646 Puntos [21:41] Buho-Transparente
1 Pista: ******* ** ********* * ** ***** Valor pregunta : 9646 Puntos
[21:41] Buho-Transparente 2 Pista: emi**** ** ********* * ** ***** 30 segundos y 9646 Puntos [21:41] Buho-Transparente
2 Pista: emi**** ** ********* * ** ***** 30 segundos y 9646 Puntos
[21:41] Buho-Transparente 3 Pista: emi*io* a* *e**ue**o o a* *i*o* 15 segundos y 9646 Puntos [21:41] Buho-Transparente
3 Pista: emi*io* a* *e**ue**o o a* *i*o* 15 segundos y 9646 Puntos
[21:41] Buho-Transparente Tiempo! La respuesta es -> emision�l�escuento��l�iron <- [21:41] Buho-Transparente
Tiempo! La respuesta es -> emision�l�escuento��l�iron <-
[21:42] Buho-Transparente Please remember this is a FREE service, Please do not complain [21:42] Buho-Transparente
Please remember this is a FREE service, Please do not complain
[21:42] Buho-Transparente Tri.5593 GeografiaɍARdeJAVA˿CU�eESeLAeTERCERAeISLAeM�eGRANDEeDELeMEDITERR�EO?e?e [21:42] Buho-Transparente
Tri.5593 GeografiaɍARdeJAVA˿CU�eESeLAeTERCERAeISLAeM�eGRANDEeDELeMEDITERR�EO?e?e
[21:42] Buho-Transparente 1 Pista: ****** Valor pregunta : 7265 Puntos [21:42] Buho-Transparente
1 Pista: ****** Valor pregunta : 7265 Puntos
[21:42] Buho-Transparente 2 Pista: chi*** 30 segundos y 7265 Puntos [21:42] Buho-Transparente
2 Pista: chi*** 30 segundos y 7265 Puntos
[21:42] Buho-Transparente 3 Pista: chi**e 15 segundos y 7265 Puntos [21:42] Buho-Transparente
3 Pista: chi**e 15 segundos y 7265 Puntos
[21:42] Buho-Transparente Tiempo! La respuesta es -> chipre <- [21:42] Buho-Transparente
Tiempo! La respuesta es -> chipre <-
[21:43] Buho-Transparente R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [21:43] Buho-Transparente
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[21:43] Buho-Transparente Tri.6023 Gastronomiaɡligator_˿AjQUEjSEMILLAjCASIjNADIEjLEjDAjIMPORTANCIAj?j [21:43] Buho-Transparente
Tri.6023 Gastronomiaɡligator_˿AjQUEjSEMILLAjCASIjNADIEjLEjDAjIMPORTANCIAj?j
[21:43] Buho-Transparente 1 Pista: ****** Valor pregunta : 11884 Puntos [21:43] Buho-Transparente
1 Pista: ****** Valor pregunta : 11884 Puntos
[21:43] Buho-Transparente 2 Pista: com*** 30 segundos y 11884 Puntos [21:43] Buho-Transparente
2 Pista: com*** 30 segundos y 11884 Puntos
[21:43] Ardilla\Insufrible comino [21:43] Ardilla\Insufrible
comino
[21:43] Buho-Transparente �Increible!! Ardilla\Insufrible contest󺠃04"comino" en �0.39 segundos, y ha ganado �1884�12 puntos [21:43] Buho-Transparente
�Increible!! Ardilla\Insufrible contest󺠃04"comino" en �0.39 segundos, y ha ganado �1884�12 puntos
[21:43] Buho-Transparente ACTION awards Ardilla\Insufrible with a +v for having over 15000 points [21:43] Buho-Transparente
ACTION awards Ardilla\Insufrible with a +v for having over 15000 points
[21:43] Buho-Transparente Ardilla\Insufrible has acertado 3 seguidas!! Puntos HOY: 3000323, SEMANA: 20789322 y MES: 17117759 [21:43] Buho-Transparente
Ardilla\Insufrible has acertado 3 seguidas!! Puntos HOY: 3000323, SEMANA: 20789322 y MES: 17117759
[21:43] Buho-Transparente If you think a Q&A is wrong, please call an OP [21:43] Buho-Transparente
If you think a Q&A is wrong, please call an OP
[21:43] Buho-Transparente Tri.548 Fisica-Quimicaɫosako˿EneKm./seg.x...ߡgqueqvelocidadwseqpropagaglagluzxeneelevac�01n?x [21:43] Buho-Transparente
Tri.548 Fisica-Quimicaɫosako˿EneKm./seg.x...ߡgqueqvelocidadwseqpropagaglagluzxeneelevac�01n?x
[21:43] Buho-Transparente 1 Pista: ****** Valor pregunta : 5712 Puntos [21:43] Buho-Transparente
1 Pista: ****** Valor pregunta : 5712 Puntos
[21:43] Buho-Transparente 2 Pista: 299*** 30 segundos y 5712 Puntos [21:43] Buho-Transparente
2 Pista: 299*** 30 segundos y 5712 Puntos
[21:44] Buho-Transparente 3 Pista: 299*** 15 segundos y 5712 Puntos [21:44] Buho-Transparente
3 Pista: 299*** 15 segundos y 5712 Puntos
[21:44] Buho-Transparente Tiempo! La respuesta es -> 299793 <- [21:44] Buho-Transparente
Tiempo! La respuesta es -> 299793 <-
[21:44] Buho-Transparente R᮫ing por D́: - Domingo: TigreSinRespeto 8389382 Lunes: Ardilla\Insufrible 439202 Martes: Ardilla\Insufrible 3723143 Miercoles: Ardilla\Insufrible 2928711 Jueves: Flamenco-Real 511120 Viernes: Ardilla\Insufrible 3683447 Sᢡdo: * 0 [21:44] Buho-Transparente
R᮫ing por D́: - Domingo: TigreSinRespeto 8389382 Lunes: Ardilla\Insufrible 439202 Martes: Ardilla\Insufrible 3723143 Miercoles: Ardilla\Insufrible 2928711 Jueves: Flamenco-Real 511120 Viernes: Ardilla\Insufrible 3683447 Sᢡdo: * 0
[21:44] Buho-Transparente Tri.14323 Miscelaneaɐsico666ˣonjuntoadehmueblesadehunatcasat?u [21:44] Buho-Transparente
Tri.14323 Miscelaneaɐsico666ˣonjuntoadehmueblesadehunatcasat?u
[21:44] Buho-Transparente 1 Pista: ********** Valor pregunta : 19458 Puntos [21:44] Buho-Transparente
1 Pista: ********** Valor pregunta : 19458 Puntos
[21:44] Buho-Transparente 2 Pista: mob******* 30 segundos y 19458 Puntos [21:44] Buho-Transparente
2 Pista: mob******* 30 segundos y 19458 Puntos
[21:45] Buho-Transparente 3 Pista: mobi*ia*io 15 segundos y 19458 Puntos [21:45] Buho-Transparente
3 Pista: mobi*ia*io 15 segundos y 19458 Puntos
[21:45] Buho-Transparente Tiempo! La respuesta es -> mobiliario <- [21:45] Buho-Transparente
Tiempo! La respuesta es -> mobiliario <-
[21:45] Buho-Transparente For The Competitive Edge type !pingme [21:45] Buho-Transparente
For The Competitive Edge type !pingme
[21:45] Buho-Transparente Tri.17166 Arteɋirei˿ENzQUevCIUDADzSEzENCUENTRAzELz"MAUSOLEOzDEzGALAzPLACIDIA"z?z [21:45] Buho-Transparente
Tri.17166 Arteɋirei˿ENzQUevCIUDADzSEzENCUENTRAzELz"MAUSOLEOzDEzGALAzPLACIDIA"z?z
[21:45] Buho-Transparente 1 Pista: ****** Valor pregunta : 17893 Puntos [21:45] Buho-Transparente
1 Pista: ****** Valor pregunta : 17893 Puntos
[21:45] Buho-Transparente 2 Pista: rav*** 30 segundos y 17893 Puntos [21:45] Buho-Transparente
2 Pista: rav*** 30 segundos y 17893 Puntos
[21:45] Buho-Transparente 3 Pista: rave*a 15 segundos y 17893 Puntos [21:45] Buho-Transparente
3 Pista: rave*a 15 segundos y 17893 Puntos
[21:46] Buho-Transparente Tiempo! La respuesta es -> ravena <- [21:46] Buho-Transparente
Tiempo! La respuesta es -> ravena <-
[21:46] Buho-Transparente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [21:46] Buho-Transparente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[21:46] Buho-Transparente Tri.3260 Fisica-QuimicaɎEVIVA˿COMOrSErLLAMANrArLOSrHIDROCARBUROSrDERIVADOSrDELrBENCENO?r?r [21:46] Buho-Transparente
Tri.3260 Fisica-QuimicaɎEVIVA˿COMOrSErLLAMANrArLOSrHIDROCARBUROSrDERIVADOSrDELrBENCENO?r?r
[21:46] Buho-Transparente 1 Pista: ********** Valor pregunta : 8385 Puntos [21:46] Buho-Transparente
1 Pista: ********** Valor pregunta : 8385 Puntos
[21:46] Cocodrilo\ConBravura Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas [21:46] Cocodrilo\ConBravura
Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas
[21:46] Buho-Transparente 2 Pista: aro******* 30 segundos y 8385 Puntos [21:46] Buho-Transparente
2 Pista: aro******* 30 segundos y 8385 Puntos
[21:46] Buho-Transparente 3 Pista: aro*a*i*o* 15 segundos y 8385 Puntos [21:46] Buho-Transparente
3 Pista: aro*a*i*o* 15 segundos y 8385 Puntos
[21:47] Buho-Transparente Tiempo! La respuesta es -> aromaticos <- [21:47] Buho-Transparente
Tiempo! La respuesta es -> aromaticos <-
[21:47] Buho-Transparente R᮫ing MES: - #1: Ardilla\Insufrible 17117759 #2: Flamenco-Real 16796092 #3: Rana}ConTimidez 16651319 #4: TigreSinRespeto 15190500 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: Alitas 4100139 #8: SMAW 4012154 #9: LaCamelia 3029384 #10: Avestruz-Feroz 2083671 [21:47] Buho-Transparente
R᮫ing MES: - #1: Ardilla\Insufrible 17117759 #2: Flamenco-Real 16796092 #3: Rana}ConTimidez 16651319 #4: TigreSinRespeto 15190500 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: Alitas 4100139 #8: SMAW 4012154 #9: LaCamelia 3029384 #10: Avestruz-Feroz 2083671
[21:47] Buho-Transparente Tri.19022 Geografiaɓebosin˿Desqu郰1gr�01mdesEspa񡃰1beswafluenteselcAlmonte?g?g [21:47] Buho-Transparente
Tri.19022 Geografiaɓebosin˿Desqu郰1gr�01mdesEspa񡃰1beswafluenteselcAlmonte?g?g
[21:47] Buho-Transparente 1 Pista: **** Valor pregunta : 13906 Puntos [21:47] Buho-Transparente
1 Pista: **** Valor pregunta : 13906 Puntos
[21:47] Buho-Transparente 2 Pista: taj* 30 segundos y 13906 Puntos [21:47] Buho-Transparente
2 Pista: taj* 30 segundos y 13906 Puntos
[21:47] Buho-Transparente 3 Pista: tajo 15 segundos y 13906 Puntos [21:47] Buho-Transparente
3 Pista: tajo 15 segundos y 13906 Puntos
[21:48] Buho-Transparente Tiempo! La respuesta es -> tajo <- [21:48] Buho-Transparente
Tiempo! La respuesta es -> tajo <-
[21:48] Buho-Transparente Please refrain from using Extreme Bad Language [21:48] Buho-Transparente
Please refrain from using Extreme Bad Language
[21:48] Buho-Transparente Tri.710 Medicina-Saludɐsico666ˣu᮴osllitrosldensangrentienenungserohumano?q?q [21:48] Buho-Transparente
Tri.710 Medicina-Saludɐsico666ˣu᮴osllitrosldensangrentienenungserohumano?q?q
[21:48] Buho-Transparente 1 Pista: *,* ****** Valor pregunta : 21570 Puntos [21:48] Buho-Transparente
1 Pista: *,* ****** Valor pregunta : 21570 Puntos
[21:48] Buho-Transparente 2 Pista: 6,4 ****** 30 segundos y 21570 Puntos [21:48] Buho-Transparente
2 Pista: 6,4 ****** 30 segundos y 21570 Puntos
[21:48] Buho-Transparente 3 Pista: 6,4 *i**o* 15 segundos y 21570 Puntos [21:48] Buho-Transparente
3 Pista: 6,4 *i**o* 15 segundos y 21570 Puntos
[21:48] Buho-Transparente Tiempo! La respuesta es -> 6,4�itros <- [21:48] Buho-Transparente
Tiempo! La respuesta es -> 6,4�itros <-
[21:49] Buho-Transparente This is #Mexico, I am your host Buho-Transparente, running Buho-Transparente [21:49] Buho-Transparente
This is #Mexico, I am your host Buho-Transparente, running Buho-Transparente
[21:49] Buho-Transparente Tri.18468 Biologiaɘavix˿Cuantosghuesosgtieneyelvcuellogdeyunaqjirafaq?l [21:49] Buho-Transparente
Tri.18468 Biologiaɘavix˿Cuantosghuesosgtieneyelvcuellogdeyunaqjirafaq?l
[21:49] Buho-Transparente 1 Pista: ***** Valor pregunta : 24944 Puntos [21:49] Buho-Transparente
1 Pista: ***** Valor pregunta : 24944 Puntos
[21:49] Buho-Transparente 2 Pista: sie** 30 segundos y 24944 Puntos [21:49] Buho-Transparente
2 Pista: sie** 30 segundos y 24944 Puntos
[21:49] Buho-Transparente 3 Pista: sie*e 15 segundos y 24944 Puntos [21:49] Buho-Transparente
3 Pista: sie*e 15 segundos y 24944 Puntos
[21:49] Buho-Transparente Tiempo! La respuesta es -> siete <- [21:49] Buho-Transparente
Tiempo! La respuesta es -> siete <-
[21:50] Buho-Transparente This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Avestruz-Feroz 2083671 #13: Sirena__ 1207677 #14: LeCaTwaLk_z 1185079 #15: Chornobyl 873565 #16: etewsgy 695960 #17: kitana_- 692692 #18: julia__ 611502 #19: karen-62 535210 #20: AlbertoA 475137 [21:50] Buho-Transparente
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Avestruz-Feroz 2083671 #13: Sirena__ 1207677 #14: LeCaTwaLk_z 1185079 #15: Chornobyl 873565 #16: etewsgy 695960 #17: kitana_- 692692 #18: julia__ 611502 #19: karen-62 535210 #20: AlbertoA 475137
[21:50] Buho-Transparente Tri.4025 Personajesɚodiack˿CualifuemelinombremdempilakdemMussolini?h?h [21:50] Buho-Transparente
Tri.4025 Personajesɚodiack˿CualifuemelinombremdempilakdemMussolini?h?h
[21:50] Buho-Transparente 1 Pista: ****** Valor pregunta : 18941 Puntos [21:50] Buho-Transparente
1 Pista: ****** Valor pregunta : 18941 Puntos
[21:50] Buho-Transparente 2 Pista: ben*** 30 segundos y 18941 Puntos [21:50] Buho-Transparente
2 Pista: ben*** 30 segundos y 18941 Puntos
[21:50] Buho-Transparente 3 Pista: beni*o 15 segundos y 18941 Puntos [21:50] Buho-Transparente
3 Pista: beni*o 15 segundos y 18941 Puntos
[21:50] Buho-Transparente Tiempo! La respuesta es -> benito <- [21:50] Buho-Transparente
Tiempo! La respuesta es -> benito <-
[21:50] Buho-Transparente Please remember this is a FREE service, Please do not complain [21:50] Buho-Transparente
Please remember this is a FREE service, Please do not complain
[21:50] Buho-Transparente Tri.12926 Cotilleo-TVɈdosO˿Enjquevserievtelevisivahinfantilksaliah"ElktiohAquiles"h?h [21:50] Buho-Transparente
Tri.12926 Cotilleo-TVɈdosO˿Enjquevserievtelevisivahinfantilksaliah"ElktiohAquiles"h?h
[21:50] Buho-Transparente 1 Pista: *** ****************** Valor pregunta : 17382 Puntos [21:50] Buho-Transparente
1 Pista: *** ****************** Valor pregunta : 17382 Puntos
[21:51] Buho-Transparente 2 Pista: los ****************** 30 segundos y 17382 Puntos [21:51] Buho-Transparente
2 Pista: los ****************** 30 segundos y 17382 Puntos
[21:51] Buho-Transparente 3 Pista: los **i*i*i*i**au*i*o* 15 segundos y 17382 Puntos [21:51] Buho-Transparente
3 Pista: los **i*i*i*i**au*i*o* 15 segundos y 17382 Puntos
[21:51] Buho-Transparente Tiempo! La respuesta es -> los�hiripitiflauticos <- [21:51] Buho-Transparente
Tiempo! La respuesta es -> los�hiripitiflauticos <-
[21:51] Buho-Transparente This MONTHS Top 11-20: - #11: Sirena__ 938571 #12: Chornobyl 873565 #13: kitana_- 682987 #14: julia__ 611502 #15: Cubanito 581548 #16: karen-62 535210 #17: AlbertoA 475137 #18: KaZuMa_KiRyU 435575 #19: karen-53 342268 #20: karen- 298704 [21:51] Buho-Transparente
This MONTHS Top 11-20: - #11: Sirena__ 938571 #12: Chornobyl 873565 #13: kitana_- 682987 #14: julia__ 611502 #15: Cubanito 581548 #16: karen-62 535210 #17: AlbertoA 475137 #18: KaZuMa_KiRyU 435575 #19: karen-53 342268 #20: karen- 298704
[21:51] Buho-Transparente Tri.7199 Personajesɖivian˿C󭯃01tseallamazlazmascotazdealosxPicapiedra?s?s [21:51] Buho-Transparente
Tri.7199 Personajesɖivian˿C󭯃01tseallamazlazmascotazdealosxPicapiedra?s?s
[21:51] Buho-Transparente 1 Pista: **** Valor pregunta : 6534 Puntos [21:51] Buho-Transparente
1 Pista: **** Valor pregunta : 6534 Puntos
[21:52] Buho-Transparente 2 Pista: din* 30 segundos y 6534 Puntos [21:52] Buho-Transparente
2 Pista: din* 30 segundos y 6534 Puntos
[21:52] Buho-Transparente 3 Pista: dino 15 segundos y 6534 Puntos [21:52] Buho-Transparente
3 Pista: dino 15 segundos y 6534 Puntos
[21:52] Buho-Transparente Tiempo! La respuesta es -> dino <- [21:52] Buho-Transparente
Tiempo! La respuesta es -> dino <-
[21:52] Buho-Transparente R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [21:52] Buho-Transparente
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[21:52] Buho-Transparente Tri.12391 Deporteɴamzarian˿Engqu郰1aespecialidadfatl鴩caidestac󃰱aUdoeBeyer?a?a [21:52] Buho-Transparente
Tri.12391 Deporteɴamzarian˿Engqu郰1aespecialidadfatl鴩caidestac󃰱aUdoeBeyer?a?a
[21:52] Buho-Transparente 1 Pista: *********** ** **** Valor pregunta : 10283 Puntos [21:52] Buho-Transparente
1 Pista: *********** ** **** Valor pregunta : 10283 Puntos
[21:53] Buho-Transparente 2 Pista: lan******** ** **** 30 segundos y 10283 Puntos [21:53] Buho-Transparente
2 Pista: lan******** ** **** 30 segundos y 10283 Puntos
[21:53] Buho-Transparente 3 Pista: lan*a*ie**o *e *e*o 15 segundos y 10283 Puntos [21:53] Buho-Transparente
3 Pista: lan*a*ie**o *e *e*o 15 segundos y 10283 Puntos
[21:53] Buho-Transparente Tiempo! La respuesta es -> lanzamiento�e�eso <- [21:53] Buho-Transparente
Tiempo! La respuesta es -> lanzamiento�e�eso <-
[21:53] Buho-Transparente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [21:53] Buho-Transparente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[21:53] Buho-Transparente Tri.19276 GeografiaɃarlovigo˿Cualuesslauregiondaustralianaumenosspoblada?h?h [21:53] Buho-Transparente
Tri.19276 GeografiaɃarlovigo˿Cualuesslauregiondaustralianaumenosspoblada?h?h
[21:53] Buho-Transparente 1 Pista: ********** *** ***** Valor pregunta : 12209 Puntos [21:53] Buho-Transparente
1 Pista: ********** *** ***** Valor pregunta : 12209 Puntos
[21:53] Buho-Transparente 2 Pista: ter******* *** ***** 30 segundos y 12209 Puntos [21:53] Buho-Transparente
2 Pista: ter******* *** ***** 30 segundos y 12209 Puntos
[21:54] Buho-Transparente 3 Pista: ter*i*o*io *e* *o**e 15 segundos y 12209 Puntos [21:54] Buho-Transparente
3 Pista: ter*i*o*io *e* *o**e 15 segundos y 12209 Puntos
[21:54] Buho-Transparente Tiempo! La respuesta es -> territorio�el�orte <- [21:54] Buho-Transparente
Tiempo! La respuesta es -> territorio�el�orte <-
[21:54] Buho-Transparente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [21:54] Buho-Transparente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[21:54] Buho-Transparente Tri.19997 Cotilleo-TVɣarlovigo˿EnkqueaprogramaxdeatelevisionkcomenzowsuzcarreraxNina?v?v [21:54] Buho-Transparente
Tri.19997 Cotilleo-TVɣarlovigo˿EnkqueaprogramaxdeatelevisionkcomenzowsuzcarreraxNina?v?v
[21:54] Buho-Transparente 1 Pista: ** *** **** Valor pregunta : 13637 Puntos [21:54] Buho-Transparente
1 Pista: ** *** **** Valor pregunta : 13637 Puntos
[21:54] Buho-Transparente 2 Pista: un�** **** 30 segundos y 13637 Puntos [21:54] Buho-Transparente
2 Pista: un�** **** 30 segundos y 13637 Puntos
[21:55] Buho-Transparente 3 Pista: un�o* **e* 15 segundos y 13637 Puntos [21:55] Buho-Transparente
3 Pista: un�o* **e* 15 segundos y 13637 Puntos
[21:55] Buho-Transparente Tiempo! La respuesta es -> un�os�res <- [21:55] Buho-Transparente
Tiempo! La respuesta es -> un�os�res <-
[21:55] Buho-Transparente R᮫ing SEMANA: - #1: Ardilla\Insufrible 20789322 #2: Flamenco-Real 19028808 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15190500 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154 [21:55] Buho-Transparente
R᮫ing SEMANA: - #1: Ardilla\Insufrible 20789322 #2: Flamenco-Real 19028808 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15190500 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154
[21:55] Buho-Transparente Tri.20225 Idiomasɦlipp_er˿LATIN--->ESPAяL:vallisr?b [21:55] Buho-Transparente
Tri.20225 Idiomasɦlipp_er˿LATIN--->ESPAяL:vallisr?b
[21:55] Buho-Transparente 1 Pista: ***** Valor pregunta : 19707 Puntos [21:55] Buho-Transparente
1 Pista: ***** Valor pregunta : 19707 Puntos
[21:55] Buho-Transparente 2 Pista: val** 30 segundos y 19707 Puntos [21:55] Buho-Transparente
2 Pista: val** 30 segundos y 19707 Puntos
[21:55] Ardilla\Insufrible a mi me gusta vivir el amor con alevosia y desenfreo [21:55] Ardilla\Insufrible
a mi me gusta vivir el amor con alevosia y desenfreo
[21:55] Ardilla\Insufrible valle [21:55] Ardilla\Insufrible
valle
[21:55] Buho-Transparente �Enhorabuena Ardilla\Insufrible!! Has contestado "valle" y por ello has ganado �9707�12 puntos [21:55] Buho-Transparente
�Enhorabuena Ardilla\Insufrible!! Has contestado "valle" y por ello has ganado �9707�12 puntos
[21:55] Buho-Transparente ACTION awards Ardilla\Insufrible with a +v for having over 15000 points [21:55] Buho-Transparente
ACTION awards Ardilla\Insufrible with a +v for having over 15000 points
[21:55] Buho-Transparente Ardilla\Insufrible has acertado 4 seguidas!! Puntos HOY: 3020030, SEMANA: 20809029 y MES: 17137466 [21:55] Buho-Transparente
Ardilla\Insufrible has acertado 4 seguidas!! Puntos HOY: 3020030, SEMANA: 20809029 y MES: 17137466
[21:56] Buho-Transparente We feature over 50,000 Q&A ! [21:56] Buho-Transparente
We feature over 50,000 Q&A !
[21:56] Buho-Transparente Tri.12220 Historiaɐsico666ˬosgtresgpuntosgformandomunctriangulomsoncelys�olominternacionalyde.....y?y [21:56] Buho-Transparente
Tri.12220 Historiaɐsico666ˬosgtresgpuntosgformandomunctriangulomsoncelys�olominternacionalyde.....y?y
[21:56] Buho-Transparente 1 Pista: ** ***** ******** Valor pregunta : 7775 Puntos [21:56] Buho-Transparente
1 Pista: ** ***** ******** Valor pregunta : 7775 Puntos
[21:56] Buho-Transparente 2 Pista: la�**** ******** 30 segundos y 7775 Puntos [21:56] Buho-Transparente
2 Pista: la�**** ******** 30 segundos y 7775 Puntos
[21:56] Buho-Transparente 3 Pista: la�o*ia *a*o*i*a 15 segundos y 7775 Puntos [21:56] Buho-Transparente
3 Pista: la�o*ia *a*o*i*a 15 segundos y 7775 Puntos
[21:56] Buho-Transparente Tiempo! La respuesta es -> la�ogia�asonica <- [21:56] Buho-Transparente
Tiempo! La respuesta es -> la�ogia�asonica <-
[21:57] Buho-Transparente R᮫ing de HOY: - #1: Ardilla\Insufrible 3020030 #2: TigreSinRespeto 1691523 #3: Avestruz-Feroz 858702 #4: Alitas 695281 #5: Flamenco-Real 253419 #6: Sirena__ 204402 #7: AlbertoA 143662 #8: kitana_- 139952 #9: Lord 100000 #10: Cubanito 21944 [21:57] Buho-Transparente
R᮫ing de HOY: - #1: Ardilla\Insufrible 3020030 #2: TigreSinRespeto 1691523 #3: Avestruz-Feroz 858702 #4: Alitas 695281 #5: Flamenco-Real 253419 #6: Sirena__ 204402 #7: AlbertoA 143662 #8: kitana_- 139952 #9: Lord 100000 #10: Cubanito 21944
[21:57] Buho-Transparente Tri.14051 DeporteɔDI˿ENsQUEsESTADIOsDEBUTOsMOLOWNYsCOMOsJUGAODRsDELsREALsMADRIDs?s [21:57] Buho-Transparente
Tri.14051 DeporteɔDI˿ENsQUEsESTADIOsDEBUTOsMOLOWNYsCOMOsJUGAODRsDELsREALsMADRIDs?s
[21:57] Buho-Transparente 1 Pista: ************* Valor pregunta : 10094 Puntos [21:57] Buho-Transparente
1 Pista: ************* Valor pregunta : 10094 Puntos
[21:57] Buho-Transparente 2 Pista: met********** 30 segundos y 10094 Puntos [21:57] Buho-Transparente
2 Pista: met********** 30 segundos y 10094 Puntos
[21:57] Buho-Transparente 3 Pista: met*o*o*i*a*o 15 segundos y 10094 Puntos [21:57] Buho-Transparente
3 Pista: met*o*o*i*a*o 15 segundos y 10094 Puntos
[21:57] Buho-Transparente Tiempo! La respuesta es -> metropolitano <- [21:57] Buho-Transparente
Tiempo! La respuesta es -> metropolitano <-
[21:57] Buho-Transparente Tri.916 HistoriaɊAVEA˿(03/11/1975):ENfQUEfPROVINCIAfESPAяLAfHUBOf27fMUERTOSfYf6fHERIDOSfOCURRIDOSfENfUNfACCIDENTEfDEfUNAfMINAf(NOfDEfGUERRA)f?f [21:57] Buho-Transparente
Tri.916 HistoriaɊAVEA˿(03/11/1975):ENfQUEfPROVINCIAfESPAяLAfHUBOf27fMUERTOSfYf6fHERIDOSfOCURRIDOSfENfUNfACCIDENTEfDEfUNAfMINAf(NOfDEfGUERRA)f?f
[21:57] Buho-Transparente 1 Pista: ********* Valor pregunta : 21060 Puntos [21:57] Buho-Transparente
1 Pista: ********* Valor pregunta : 21060 Puntos
[21:58] Buho-Transparente 2 Pista: BAR****** 30 segundos y 21060 Puntos [21:58] Buho-Transparente
2 Pista: BAR****** 30 segundos y 21060 Puntos
[21:58] Buho-Transparente 3 Pista: BAR*E*O*A 15 segundos y 21060 Puntos [21:58] Buho-Transparente
3 Pista: BAR*E*O*A 15 segundos y 21060 Puntos
[21:58] Buho-Transparente Tiempo! La respuesta es -> BARCELONA <- [21:58] Buho-Transparente
Tiempo! La respuesta es -> BARCELONA <-
[21:58] Buho-Transparente Please remember this is a FREE service, Please do not complain [21:58] Buho-Transparente
Please remember this is a FREE service, Please do not complain
[21:58] Buho-Transparente Tri.8105 Cancionesɖonk˿Detquienfescthetothernsidetofksummern?f [21:58] Buho-Transparente
Tri.8105 Cancionesɖonk˿Detquienfescthetothernsidetofksummern?f
[21:58] Buho-Transparente 1 Pista: ***** ******** Valor pregunta : 11982 Puntos [21:58] Buho-Transparente
1 Pista: ***** ******** Valor pregunta : 11982 Puntos
[21:59] Buho-Transparente 2 Pista: elv** ******** 30 segundos y 11982 Puntos [21:59] Buho-Transparente
2 Pista: elv** ******** 30 segundos y 11982 Puntos
[21:59] Buho-Transparente 3 Pista: elvi* *o**e**o 15 segundos y 11982 Puntos [21:59] Buho-Transparente
3 Pista: elvi* *o**e**o 15 segundos y 11982 Puntos
[21:59] Ardilla\Insufrible elvis costello [21:59] Ardilla\Insufrible
elvis costello
[21:59] Buho-Transparente �Ol頃04Ardilla\Insufrible!! Has contestado: "elvis costello" en �0.844 segundos y sumas �1982�12 puntos a tu marcador. �Sigue as� [21:59] Buho-Transparente
�Ol頃04Ardilla\Insufrible!! Has contestado: "elvis costello" en �0.844 segundos y sumas �1982�12 puntos a tu marcador. �Sigue as�
[21:59] Buho-Transparente ACTION awards Ardilla\Insufrible with a +v for having over 15000 points [21:59] Buho-Transparente
ACTION awards Ardilla\Insufrible with a +v for having over 15000 points
[21:59] Buho-Transparente Ardilla\Insufrible has acertado 5 seguidas!! Puntos HOY: 3032012, SEMANA: 20821011 y MES: 17149448 [21:59] Buho-Transparente
Ardilla\Insufrible has acertado 5 seguidas!! Puntos HOY: 3032012, SEMANA: 20821011 y MES: 17149448
[21:59] Buho-Transparente R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [21:59] Buho-Transparente
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[21:59] Buho-Transparente Tri.7571 Cancionesɔruchi˿Dexquexgrupovespa񯬃01deselaocancions"rosaogris"e?e [21:59] Buho-Transparente
Tri.7571 Cancionesɔruchi˿Dexquexgrupovespa񯬃01deselaocancions"rosaogris"e?e
[21:59] Buho-Transparente 1 Pista: ****** *** Valor pregunta : 21157 Puntos [21:59] Buho-Transparente
1 Pista: ****** *** Valor pregunta : 21157 Puntos
[21:59] Ardilla\Insufrible duncan dhu [21:59] Ardilla\Insufrible
duncan dhu
[21:59] Buho-Transparente �Est᳠que lo tiras Ardilla\Insufrible!! ߃󭯠supiste que "duncan dhu" era la respuesta? Venga, �1157�12 puntos suben a tu marcador [21:59] Buho-Transparente
�Est᳠que lo tiras Ardilla\Insufrible!! ߃󭯠supiste que "duncan dhu" era la respuesta? Venga, �1157�12 puntos suben a tu marcador
[21:59] Buho-Transparente ACTION awards Ardilla\Insufrible with a +v for having over 15000 points [21:59] Buho-Transparente
ACTION awards Ardilla\Insufrible with a +v for having over 15000 points
[21:59] Buho-Transparente Ardilla\Insufrible has acertado 6 seguidas!! Puntos HOY: 3053169, SEMANA: 20842168 y MES: 17170605 [21:59] Buho-Transparente
Ardilla\Insufrible has acertado 6 seguidas!! Puntos HOY: 3053169, SEMANA: 20842168 y MES: 17170605
[21:59] Buho-Transparente If you think a Q&A is wrong, please call an OP [21:59] Buho-Transparente
If you think a Q&A is wrong, please call an OP
[21:59] Buho-Transparente Tri.3595 CienciaɃocoman˿Enunciadoscientificosqueynosseydeduce,lsinosqueyseyestableceyynseyaceptahcomosbuenosynuniversalc?l [21:59] Buho-Transparente
Tri.3595 CienciaɃocoman˿Enunciadoscientificosqueynosseydeduce,lsinosqueyseyestableceyynseyaceptahcomosbuenosynuniversalc?l
[21:59] Buho-Transparente 1 Pista: ****** Pregunta de BONUS : 100000 Puntos [21:59] Buho-Transparente
1 Pista: ****** Pregunta de BONUS : 100000 Puntos
[22:00] Ardilla\Insufrible teoria [22:00] Ardilla\Insufrible
teoria
[22:00] Buho-Transparente 2 Pista: axi*** 30 segundos y 100000 Puntos [22:00] Buho-Transparente
2 Pista: axi*** 30 segundos y 100000 Puntos
[22:00] Buho-Transparente �Bingo!! Ardilla\Insufrible dio la respuesta: "axioma" en �8.453 segundos e incrementa sus ganancias con �00000�12 puntos [22:00] Buho-Transparente
�Bingo!! Ardilla\Insufrible dio la respuesta: "axioma" en �8.453 segundos e incrementa sus ganancias con �00000�12 puntos
[22:00] Buho-Transparente ACTION awards Ardilla\Insufrible with a +v for having over 15000 points [22:00] Buho-Transparente
ACTION awards Ardilla\Insufrible with a +v for having over 15000 points
[22:00] Buho-Transparente Ardilla\Insufrible has acertado 7 seguidas!! Puntos HOY: 3153169, SEMANA: 20942168 y MES: 17270605 [22:00] Buho-Transparente
Ardilla\Insufrible has acertado 7 seguidas!! Puntos HOY: 3153169, SEMANA: 20942168 y MES: 17270605
[22:00] Ardilla\Insufrible axioma [22:00] Ardilla\Insufrible
axioma
[22:00] Buho-Transparente R᮫ing por D́: - Domingo: TigreSinRespeto 8389382 Lunes: Ardilla\Insufrible 439202 Martes: Ardilla\Insufrible 3723143 Miercoles: Ardilla\Insufrible 2928711 Jueves: Flamenco-Real 511120 Viernes: Ardilla\Insufrible 3683447 Sᢡdo: * 0 [22:00] Buho-Transparente
R᮫ing por D́: - Domingo: TigreSinRespeto 8389382 Lunes: Ardilla\Insufrible 439202 Martes: Ardilla\Insufrible 3723143 Miercoles: Ardilla\Insufrible 2928711 Jueves: Flamenco-Real 511120 Viernes: Ardilla\Insufrible 3683447 Sᢡdo: * 0
[22:00] Buho-Transparente Tri.1760 Fisica-QuimicaɐEDROC˿ELrPRODUCIRrLUZrLASrSUSTANCIASrCUANDOrSErROMPENrOrSErAPLASTANrSErLLAMAr?r [22:00] Buho-Transparente
Tri.1760 Fisica-QuimicaɐEDROC˿ELrPRODUCIRrLUZrLASrSUSTANCIASrCUANDOrSErROMPENrOrSErAPLASTANrSErLLAMAr?r
[22:00] Buho-Transparente 1 Pista: ****************** Valor pregunta : 23055 Puntos [22:00] Buho-Transparente
1 Pista: ****************** Valor pregunta : 23055 Puntos
[22:00] Buho-Transparente 2 Pista: TRI*************** 30 segundos y 23055 Puntos [22:00] Buho-Transparente
2 Pista: TRI*************** 30 segundos y 23055 Puntos
[22:00] Buho-Transparente 3 Pista: TRI*O*U*I*I**E**IA 15 segundos y 23055 Puntos [22:00] Buho-Transparente
3 Pista: TRI*O*U*I*I**E**IA 15 segundos y 23055 Puntos
[22:01] Buho-Transparente Tiempo! La respuesta es -> TRIBOLUMINISCENCIA <- [22:01] Buho-Transparente
Tiempo! La respuesta es -> TRIBOLUMINISCENCIA <-
[22:01] Buho-Transparente For The Competitive Edge type !pingme [22:01] Buho-Transparente
For The Competitive Edge type !pingme
[22:01] Buho-Transparente Tri.11334 Economiaɖivian˿Ennqu郰1gpa�01oseufund󃰱glancompa񭡃01nSonytCorporation?g?g [22:01] Buho-Transparente
Tri.11334 Economiaɖivian˿Ennqu郰1gpa�01oseufund󃰱glancompa񭡃01nSonytCorporation?g?g
[22:01] Buho-Transparente 1 Pista: ***** Valor pregunta : 14341 Puntos [22:01] Buho-Transparente
1 Pista: ***** Valor pregunta : 14341 Puntos
[22:01] Buho-Transparente 2 Pista: jap** 30 segundos y 14341 Puntos [22:01] Buho-Transparente
2 Pista: jap** 30 segundos y 14341 Puntos
[22:01] Buho-Transparente 3 Pista: japo* 15 segundos y 14341 Puntos [22:01] Buho-Transparente
3 Pista: japo* 15 segundos y 14341 Puntos
[22:02] Buho-Transparente Tiempo! La respuesta es -> japon <- [22:02] Buho-Transparente
Tiempo! La respuesta es -> japon <-
[22:02] Buho-Transparente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [22:02] Buho-Transparente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[22:02] Buho-Transparente Tri.18797 CienciaɅME^˿CELEBREvMATEMATICOvHINDUvDEvPRINCIPIOSvDEvSIGLOv?v [22:02] Buho-Transparente
Tri.18797 CienciaɅME^˿CELEBREvMATEMATICOvHINDUvDEvPRINCIPIOSvDEvSIGLOv?v
[22:02] Buho-Transparente 1 Pista: ********* ********* Valor pregunta : 12539 Puntos [22:02] Buho-Transparente
1 Pista: ********* ********* Valor pregunta : 12539 Puntos
[22:02] Buho-Transparente 2 Pista: sri****** ********* 30 segundos y 12539 Puntos [22:02] Buho-Transparente
2 Pista: sri****** ********* 30 segundos y 12539 Puntos
[22:02] Buho-Transparente 3 Pista: sri*i*a*a *a*a*u*a* 15 segundos y 12539 Puntos [22:02] Buho-Transparente
3 Pista: sri*i*a*a *a*a*u*a* 15 segundos y 12539 Puntos
[22:02] Buho-Transparente Tiempo! La respuesta es -> srinivasa�amanujan <- [22:02] Buho-Transparente
Tiempo! La respuesta es -> srinivasa�amanujan <-
[22:03] Buho-Transparente R᮫ing MES: - #1: Ardilla\Insufrible 17270605 #2: Flamenco-Real 16796092 #3: Rana}ConTimidez 16651319 #4: TigreSinRespeto 15190500 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: Alitas 4100139 #8: SMAW 4012154 #9: LaCamelia 3029384 #10: Avestruz-Feroz 2083671 [22:03] Buho-Transparente
R᮫ing MES: - #1: Ardilla\Insufrible 17270605 #2: Flamenco-Real 16796092 #3: Rana}ConTimidez 16651319 #4: TigreSinRespeto 15190500 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: Alitas 4100139 #8: SMAW 4012154 #9: LaCamelia 3029384 #10: Avestruz-Feroz 2083671
[22:03] Buho-Transparente Tri.4151 Medicina-Saludɐsico666˰iezaodeltejidovanimalgdestinadaoaorepararfovsustituirfunaoparteldelgcuerpovhumanov?c [22:03] Buho-Transparente
Tri.4151 Medicina-Saludɐsico666˰iezaodeltejidovanimalgdestinadaoaorepararfovsustituirfunaoparteldelgcuerpovhumanov?c
[22:03] Buho-Transparente 1 Pista: *********** Valor pregunta : 24992 Puntos [22:03] Buho-Transparente
1 Pista: *********** Valor pregunta : 24992 Puntos
[22:03] Buho-Transparente 2 Pista: bio******** 30 segundos y 24992 Puntos [22:03] Buho-Transparente
2 Pista: bio******** 30 segundos y 24992 Puntos
[22:03] Buho-Transparente 3 Pista: bio**o*e*i* 15 segundos y 24992 Puntos [22:03] Buho-Transparente
3 Pista: bio**o*e*i* 15 segundos y 24992 Puntos
[22:03] Buho-Transparente Tiempo! La respuesta es -> bioprotesis <- [22:03] Buho-Transparente
Tiempo! La respuesta es -> bioprotesis <-
[22:04] Buho-Transparente Please refrain from using Extreme Bad Language [22:04] Buho-Transparente
Please refrain from using Extreme Bad Language
[22:04] Buho-Transparente Tri.5799 CienciaɁlkaid˿CUALfESfLAfFORMAfGEOMETRICAfDELfROYALfALBERTfHALLfDEfLONDRES?f?f [22:04] Buho-Transparente
Tri.5799 CienciaɁlkaid˿CUALfESfLAfFORMAfGEOMETRICAfDELfROYALfALBERTfHALLfDEfLONDRES?f?f
[22:04] Buho-Transparente 1 Pista: ******* Valor pregunta : 7110 Puntos [22:04] Buho-Transparente
1 Pista: ******* Valor pregunta : 7110 Puntos
[22:04] Buho-Transparente 2 Pista: cir**** 30 segundos y 7110 Puntos [22:04] Buho-Transparente
2 Pista: cir**** 30 segundos y 7110 Puntos
[22:04] Buho-Transparente 3 Pista: cir*u*o 15 segundos y 7110 Puntos [22:04] Buho-Transparente
3 Pista: cir*u*o 15 segundos y 7110 Puntos
[22:04] Buho-Transparente Tiempo! La respuesta es -> circulo <- [22:04] Buho-Transparente
Tiempo! La respuesta es -> circulo <-
[22:05] Buho-Transparente This is #Mexico, I am your host Buho-Transparente, running Buho-Transparente [22:05] Buho-Transparente
This is #Mexico, I am your host Buho-Transparente, running Buho-Transparente
[22:05] Buho-Transparente Tri.17351 GeografiaɍARdeJAVA˿ENwQUɃ01wPA͓wSEwENCUENTRAwLAwCIUDADwDEwLAwROMANA?w?w [22:05] Buho-Transparente
Tri.17351 GeografiaɍARdeJAVA˿ENwQUɃ01wPA͓wSEwENCUENTRAwLAwCIUDADwDEwLAwROMANA?w?w
[22:05] Buho-Transparente 1 Pista: ********* ********** Valor pregunta : 18636 Puntos [22:05] Buho-Transparente
1 Pista: ********* ********** Valor pregunta : 18636 Puntos
[22:05] Buho-Transparente 2 Pista: rep****** ********** 30 segundos y 18636 Puntos [22:05] Buho-Transparente
2 Pista: rep****** ********** 30 segundos y 18636 Puntos
[22:05] Buho-Transparente 3 Pista: repu**i*a *o*i*i*a*a 15 segundos y 18636 Puntos [22:05] Buho-Transparente
3 Pista: repu**i*a *o*i*i*a*a 15 segundos y 18636 Puntos
[22:05] Buho-Transparente Tiempo! La respuesta es -> republica�ominicana <- [22:05] Buho-Transparente
Tiempo! La respuesta es -> republica�ominicana <-
[22:05] Buho-Transparente This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Avestruz-Feroz 2083671 #13: Sirena__ 1207677 #14: LeCaTwaLk_z 1185079 #15: Chornobyl 873565 #16: etewsgy 695960 #17: kitana_- 692692 #18: julia__ 611502 #19: karen-62 535210 #20: AlbertoA 475137 [22:05] Buho-Transparente
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Avestruz-Feroz 2083671 #13: Sirena__ 1207677 #14: LeCaTwaLk_z 1185079 #15: Chornobyl 873565 #16: etewsgy 695960 #17: kitana_- 692692 #18: julia__ 611502 #19: karen-62 535210 #20: AlbertoA 475137
[22:05] Buho-Transparente Tri.16970 Cancionesɤassler˿Dejqu郰1cgrupoyesblaecanci󮃰1c"cUnderkPressurej"c?"c?c [22:05] Buho-Transparente
Tri.16970 Cancionesɤassler˿Dejqu郰1cgrupoyesblaecanci󮃰1c"cUnderkPressurej"c?"c?c
[22:05] Buho-Transparente 1 Pista: ***** Valor pregunta : 13884 Puntos [22:05] Buho-Transparente
1 Pista: ***** Valor pregunta : 13884 Puntos
[22:06] Buho-Transparente 2 Pista: que** 30 segundos y 13884 Puntos [22:06] Buho-Transparente
2 Pista: que** 30 segundos y 13884 Puntos
[22:06] Cocodrilo\ConBravura Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas [22:06] Cocodrilo\ConBravura
Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas
[22:06] Buho-Transparente 3 Pista: quee* 15 segundos y 13884 Puntos [22:06] Buho-Transparente
3 Pista: quee* 15 segundos y 13884 Puntos
[22:06] Buho-Transparente Tiempo! La respuesta es -> queen <- [22:06] Buho-Transparente
Tiempo! La respuesta es -> queen <-
[22:06] Buho-Transparente Please remember this is a FREE service, Please do not complain [22:06] Buho-Transparente
Please remember this is a FREE service, Please do not complain
[22:06] Buho-Transparente Tri.2210 Biologiaɳtephenwo˿Juntowconwelchalconwcualceshelcavedm᳃01hrapidajenwvuelowpicadowalcanzandowlosh290nkm/h?n?n [22:06] Buho-Transparente
Tri.2210 Biologiaɳtephenwo˿Juntowconwelchalconwcualceshelcavedm᳃01hrapidajenwvuelowpicadowalcanzandowlosh290nkm/h?n?n
[22:06] Buho-Transparente 1 Pista: ****** **** Valor pregunta : 12646 Puntos [22:06] Buho-Transparente
1 Pista: ****** **** Valor pregunta : 12646 Puntos
[22:07] Buho-Transparente 2 Pista: agu*** **** 30 segundos y 12646 Puntos [22:07] Buho-Transparente
2 Pista: agu*** **** 30 segundos y 12646 Puntos
[22:07] Buho-Transparente 3 Pista: agui*a *ea* 15 segundos y 12646 Puntos [22:07] Buho-Transparente
3 Pista: agui*a *ea* 15 segundos y 12646 Puntos
[22:07] Buho-Transparente Tiempo! La respuesta es -> aguila�eal <- [22:07] Buho-Transparente
Tiempo! La respuesta es -> aguila�eal <-
[22:07] Buho-Transparente This MONTHS Top 11-20: - #11: Sirena__ 938571 #12: Chornobyl 873565 #13: kitana_- 682987 #14: julia__ 611502 #15: Cubanito 581548 #16: karen-62 535210 #17: AlbertoA 475137 #18: KaZuMa_KiRyU 435575 #19: karen-53 342268 #20: karen- 298704 [22:07] Buho-Transparente
This MONTHS Top 11-20: - #11: Sirena__ 938571 #12: Chornobyl 873565 #13: kitana_- 682987 #14: julia__ 611502 #15: Cubanito 581548 #16: karen-62 535210 #17: AlbertoA 475137 #18: KaZuMa_KiRyU 435575 #19: karen-53 342268 #20: karen- 298704
[22:07] Buho-Transparente Tri.18445 Idiomasɲaziel9˿FRANCES--->ESPA񏌺toujoursq?n [22:07] Buho-Transparente
Tri.18445 Idiomasɲaziel9˿FRANCES--->ESPA񏌺toujoursq?n
[22:07] Buho-Transparente 1 Pista: ******* Valor pregunta : 23199 Puntos [22:07] Buho-Transparente
1 Pista: ******* Valor pregunta : 23199 Puntos
[22:08] Buho-Transparente 2 Pista: sie**** 30 segundos y 23199 Puntos [22:08] Buho-Transparente
2 Pista: sie**** 30 segundos y 23199 Puntos
[22:08] Buho-Transparente 3 Pista: sie***e 15 segundos y 23199 Puntos [22:08] Buho-Transparente
3 Pista: sie***e 15 segundos y 23199 Puntos
[22:08] Buho-Transparente Tiempo! La respuesta es -> siempre <- [22:08] Buho-Transparente
Tiempo! La respuesta es -> siempre <-
[22:08] Buho-Transparente R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [22:08] Buho-Transparente
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[22:08] Buho-Transparente Tri.18196 Informaticaɐax˿Cuantostpinesttieneveliconectorr(ps2)xdevunrtecladob?x [22:08] Buho-Transparente
Tri.18196 Informaticaɐax˿Cuantostpinesttieneveliconectorr(ps2)xdevunrtecladob?x
[22:08] Buho-Transparente 1 Pista: **** Valor pregunta : 24581 Puntos [22:08] Buho-Transparente
1 Pista: **** Valor pregunta : 24581 Puntos
[22:08] Buho-Transparente 2 Pista: sei* 30 segundos y 24581 Puntos [22:08] Buho-Transparente
2 Pista: sei* 30 segundos y 24581 Puntos
[22:09] Buho-Transparente 3 Pista: sei* 15 segundos y 24581 Puntos [22:09] Buho-Transparente
3 Pista: sei* 15 segundos y 24581 Puntos
[22:09] Buho-Transparente Tiempo! La respuesta es -> seis <- [22:09] Buho-Transparente
Tiempo! La respuesta es -> seis <-
[22:09] Buho-Transparente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [22:09] Buho-Transparente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[22:09] Buho-Transparente Tri.16673 MitologiaɔeLaRaNhA˿Dioslgriegoadeyloslmareslyzloslriosl?e [22:09] Buho-Transparente
Tri.16673 MitologiaɔeLaRaNhA˿Dioslgriegoadeyloslmareslyzloslriosl?e
[22:09] Buho-Transparente 1 Pista: ******** Valor pregunta : 9242 Puntos [22:09] Buho-Transparente
1 Pista: ******** Valor pregunta : 9242 Puntos
[22:09] Buho-Transparente 2 Pista: pos***** 30 segundos y 9242 Puntos [22:09] Buho-Transparente
2 Pista: pos***** 30 segundos y 9242 Puntos
[22:10] Buho-Transparente 3 Pista: posei*o* 15 segundos y 9242 Puntos [22:10] Buho-Transparente
3 Pista: posei*o* 15 segundos y 9242 Puntos
[22:10] Buho-Transparente Tiempo! La respuesta es -> poseidon <- [22:10] Buho-Transparente
Tiempo! La respuesta es -> poseidon <-
[22:10] Buho-Transparente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [22:10] Buho-Transparente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[22:10] Buho-Transparente Tri.18099 Informaticaɭeji˿ConiqueuprogramaedeuWindowsopodemosoverwsireljregistroonoocontieneufallos?m?m [22:10] Buho-Transparente
Tri.18099 Informaticaɭeji˿ConiqueuprogramaedeuWindowsopodemosoverwsireljregistroonoocontieneufallos?m?m
[22:10] Buho-Transparente 1 Pista: ******* Valor pregunta : 20935 Puntos [22:10] Buho-Transparente
1 Pista: ******* Valor pregunta : 20935 Puntos
[22:10] Buho-Transparente 2 Pista: sca**** 30 segundos y 20935 Puntos [22:10] Buho-Transparente
2 Pista: sca**** 30 segundos y 20935 Puntos
[22:10] Flamenco-Real !Stats [22:10] Flamenco-Real
!Stats
[22:10] Culebra_Torpe Realización de estadísticas en curso. Solicitadas por: Flamenco-Real. [22:10] Culebra_Torpe
Realización de estadísticas en curso. Solicitadas por: Flamenco-Real.
[22:11] Buho-Transparente 3 Pista: sca**e* 15 segundos y 20935 Puntos [22:11] Buho-Transparente
3 Pista: sca**e* 15 segundos y 20935 Puntos
[22:11] Culebra_Torpe Resumen de estadísticas - Los que más han escrito hoy -> Buho-Transparente ( 6117 ), Ardilla\Insufrible ( 325), Alitas ( 156), TigreSinRespeto ( 105), Avestruz-Feroz ( 72), _Elektra_ ( 65), Oh-Diosa ( 63), kitana_- ( 58), Sirena__ ( 20), NN_vOx_Trump ( 18 ) [22:11] Culebra_Torpe
Resumen de estadísticas - Los que más han escrito hoy -> Buho-Transparente ( 6117 ), Ardilla\Insufrible ( 325), Alitas ( 156), TigreSinRespeto ( 105), Avestruz-Feroz ( 72), _Elektra_ ( 65), Oh-Diosa ( 63), kitana_- ( 58), Sirena__ ( 20), NN_vOx_Trump ( 18 )
[22:11] Culebra_Torpe Estadísticas actualizadas por Flamenco-Real. Visite las estadísticas en https://www.winstats.es/stats/mexico.html [22:11] Culebra_Torpe
Estadísticas actualizadas por Flamenco-Real. Visite las estadísticas en https://www.winstats.es/stats/mexico.html
[22:11] Buho-Transparente Tiempo! La respuesta es -> scanreg <- [22:11] Buho-Transparente
Tiempo! La respuesta es -> scanreg <-
[22:11] Buho-Transparente R᮫ing SEMANA: - #1: Ardilla\Insufrible 20942168 #2: Flamenco-Real 19028808 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15190500 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154 [22:11] Buho-Transparente
R᮫ing SEMANA: - #1: Ardilla\Insufrible 20942168 #2: Flamenco-Real 19028808 #3: Rana}ConTimidez 17127023 #4: TigreSinRespeto 15190500 #5: Cubanito 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: Alitas 4100139 #10: SMAW 4012154
[22:11] Buho-Transparente Tri.9994 Geografiaɓebosin˿C󭯃01kseflefllamaqalxnaturalxdelxbarriokvalencianokdefElxGrao?v?v [22:11] Buho-Transparente
Tri.9994 Geografiaɓebosin˿C󭯃01kseflefllamaqalxnaturalxdelxbarriokvalencianokdefElxGrao?v?v
[22:11] Buho-Transparente 1 Pista: ******* Valor pregunta : 20203 Puntos [22:11] Buho-Transparente
1 Pista: ******* Valor pregunta : 20203 Puntos
[22:11] Buho-Transparente 2 Pista: gra**** 30 segundos y 20203 Puntos [22:11] Buho-Transparente
2 Pista: gra**** 30 segundos y 20203 Puntos
[22:11] Buho-Transparente 3 Pista: gra*e*o 15 segundos y 20203 Puntos [22:11] Buho-Transparente
3 Pista: gra*e*o 15 segundos y 20203 Puntos
[22:12] Buho-Transparente Tiempo! La respuesta es -> granero <- [22:12] Buho-Transparente
Tiempo! La respuesta es -> granero <-
[22:12] Buho-Transparente We feature over 50,000 Q&A ! [22:12] Buho-Transparente
We feature over 50,000 Q&A !
[22:12] Buho-Transparente Tri.3586 Geografiaɓebosin˿Enbqu郰1kprovinciawespa񯬡wsecencuentranblosnTorosndecGuisando,klugarsdondecsecreconoci󃰱kawIsabelqlawCat󬩣awsucesorawdecEnriquecIV?k?k [22:12] Buho-Transparente
Tri.3586 Geografiaɓebosin˿Enbqu郰1kprovinciawespa񯬡wsecencuentranblosnTorosndecGuisando,klugarsdondecsecreconoci󃰱kawIsabelqlawCat󬩣awsucesorawdecEnriquecIV?k?k
[22:12] Buho-Transparente 1 Pista: ***** Pregunta de BONUS : 25000 Puntos [22:12] Buho-Transparente
1 Pista: ***** Pregunta de BONUS : 25000 Puntos
[22:12] Buho-Transparente 2 Pista: avi** 30 segundos y 25000 Puntos [22:12] Buho-Transparente
2 Pista: avi** 30 segundos y 25000 Puntos
[22:12] Buho-Transparente 3 Pista: avi*a 15 segundos y 25000 Puntos [22:12] Buho-Transparente
3 Pista: avi*a 15 segundos y 25000 Puntos
[22:13] Buho-Transparente Tiempo! La respuesta es -> avila <- [22:13] Buho-Transparente
Tiempo! La respuesta es -> avila <-
[22:13] Buho-Transparente R᮫ing de HOY: - #1: Ardilla\Insufrible 3153169 #2: TigreSinRespeto 1691523 #3: Avestruz-Feroz 858702 #4: Alitas 695281 #5: Flamenco-Real 253419 #6: Sirena__ 204402 #7: AlbertoA 143662 #8: kitana_- 139952 #9: Lord 100000 #10: Cubanito 21944 [22:13] Buho-Transparente
R᮫ing de HOY: - #1: Ardilla\Insufrible 3153169 #2: TigreSinRespeto 1691523 #3: Avestruz-Feroz 858702 #4: Alitas 695281 #5: Flamenco-Real 253419 #6: Sirena__ 204402 #7: AlbertoA 143662 #8: kitana_- 139952 #9: Lord 100000 #10: Cubanito 21944
[22:13] Buho-Transparente Tri.10861 Biologiaɳherif˿Cuᬃ01besqelbnombrexvulgartdelbvelozrAepycerosqmelampus?r?r [22:13] Buho-Transparente
Tri.10861 Biologiaɳherif˿Cuᬃ01besqelbnombrexvulgartdelbvelozrAepycerosqmelampus?r?r
[22:13] Buho-Transparente 1 Pista: ****** Valor pregunta : 6452 Puntos [22:13] Buho-Transparente
1 Pista: ****** Valor pregunta : 6452 Puntos
[22:13] Buho-Transparente 2 Pista: imp*** 30 segundos y 6452 Puntos [22:13] Buho-Transparente
2 Pista: imp*** 30 segundos y 6452 Puntos
[22:13] Buho-Transparente 3 Pista: impa*a 15 segundos y 6452 Puntos [22:13] Buho-Transparente
3 Pista: impa*a 15 segundos y 6452 Puntos
[22:14] Buho-Transparente Tiempo! La respuesta es -> impala <- [22:14] Buho-Transparente
Tiempo! La respuesta es -> impala <-
[22:14] Rana}ConTimidez buenas tardes [22:14] Rana}ConTimidez
buenas tardes
[22:14] Buho-Transparente Tri.2014 InformaticaɉRC-Domain˿EmpresaaquedfabricaalosfportᴩlesfTravelmated?k [22:14] Buho-Transparente
Tri.2014 InformaticaɉRC-Domain˿EmpresaaquedfabricaalosfportᴩlesfTravelmated?k
[22:14] Buho-Transparente 1 Pista: **** Valor pregunta : 20475 Puntos [22:14] Buho-Transparente
1 Pista: **** Valor pregunta : 20475 Puntos
[22:14] Rana}ConTimidez buenas noches [22:14] Rana}ConTimidez
buenas noches
[22:14] Buho-Transparente 2 Pista: ace* 30 segundos y 20475 Puntos [22:14] Buho-Transparente
2 Pista: ace* 30 segundos y 20475 Puntos
[22:14] Buho-Transparente 3 Pista: ace* 15 segundos y 20475 Puntos [22:14] Buho-Transparente
3 Pista: ace* 15 segundos y 20475 Puntos
[22:14] Buho-Transparente Tiempo! La respuesta es -> acer <- [22:14] Buho-Transparente
Tiempo! La respuesta es -> acer <-
[22:15] Buho-Transparente Please remember this is a FREE service, Please do not complain [22:15] Buho-Transparente
Please remember this is a FREE service, Please do not complain
[22:15] Buho-Transparente Tri.11822 LiteraturaɍARdeJAVAˑUɃ01uEMPERADORu(100-44uA.C.)uESCRIBIӃ01u"uCOMENTARIOSuDEuLAuGUERRAuCIVILu"u?u [22:15] Buho-Transparente
Tri.11822 LiteraturaɍARdeJAVAˑUɃ01uEMPERADORu(100-44uA.C.)uESCRIBIӃ01u"uCOMENTARIOSuDEuLAuGUERRAuCIVILu"u?u
[22:15] Buho-Transparente 1 Pista: ***** ***** Valor pregunta : 9597 Puntos [22:15] Buho-Transparente
1 Pista: ***** ***** Valor pregunta : 9597 Puntos
[22:15] Buho-Transparente 2 Pista: jul** ***** 30 segundos y 9597 Puntos [22:15] Buho-Transparente
2 Pista: jul** ***** 30 segundos y 9597 Puntos
[22:15] Buho-Transparente 3 Pista: julio *e*a* 15 segundos y 9597 Puntos [22:15] Buho-Transparente
3 Pista: julio *e*a* 15 segundos y 9597 Puntos
[22:15] Buho-Transparente Tiempo! La respuesta es -> julio�esar <- [22:15] Buho-Transparente
Tiempo! La respuesta es -> julio�esar <-
[22:16] Buho-Transparente R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [22:16] Buho-Transparente
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[22:16] Buho-Transparente Tri.15213 Informaticaɭeji˿(ASM)yQueqseqguardamenqelqregistrozPCy?y [22:16] Buho-Transparente
Tri.15213 Informaticaɭeji˿(ASM)yQueqseqguardamenqelqregistrozPCy?y
[22:16] Buho-Transparente 1 Pista: ****** ** *********** ********* Valor pregunta : 8976 Puntos [22:16] Buho-Transparente
1 Pista: ****** ** *********** ********* Valor pregunta : 8976 Puntos
[22:16] Buho-Transparente 2 Pista: num*** ** *********** ********* 30 segundos y 8976 Puntos [22:16] Buho-Transparente
2 Pista: num*** ** *********** ********* 30 segundos y 8976 Puntos
[22:16] Buho-Transparente 3 Pista: nume*o *e i****u**io* *i*uie**e 15 segundos y 8976 Puntos [22:16] Buho-Transparente
3 Pista: nume*o *e i****u**io* *i*uie**e 15 segundos y 8976 Puntos
[22:16] Buho-Transparente Tiempo! La respuesta es -> numero�e�nstruccion�iguiente <- [22:16] Buho-Transparente
Tiempo! La respuesta es -> numero�e�nstruccion�iguiente <-
[22:16] Buho-Transparente If you think a Q&A is wrong, please call an OP [22:16] Buho-Transparente
If you think a Q&A is wrong, please call an OP
[22:16] Buho-Transparente Tri.3525 Biologiaɐsico666˰a�01doriginariozdelfeucaliptusd?d [22:16] Buho-Transparente
Tri.3525 Biologiaɐsico666˰a�01doriginariozdelfeucaliptusd?d
[22:16] Buho-Transparente 1 Pista: ********* Valor pregunta : 8717 Puntos [22:16] Buho-Transparente
1 Pista: ********* Valor pregunta : 8717 Puntos
[22:17] Buho-Transparente 2 Pista: aus****** 30 segundos y 8717 Puntos [22:17] Buho-Transparente
2 Pista: aus****** 30 segundos y 8717 Puntos
[22:17] Buho-Transparente 3 Pista: aus**a*ia 15 segundos y 8717 Puntos [22:17] Buho-Transparente
3 Pista: aus**a*ia 15 segundos y 8717 Puntos
[22:17] Buho-Transparente Tiempo! La respuesta es -> australia <- [22:17] Buho-Transparente
Tiempo! La respuesta es -> australia <-
[22:17] Buho-Transparente R᮫ing por D́: - Domingo: TigreSinRespeto 8389382 Lunes: Ardilla\Insufrible 439202 Martes: Ardilla\Insufrible 3723143 Miercoles: Ardilla\Insufrible 2928711 Jueves: Flamenco-Real 511120 Viernes: Ardilla\Insufrible 3683447 Sᢡdo: * 0 [22:17] Buho-Transparente
R᮫ing por D́: - Domingo: TigreSinRespeto 8389382 Lunes: Ardilla\Insufrible 439202 Martes: Ardilla\Insufrible 3723143 Miercoles: Ardilla\Insufrible 2928711 Jueves: Flamenco-Real 511120 Viernes: Ardilla\Insufrible 3683447 Sᢡdo: * 0
[22:17] Buho-Transparente Tri.10043 ArteɎeo_Fenix˿Autorides"Cristoryacente"a?a [22:17] Buho-Transparente
Tri.10043 ArteɎeo_Fenix˿Autorides"Cristoryacente"a?a
[22:17] Buho-Transparente 1 Pista: ******** ********* Pregunta de BONUS : 100000 Puntos [22:17] Buho-Transparente
1 Pista: ******** ********* Pregunta de BONUS : 100000 Puntos
[22:18] Buho-Transparente 2 Pista: gre***** ********* 30 segundos y 100000 Puntos [22:18] Buho-Transparente
2 Pista: gre***** ********* 30 segundos y 100000 Puntos
[22:18] Buho-Transparente 3 Pista: gre*o*io *e**a**e* 15 segundos y 100000 Puntos [22:18] Buho-Transparente
3 Pista: gre*o*io *e**a**e* 15 segundos y 100000 Puntos
[22:18] Buho-Transparente Tiempo! La respuesta es -> gregorio�ernandez <- [22:18] Buho-Transparente
Tiempo! La respuesta es -> gregorio�ernandez <-
[22:18] Buho-Transparente For The Competitive Edge type !pingme [22:18] Buho-Transparente
For The Competitive Edge type !pingme
[22:18] Buho-Transparente Tri.10346 Mitologiaɭartuniki˿DIOSjGRIEGOjQUEjMODELoqELjAUToMATAjDEjTALOSj?j [22:18] Buho-Transparente
Tri.10346 Mitologiaɭartuniki˿DIOSjGRIEGOjQUEjMODELoqELjAUToMATAjDEjTALOSj?j
[22:18] Buho-Transparente 1 Pista: ******* Pregunta de BONUS : 50000 Puntos [22:18] Buho-Transparente
1 Pista: ******* Pregunta de BONUS : 50000 Puntos
[22:19] Buho-Transparente 2 Pista: hef**** 30 segundos y 50000 Puntos [22:19] Buho-Transparente
2 Pista: hef**** 30 segundos y 50000 Puntos
[22:19] Buho-Transparente 3 Pista: hefe**o 15 segundos y 50000 Puntos [22:19] Buho-Transparente
3 Pista: hefe**o 15 segundos y 50000 Puntos
[22:19] Buho-Transparente Tiempo! La respuesta es -> hefesto <- [22:19] Buho-Transparente
Tiempo! La respuesta es -> hefesto <-
[22:19] Buho-Transparente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [22:19] Buho-Transparente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[22:19] Buho-Transparente Tri.20491 LiteraturaɁntiquo˿CUALzERAzELzSEGUNDOzAPELLIDOzDEzFRANCISCOzDEzQUEVEDOz?z [22:19] Buho-Transparente
Tri.20491 LiteraturaɁntiquo˿CUALzERAzELzSEGUNDOzAPELLIDOzDEzFRANCISCOzDEzQUEVEDOz?z
[22:19] Buho-Transparente 1 Pista: ******** Valor pregunta : 20198 Puntos [22:19] Buho-Transparente
1 Pista: ******** Valor pregunta : 20198 Puntos
[22:20] Buho-Transparente 2 Pista: vil***** 30 segundos y 20198 Puntos [22:20] Buho-Transparente
2 Pista: vil***** 30 segundos y 20198 Puntos
[22:20] Buho-Transparente 3 Pista: vil*e*a* 15 segundos y 20198 Puntos [22:20] Buho-Transparente
3 Pista: vil*e*a* 15 segundos y 20198 Puntos
[22:20] Buho-Transparente Tiempo! La respuesta es -> villegas <- [22:20] Buho-Transparente
Tiempo! La respuesta es -> villegas <-
[22:20] Buho-Transparente R᮫ing MES: - #1: Ardilla\Insufrible 17270605 #2: Flamenco-Real 16796092 #3: Rana}ConTimidez 16651319 #4: TigreSinRespeto 15190500 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: Alitas 4100139 #8: SMAW 4012154 #9: LaCamelia 3029384 #10: Avestruz-Feroz 2083671 [22:20] Buho-Transparente
R᮫ing MES: - #1: Ardilla\Insufrible 17270605 #2: Flamenco-Real 16796092 #3: Rana}ConTimidez 16651319 #4: TigreSinRespeto 15190500 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: Alitas 4100139 #8: SMAW 4012154 #9: LaCamelia 3029384 #10: Avestruz-Feroz 2083671
[22:20] Buho-Transparente Tri.235 Musicaɳubmarin˿Enmquexa񯃰1qnacioqwagner?a?a [22:20] Buho-Transparente
Tri.235 Musicaɳubmarin˿Enmquexa񯃰1qnacioqwagner?a?a
[22:20] Buho-Transparente 1 Pista: **** Valor pregunta : 7335 Puntos [22:20] Buho-Transparente
1 Pista: **** Valor pregunta : 7335 Puntos
[22:20] Buho-Transparente 2 Pista: 181* 30 segundos y 7335 Puntos [22:20] Buho-Transparente
2 Pista: 181* 30 segundos y 7335 Puntos
[22:21] Buho-Transparente 3 Pista: 181* 15 segundos y 7335 Puntos [22:21] Buho-Transparente
3 Pista: 181* 15 segundos y 7335 Puntos
[22:21] Buho-Transparente Tiempo! La respuesta es -> 1813 <- [22:21] Buho-Transparente
Tiempo! La respuesta es -> 1813 <-
[22:21] Buho-Transparente Please refrain from using Extreme Bad Language [22:21] Buho-Transparente
Please refrain from using Extreme Bad Language
[22:21] Buho-Transparente Tri.3401 GastronomiaɁnghara˿Desd󮤥ssonwlasrmara񵥬asr?l [22:21] Buho-Transparente
Tri.3401 GastronomiaɁnghara˿Desd󮤥ssonwlasrmara񵥬asr?l
[22:21] Buho-Transparente 1 Pista: ******** Valor pregunta : 20641 Puntos [22:21] Buho-Transparente
1 Pista: ******** Valor pregunta : 20641 Puntos
[22:21] Buho-Transparente 2 Pista: ast***** 30 segundos y 20641 Puntos [22:21] Buho-Transparente
2 Pista: ast***** 30 segundos y 20641 Puntos
[22:22] Buho-Transparente 3 Pista: astu*ia* 15 segundos y 20641 Puntos [22:22] Buho-Transparente
3 Pista: astu*ia* 15 segundos y 20641 Puntos
[22:22] Buho-Transparente Tiempo! La respuesta es -> asturias <- [22:22] Buho-Transparente
Tiempo! La respuesta es -> asturias <-
[22:22] Buho-Transparente This is #Mexico, I am your host Buho-Transparente, running Buho-Transparente [22:22] Buho-Transparente
This is #Mexico, I am your host Buho-Transparente, running Buho-Transparente
[22:22] Buho-Transparente Tri.18022 ArteɅME^˿ENo1075oCOMENZOoLAoCONSTRUCCIONoDEoLAoCATEDRALoDE....o?o [22:22] Buho-Transparente
Tri.18022 ArteɅME^˿ENo1075oCOMENZOoLAoCONSTRUCCIONoDEoLAoCATEDRALoDE....o?o
[22:22] Buho-Transparente 1 Pista: ******** ** ********** Valor pregunta : 21621 Puntos [22:22] Buho-Transparente
1 Pista: ******** ** ********** Valor pregunta : 21621 Puntos
[22:22] Buho-Transparente 2 Pista: san***** ** ********** 30 segundos y 21621 Puntos [22:22] Buho-Transparente
2 Pista: san***** ** ********** 30 segundos y 21621 Puntos
[22:23] Buho-Transparente 3 Pista: san*ia*o *e *o**o**e*a 15 segundos y 21621 Puntos [22:23] Buho-Transparente
3 Pista: san*ia*o *e *o**o**e*a 15 segundos y 21621 Puntos
[22:23] Buho-Transparente Tiempo! La respuesta es -> santiago�e�ompostela <- [22:23] Buho-Transparente
Tiempo! La respuesta es -> santiago�e�ompostela <-
[22:23] Buho-Transparente This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Avestruz-Feroz 2083671 #13: Sirena__ 1207677 #14: LeCaTwaLk_z 1185079 #15: Chornobyl 873565 #16: etewsgy 695960 #17: kitana_- 692692 #18: julia__ 611502 #19: karen-62 535210 #20: AlbertoA 475137 [22:23] Buho-Transparente
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Avestruz-Feroz 2083671 #13: Sirena__ 1207677 #14: LeCaTwaLk_z 1185079 #15: Chornobyl 873565 #16: etewsgy 695960 #17: kitana_- 692692 #18: julia__ 611502 #19: karen-62 535210 #20: AlbertoA 475137
[22:23] Buho-Transparente Tri.14948 Cienciaɴamzarian˿EnielhEcuador,tߣu᮴ashestrellashsonivisibleshtodashlashnocheshdelha񯿃01t?t [22:23] Buho-Transparente
Tri.14948 Cienciaɴamzarian˿EnielhEcuador,tߣu᮴ashestrellashsonivisibleshtodashlashnocheshdelha񯿃01t?t
[22:23] Buho-Transparente 1 Pista: ******* Valor pregunta : 15698 Puntos [22:23] Buho-Transparente
1 Pista: ******* Valor pregunta : 15698 Puntos
[22:23] Buho-Transparente 2 Pista: nin**** 30 segundos y 15698 Puntos [22:23] Buho-Transparente
2 Pista: nin**** 30 segundos y 15698 Puntos
[22:23] Buho-Transparente 3 Pista: nin*u*a 15 segundos y 15698 Puntos [22:23] Buho-Transparente
3 Pista: nin*u*a 15 segundos y 15698 Puntos
[22:24] Buho-Transparente Tiempo! La respuesta es -> ninguna <- [22:24] Buho-Transparente
Tiempo! La respuesta es -> ninguna <-
[22:24] Buho-Transparente Please remember this is a FREE service, Please do not complain [22:24] Buho-Transparente
Please remember this is a FREE service, Please do not complain
[22:24] Buho-Transparente Tri.3103 Mitologiaɭartuniki˿ARTEMISAiESiLAiHERMANAiGEMELAiDEi?i [22:24] Buho-Transparente
Tri.3103 Mitologiaɭartuniki˿ARTEMISAiESiLAiHERMANAiGEMELAiDEi?i
[22:24] Buho-Transparente 1 Pista: ***** Valor pregunta : 15918 Puntos [22:24] Buho-Transparente
1 Pista: ***** Valor pregunta : 15918 Puntos
[22:24] Buho-Transparente 2 Pista: apo** 30 segundos y 15918 Puntos [22:24] Buho-Transparente
2 Pista: apo** 30 segundos y 15918 Puntos
[22:24] Buho-Transparente 3 Pista: apo*o 15 segundos y 15918 Puntos [22:24] Buho-Transparente
3 Pista: apo*o 15 segundos y 15918 Puntos
[22:25] Buho-Transparente Tiempo! La respuesta es -> apolo <- [22:25] Buho-Transparente
Tiempo! La respuesta es -> apolo <-
[22:25] Buho-Transparente This MONTHS Top 11-20: - #11: Sirena__ 938571 #12: Chornobyl 873565 #13: kitana_- 682987 #14: julia__ 611502 #15: Cubanito 581548 #16: karen-62 535210 #17: AlbertoA 475137 #18: KaZuMa_KiRyU 435575 #19: karen-53 342268 #20: karen- 298704 [22:25] Buho-Transparente
This MONTHS Top 11-20: - #11: Sirena__ 938571 #12: Chornobyl 873565 #13: kitana_- 682987 #14: julia__ 611502 #15: Cubanito 581548 #16: karen-62 535210 #17: AlbertoA 475137 #18: KaZuMa_KiRyU 435575 #19: karen-53 342268 #20: karen- 298704
[22:25] Buho-Transparente Tri.8977 Politicaɢoquer˿Dehqu郰1jex-l�rqpol�coferamsuegrofellcoronellVicentehRomerof?j [22:25] Buho-Transparente
Tri.8977 Politicaɢoquer˿Dehqu郰1jex-l�rqpol�coferamsuegrofellcoronellVicentehRomerof?j
[22:25] Buho-Transparente 1 Pista: ****** ******** Pregunta de BONUS : 100000 Puntos [22:25] Buho-Transparente
1 Pista: ****** ******** Pregunta de BONUS : 100000 Puntos
[22:25] Buho-Transparente 2 Pista: fel*** ******** 30 segundos y 100000 Puntos [22:25] Buho-Transparente
2 Pista: fel*** ******** 30 segundos y 100000 Puntos
[22:25] Buho-Transparente 3 Pista: feli*e *o**a*e* 15 segundos y 100000 Puntos [22:25] Buho-Transparente
3 Pista: feli*e *o**a*e* 15 segundos y 100000 Puntos
[22:26] Buho-Transparente Tiempo! La respuesta es -> felipe�onzalez <- [22:26] Buho-Transparente
Tiempo! La respuesta es -> felipe�onzalez <-
[22:26] Buho-Transparente Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar [22:26] Buho-Transparente
Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar
[22:26] Cocodrilo\ConBravura Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas [22:26] Cocodrilo\ConBravura
Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas
| Share with: