Historia de #mexico 08/07/2026 21:10 31 visitas

Hour Alias Mensaje Mensaje
[21:10] CaracolSuave !Stats [21:10] CaracolSuave
!Stats
[21:10] Cobaya-Suave Realización de estadísticas en curso. Solicitadas por: CaracolSuave. [21:10] Cobaya-Suave
Realización de estadísticas en curso. Solicitadas por: CaracolSuave.
[21:11] Cobaya-Suave Resumen de estadísticas - Los que más han escrito hoy -> Culebra\Brillante ( 2075 ), CaracolSuave ( 88), Miriam_ ( 20), ChicodeGranada ( 18), elagujero ( 15), Maryel_ ( 7), Chica05 ( 4), alEldenena ( 3), QuieroChat68 ( 2), ggg ( 2 ) [21:11] Cobaya-Suave
Resumen de estadísticas - Los que más han escrito hoy -> Culebra\Brillante ( 2075 ), CaracolSuave ( 88), Miriam_ ( 20), ChicodeGranada ( 18), elagujero ( 15), Maryel_ ( 7), Chica05 ( 4), alEldenena ( 3), QuieroChat68 ( 2), ggg ( 2 )
[21:11] Cobaya-Suave Estadísticas actualizadas por CaracolSuave. Visite las estadísticas en https://www.winstats.es/stats/mexico.html [21:11] Cobaya-Suave
Estadísticas actualizadas por CaracolSuave. Visite las estadísticas en https://www.winstats.es/stats/mexico.html
[21:11] CaballitoDeMar}Feliz ¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [21:11] CaballitoDeMar}Feliz
¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[21:11] CaracolSuave !jugar [21:11] CaracolSuave
!jugar
[21:11] Culebra\Brillante EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!! [21:11] Culebra\Brillante
EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!!
[21:12] Culebra\Brillante R᮫ing �ltima SEMANA: #1: CaracolSuave 52274936 #2: Paulus 12116637 #3: _Samantha_ 12018901 [21:12] Culebra\Brillante
R᮫ing �ltima SEMANA: #1: CaracolSuave 52274936 #2: Paulus 12116637 #3: _Samantha_ 12018901
[21:12] Culebra\Brillante Tri.19116 MiscelaneaɍARdeJAVA˿DEuQUɃ13uSIGNOuDELuZOD́COuESuUNAuPERSONAuNACIDAuENTREuELu20uDEuABRILuYuELu20uDEuMAYO?u?u [21:12] Culebra\Brillante
Tri.19116 MiscelaneaɍARdeJAVA˿DEuQUɃ13uSIGNOuDELuZOD́COuESuUNAuPERSONAuNACIDAuENTREuELu20uDEuABRILuYuELu20uDEuMAYO?u?u
[21:12] Culebra\Brillante 1 Pista: ***** Valor pregunta : 17167 Puntos [21:12] Culebra\Brillante
1 Pista: ***** Valor pregunta : 17167 Puntos
[21:12] Culebra\Brillante 2 Pista: tau** 30 segundos y 17167 Puntos [21:12] Culebra\Brillante
2 Pista: tau** 30 segundos y 17167 Puntos
[21:12] CaracolSuave tauro [21:12] CaracolSuave
tauro
[21:12] Culebra\Brillante �e nota que sabes mucho de esto CaracolSuave! Tu respuesta "tauro" es correcta y ganas �7167�12 puntos [21:12] Culebra\Brillante
�e nota que sabes mucho de esto CaracolSuave! Tu respuesta "tauro" es correcta y ganas �7167�12 puntos
[21:12] Culebra\Brillante CaracolSuave has acertado 1 seguidas!! Puntos HOY: 7509778, SEMANA: 30178024 y MES: 64372853 [21:12] Culebra\Brillante
CaracolSuave has acertado 1 seguidas!! Puntos HOY: 7509778, SEMANA: 30178024 y MES: 64372853
[21:12] Culebra\Brillante Los jugadore Top10 (Semanal & Mensual) Tienen auto-Voice! [21:12] Culebra\Brillante
Los jugadore Top10 (Semanal & Mensual) Tienen auto-Voice!
[21:12] Culebra\Brillante Tri.2430 BiologiaɓESINO˿C󭯃13uselllamajcadajunajdellasbformasbennquelpuedelpresentarselunngennennunnmismoulocus?w?w [21:12] Culebra\Brillante
Tri.2430 BiologiaɓESINO˿C󭯃13uselllamajcadajunajdellasbformasbennquelpuedelpresentarselunngennennunnmismoulocus?w?w
[21:12] Culebra\Brillante 1 Pista: ***** Valor pregunta : 12934 Puntos [21:12] Culebra\Brillante
1 Pista: ***** Valor pregunta : 12934 Puntos
[21:12] Culebra\Brillante 2 Pista: ale** 30 segundos y 12934 Puntos [21:12] Culebra\Brillante
2 Pista: ale** 30 segundos y 12934 Puntos
[21:13] Culebra\Brillante 3 Pista: ale*o 15 segundos y 12934 Puntos [21:13] Culebra\Brillante
3 Pista: ale*o 15 segundos y 12934 Puntos
[21:13] CaracolSuave alelo [21:13] CaracolSuave
alelo
[21:13] Culebra\Brillante �Bien CaracolSuave!! Tu respuesta: "alelo" es correcta y ganas �2934�12 puntos [21:13] Culebra\Brillante
�Bien CaracolSuave!! Tu respuesta: "alelo" es correcta y ganas �2934�12 puntos
[21:13] Culebra\Brillante CaracolSuave has acertado 2 seguidas!! Puntos HOY: 7522712, SEMANA: 30190958 y MES: 64385787 [21:13] Culebra\Brillante
CaracolSuave has acertado 2 seguidas!! Puntos HOY: 7522712, SEMANA: 30190958 y MES: 64385787
[21:13] Culebra\Brillante Si detecta una pregunta o respuesta incorrecta, por favor, comun�elo a un OP de la sala [21:13] Culebra\Brillante
Si detecta una pregunta o respuesta incorrecta, por favor, comun�elo a un OP de la sala
[21:13] Culebra\Brillante Tri.18122 Cienciaɳtephenwo˿Alacruzarvdeounohusoyhorarioyauotroyhaciauorienteoqueoseohaceoconolauhora?g?g [21:13] Culebra\Brillante
Tri.18122 Cienciaɳtephenwo˿Alacruzarvdeounohusoyhorarioyauotroyhaciauorienteoqueoseohaceoconolauhora?g?g
[21:13] Culebra\Brillante 1 Pista: ** ******** Valor pregunta : 23867 Puntos [21:13] Culebra\Brillante
1 Pista: ** ******** Valor pregunta : 23867 Puntos
[21:13] Culebra\Brillante 2 Pista: se�******* 30 segundos y 23867 Puntos [21:13] Culebra\Brillante
2 Pista: se�******* 30 segundos y 23867 Puntos
[21:13] CaracolSuave se adelanta [21:13] CaracolSuave
se adelanta
[21:13] Culebra\Brillante �Suma y sigue CaracolSuave!! La respuesta: "se adelanta" incrementa tu marcador en �3867�12 puntos [21:13] Culebra\Brillante
�Suma y sigue CaracolSuave!! La respuesta: "se adelanta" incrementa tu marcador en �3867�12 puntos
[21:13] Culebra\Brillante CaracolSuave has acertado 3 seguidas!! Puntos HOY: 7546579, SEMANA: 30214825 y MES: 64409654 [21:13] Culebra\Brillante
CaracolSuave has acertado 3 seguidas!! Puntos HOY: 7546579, SEMANA: 30214825 y MES: 64409654
[21:13] Culebra\Brillante R᮫ing SEMANA: - #1: CaracolSuave 30214825 #2: Paulus 8435839 #3: siva- 4607335 #4: LeCaTwaLk_z 2198600 #5: ChicodeGranada 244103 #6: Miriam_ 108988 #7: elagujero 108090 #8: Maryel_ 25000 #9: YasuoGr 23969 #10: Tigre_Marron 20136 [21:13] Culebra\Brillante
R᮫ing SEMANA: - #1: CaracolSuave 30214825 #2: Paulus 8435839 #3: siva- 4607335 #4: LeCaTwaLk_z 2198600 #5: ChicodeGranada 244103 #6: Miriam_ 108988 #7: elagujero 108090 #8: Maryel_ 25000 #9: YasuoGr 23969 #10: Tigre_Marron 20136
[21:13] Culebra\Brillante Tri.275 InformaticaɖaKaMiLKa˿Efectov2000:bFelizba񯮮.b?b [21:13] Culebra\Brillante
Tri.275 InformaticaɖaKaMiLKa˿Efectov2000:bFelizba񯮮.b?b
[21:13] Culebra\Brillante 1 Pista: **** Valor pregunta : 18031 Puntos [21:13] Culebra\Brillante
1 Pista: **** Valor pregunta : 18031 Puntos
[21:14] CaracolSuave 1999 [21:14] CaracolSuave
1999
[21:14] Culebra\Brillante 2 Pista: 190* 30 segundos y 18031 Puntos [21:14] Culebra\Brillante
2 Pista: 190* 30 segundos y 18031 Puntos
[21:14] CaracolSuave 1900 [21:14] CaracolSuave
1900
[21:14] Culebra\Brillante �e nota que sabes mucho de esto CaracolSuave! Tu respuesta "1900" es correcta y ganas �8031�12 puntos [21:14] Culebra\Brillante
�e nota que sabes mucho de esto CaracolSuave! Tu respuesta "1900" es correcta y ganas �8031�12 puntos
[21:14] Culebra\Brillante CaracolSuave has acertado 4 seguidas!! Puntos HOY: 7564610, SEMANA: 30232856 y MES: 64427685 [21:14] Culebra\Brillante
CaracolSuave has acertado 4 seguidas!! Puntos HOY: 7564610, SEMANA: 30232856 y MES: 64427685
[21:14] Culebra\Brillante Tenemos m᳠de 70.000 preguntas y respuestas!! [21:14] Culebra\Brillante
Tenemos m᳠de 70.000 preguntas y respuestas!!
[21:14] Culebra\Brillante Tri.10327 Miscelaneaɴjmm.com˿Conqqu郱3nc󤩧ossexidentificawawlosjlᰩcesjosminasjdexdurezawmedia?n?n [21:14] Culebra\Brillante
Tri.10327 Miscelaneaɴjmm.com˿Conqqu郱3nc󤩧ossexidentificawawlosjlᰩcesjosminasjdexdurezawmedia?n?n
[21:14] Culebra\Brillante 1 Pista: ** Pregunta de BONUS : 200000 Puntos [21:14] Culebra\Brillante
1 Pista: ** Pregunta de BONUS : 200000 Puntos
[21:14] Culebra\Brillante 2 Pista: hb 30 segundos y 200000 Puntos [21:14] Culebra\Brillante
2 Pista: hb 30 segundos y 200000 Puntos
[21:14] CaracolSuave hb [21:14] CaracolSuave
hb
[21:14] Culebra\Brillante �Muy bien CaracolSuave!! Acertaste "hb" en tan s󬯠�8.766 segundos y por eso has ganado: �00000�12 puntos [21:14] Culebra\Brillante
�Muy bien CaracolSuave!! Acertaste "hb" en tan s󬯠�8.766 segundos y por eso has ganado: �00000�12 puntos
[21:14] Culebra\Brillante CaracolSuave has acertado 5 seguidas!! Puntos HOY: 7764610, SEMANA: 30432856 y MES: 64627685 [21:14] Culebra\Brillante
CaracolSuave has acertado 5 seguidas!! Puntos HOY: 7764610, SEMANA: 30432856 y MES: 64627685
[21:15] Culebra\Brillante Tri.3706 DeporteɔeLaRaNhA˿F1:kcircuitospdeldMundial:kBahreins?k [21:15] Culebra\Brillante
Tri.3706 DeporteɔeLaRaNhA˿F1:kcircuitospdeldMundial:kBahreins?k
[21:15] Culebra\Brillante 1 Pista: ******* ************* ******* Valor pregunta : 12935 Puntos [21:15] Culebra\Brillante
1 Pista: ******* ************* ******* Valor pregunta : 12935 Puntos
[21:15] Culebra\Brillante 2 Pista: bah**** ************* ******* 30 segundos y 12935 Puntos [21:15] Culebra\Brillante
2 Pista: bah**** ************* ******* 30 segundos y 12935 Puntos
[21:15] Culebra\Brillante 3 Pista: bah*ei* i**e**a*io*a* *i**ui* 15 segundos y 12935 Puntos [21:15] Culebra\Brillante
3 Pista: bah*ei* i**e**a*io*a* *i**ui* 15 segundos y 12935 Puntos
[21:15] Culebra\Brillante Tiempo! La respuesta es -> bahrein�nternational�ircuit <- [21:15] Culebra\Brillante
Tiempo! La respuesta es -> bahrein�nternational�ircuit <-
[21:15] Culebra\Brillante 12935 Puntos a adidos al BOTE, donde hay 2681638 Puntos [21:15] Culebra\Brillante
12935 Puntos a adidos al BOTE, donde hay 2681638 Puntos
[21:15] Culebra\Brillante Atenci󮠡 las preguntas MEGA BONUS de 500.000 y 1.000.000 de puntos [21:15] Culebra\Brillante
Atenci󮠡 las preguntas MEGA BONUS de 500.000 y 1.000.000 de puntos
[21:15] Culebra\Brillante Tri.16015 LiteraturaɉRC-Domain˿Autorrdee"aguilastydcuervos"b?b [21:15] Culebra\Brillante
Tri.16015 LiteraturaɉRC-Domain˿Autorrdee"aguilastydcuervos"b?b
[21:15] Culebra\Brillante 1 Pista: ******* ***** Valor pregunta : 21081 Puntos [21:15] Culebra\Brillante
1 Pista: ******* ***** Valor pregunta : 21081 Puntos
[21:16] Culebra\Brillante 2 Pista: pau**** ***** 30 segundos y 21081 Puntos [21:16] Culebra\Brillante
2 Pista: pau**** ***** 30 segundos y 21081 Puntos
[21:16] Culebra\Brillante 3 Pista: pau*i*e *e**e 15 segundos y 21081 Puntos [21:16] Culebra\Brillante
3 Pista: pau*i*e *e**e 15 segundos y 21081 Puntos
[21:16] Culebra\Brillante Tiempo! La respuesta es -> pauline�edge <- [21:16] Culebra\Brillante
Tiempo! La respuesta es -> pauline�edge <-
[21:16] Culebra\Brillante 21081 Puntos a adidos al BOTE, donde hay 2702719 Puntos [21:16] Culebra\Brillante
21081 Puntos a adidos al BOTE, donde hay 2702719 Puntos
[21:16] Culebra\Brillante Recuerda que est Trivia e GRATIS, por favor, no se queje [21:16] Culebra\Brillante
Recuerda que est Trivia e GRATIS, por favor, no se queje
[21:16] Culebra\Brillante Tri.2477 InformaticaɗILDone˿(consolas)quegvideojuegowtraiaqyaqinstaladowlaqconsolaqmastervsystemhenhsujlanzamientow?y [21:16] Culebra\Brillante
Tri.2477 InformaticaɗILDone˿(consolas)quegvideojuegowtraiaqyaqinstaladowlaqconsolaqmastervsystemhenhsujlanzamientow?y
[21:16] Culebra\Brillante 1 Pista: **** *** Pregunta de BONUS : 25000 Puntos [21:16] Culebra\Brillante
1 Pista: **** *** Pregunta de BONUS : 25000 Puntos
[21:17] Culebra\Brillante 2 Pista: ale* *** 30 segundos y 25000 Puntos [21:17] Culebra\Brillante
2 Pista: ale* *** 30 segundos y 25000 Puntos
[21:17] Culebra\Brillante 3 Pista: ale* *i* 15 segundos y 25000 Puntos [21:17] Culebra\Brillante
3 Pista: ale* *i* 15 segundos y 25000 Puntos
[21:17] Culebra\Brillante Tiempo! La respuesta es -> alex�id <- [21:17] Culebra\Brillante
Tiempo! La respuesta es -> alex�id <-
[21:17] Culebra\Brillante 25000 Puntos a adidos al BOTE, donde hay 2727719 Puntos [21:17] Culebra\Brillante
25000 Puntos a adidos al BOTE, donde hay 2727719 Puntos
[21:17] Culebra\Brillante Tri.11554 Cancionesɖonk˿Defquiengesqlaecanciongdearvyokos?n [21:17] Culebra\Brillante
Tri.11554 Cancionesɖonk˿Defquiengesqlaecanciongdearvyokos?n
[21:17] Culebra\Brillante 1 Pista: **** ****** Valor pregunta : 15069 Puntos [21:17] Culebra\Brillante
1 Pista: **** ****** Valor pregunta : 15069 Puntos
[21:18] Culebra\Brillante 2 Pista: joh* ****** 30 segundos y 15069 Puntos [21:18] Culebra\Brillante
2 Pista: joh* ****** 30 segundos y 15069 Puntos
[21:18] Culebra\Brillante 3 Pista: joh* *e**o* 15 segundos y 15069 Puntos [21:18] Culebra\Brillante
3 Pista: joh* *e**o* 15 segundos y 15069 Puntos
[21:18] CaracolSuave john lennon [21:18] CaracolSuave
john lennon
[21:18] Culebra\Brillante �Est᳠que lo tiras CaracolSuave!! ߃󭯠supiste que "john lennon" era la respuesta? Venga, �5069�12 puntos suben a tu marcador [21:18] Culebra\Brillante
�Est᳠que lo tiras CaracolSuave!! ߃󭯠supiste que "john lennon" era la respuesta? Venga, �5069�12 puntos suben a tu marcador
[21:18] Culebra\Brillante CaracolSuave has acertado 6 seguidas!! Puntos HOY: 7779679, SEMANA: 30447925 y MES: 64642754 [21:18] Culebra\Brillante
CaracolSuave has acertado 6 seguidas!! Puntos HOY: 7779679, SEMANA: 30447925 y MES: 64642754
[21:18] Culebra\Brillante Si desea agregar preguntas & respuestas a la BASE DE DATOS, por favor, comun�elo a un OP de la sala [21:18] Culebra\Brillante
Si desea agregar preguntas & respuestas a la BASE DE DATOS, por favor, comun�elo a un OP de la sala
[21:18] Culebra\Brillante Tri.13199 Biologiaɳherif˿Cuᬃ13yeszelynombrencient�cosdelycangurosrojo?l?l [21:18] Culebra\Brillante
Tri.13199 Biologiaɳherif˿Cuᬃ13yeszelynombrencient�cosdelycangurosrojo?l?l
[21:18] Culebra\Brillante 1 Pista: ******** ***** Valor pregunta : 12215 Puntos [21:18] Culebra\Brillante
1 Pista: ******** ***** Valor pregunta : 12215 Puntos
[21:18] Culebra\Brillante 2 Pista: mac***** ***** 30 segundos y 12215 Puntos [21:18] Culebra\Brillante
2 Pista: mac***** ***** 30 segundos y 12215 Puntos
[21:19] Culebra\Brillante 3 Pista: mac*o*u* *u*u* 15 segundos y 12215 Puntos [21:19] Culebra\Brillante
3 Pista: mac*o*u* *u*u* 15 segundos y 12215 Puntos
[21:19] Culebra\Brillante Tiempo! La respuesta es -> macropus�ufus <- [21:19] Culebra\Brillante
Tiempo! La respuesta es -> macropus�ufus <-
[21:19] Culebra\Brillante 12215 Puntos a adidos al BOTE, donde hay 2739934 Puntos [21:19] Culebra\Brillante
12215 Puntos a adidos al BOTE, donde hay 2739934 Puntos
[21:19] Culebra\Brillante R᮫ing por D́: - Domingo: Paulus 8435839 Lunes: CaracolSuave 6563878 Martes: CaracolSuave 8576491 Miercoles: CaracolSuave 7893517 Jueves: CaracolSuave 5997199 Viernes: CaracolSuave 3467306 Sᢡdo: Paulus 7947521 [21:19] Culebra\Brillante
R᮫ing por D́: - Domingo: Paulus 8435839 Lunes: CaracolSuave 6563878 Martes: CaracolSuave 8576491 Miercoles: CaracolSuave 7893517 Jueves: CaracolSuave 5997199 Viernes: CaracolSuave 3467306 Sᢡdo: Paulus 7947521
[21:19] Culebra\Brillante Tri.4229 Medicina-Saludɤassler˿C󭯃13psevllamaqlaqenfermedadqinfecciosaqcausadaqporcunzhongopquevsevalojaqgeneralmentevenzlosopulmones?k?k [21:19] Culebra\Brillante
Tri.4229 Medicina-Saludɤassler˿C󭯃13psevllamaqlaqenfermedadqinfecciosaqcausadaqporcunzhongopquevsevalojaqgeneralmentevenzlosopulmones?k?k
[21:19] Culebra\Brillante 1 Pista: ************* Valor pregunta : 23788 Puntos [21:19] Culebra\Brillante
1 Pista: ************* Valor pregunta : 23788 Puntos
[21:19] Culebra\Brillante 2 Pista: bla********** 30 segundos y 23788 Puntos [21:19] Culebra\Brillante
2 Pista: bla********** 30 segundos y 23788 Puntos
[21:20] Culebra\Brillante 3 Pista: bla**o*i*o*i* 15 segundos y 23788 Puntos [21:20] Culebra\Brillante
3 Pista: bla**o*i*o*i* 15 segundos y 23788 Puntos
[21:20] Culebra\Brillante Tiempo! La respuesta es -> blastomicosis <- [21:20] Culebra\Brillante
Tiempo! La respuesta es -> blastomicosis <-
[21:20] Culebra\Brillante 23788 Puntos a adidos al BOTE, donde hay 2763722 Puntos [21:20] Culebra\Brillante
23788 Puntos a adidos al BOTE, donde hay 2763722 Puntos
[21:20] Culebra\Brillante Para conocer los jugadores con mayores puntuaciones escriba... !top10 [21:20] Culebra\Brillante
Para conocer los jugadores con mayores puntuaciones escriba... !top10
[21:20] Culebra\Brillante Tri.19652 Miscelaneaɂatval˿COMOmSEmDENOMINAmLAmCA񁃱3mCONmLASmQUEmSEmFABRICANmLASmCANOASmDELmTITICACA?m?m [21:20] Culebra\Brillante
Tri.19652 Miscelaneaɂatval˿COMOmSEmDENOMINAmLAmCA񁃱3mCONmLASmQUEmSEmFABRICANmLASmCANOASmDELmTITICACA?m?m
[21:20] Culebra\Brillante 1 Pista: ****** Valor pregunta : 6176 Puntos [21:20] Culebra\Brillante
1 Pista: ****** Valor pregunta : 6176 Puntos
[21:20] Culebra\Brillante 2 Pista: tot*** 30 segundos y 6176 Puntos [21:20] Culebra\Brillante
2 Pista: tot*** 30 segundos y 6176 Puntos
[21:20] Culebra\Brillante 3 Pista: toto*a 15 segundos y 6176 Puntos [21:20] Culebra\Brillante
3 Pista: toto*a 15 segundos y 6176 Puntos
[21:21] Culebra\Brillante Tiempo! La respuesta es -> totora <- [21:21] Culebra\Brillante
Tiempo! La respuesta es -> totora <-
[21:21] Culebra\Brillante 6176 Puntos a adidos al BOTE, donde hay 2769898 Puntos [21:21] Culebra\Brillante
6176 Puntos a adidos al BOTE, donde hay 2769898 Puntos
[21:21] Culebra\Brillante Tri.13641 Biologiaɳherif˿Cuᬃ13wesfelwnombrencient�cogdenladmarmota?d?d [21:21] Culebra\Brillante
Tri.13641 Biologiaɳherif˿Cuᬃ13wesfelwnombrencient�cogdenladmarmota?d?d
[21:21] Culebra\Brillante 1 Pista: ******* ******* Valor pregunta : 24571 Puntos [21:21] Culebra\Brillante
1 Pista: ******* ******* Valor pregunta : 24571 Puntos
[21:21] Culebra\Brillante 2 Pista: mar**** ******* 30 segundos y 24571 Puntos [21:21] Culebra\Brillante
2 Pista: mar**** ******* 30 segundos y 24571 Puntos
[21:21] Culebra\Brillante 3 Pista: mar*o*a *a**o*a 15 segundos y 24571 Puntos [21:21] Culebra\Brillante
3 Pista: mar*o*a *a**o*a 15 segundos y 24571 Puntos
[21:22] Culebra\Brillante Tiempo! La respuesta es -> marmota�armota <- [21:22] Culebra\Brillante
Tiempo! La respuesta es -> marmota�armota <-
[21:22] Culebra\Brillante 24571 Puntos a adidos al BOTE, donde hay 2794469 Puntos [21:22] Culebra\Brillante
24571 Puntos a adidos al BOTE, donde hay 2794469 Puntos
[21:22] Culebra\Brillante Atenci󮠡 las preguntas BONUS de 25.000 y 100.000 puntos!!! [21:22] Culebra\Brillante
Atenci󮠡 las preguntas BONUS de 25.000 y 100.000 puntos!!!
[21:22] Culebra\Brillante Tri.11100 Literaturaɭeji˿Autorades"sue񯳃13wdesrobot"c?c [21:22] Culebra\Brillante
Tri.11100 Literaturaɭeji˿Autorades"sue񯳃13wdesrobot"c?c
[21:22] Culebra\Brillante 1 Pista: ***** ****** Valor pregunta : 18052 Puntos [21:22] Culebra\Brillante
1 Pista: ***** ****** Valor pregunta : 18052 Puntos
[21:22] Culebra\Brillante 2 Pista: isa** ****** 30 segundos y 18052 Puntos [21:22] Culebra\Brillante
2 Pista: isa** ****** 30 segundos y 18052 Puntos
[21:22] Culebra\Brillante 3 Pista: isaa* a*i*o* 15 segundos y 18052 Puntos [21:22] Culebra\Brillante
3 Pista: isaa* a*i*o* 15 segundos y 18052 Puntos
[21:23] Culebra\Brillante Tiempo! La respuesta es -> isaac�simov <- [21:23] Culebra\Brillante
Tiempo! La respuesta es -> isaac�simov <-
[21:23] Culebra\Brillante 18052 Puntos a adidos al BOTE, donde hay 2812521 Puntos [21:23] Culebra\Brillante
18052 Puntos a adidos al BOTE, donde hay 2812521 Puntos
[21:23] Culebra\Brillante Tri.12317 Eros-SexɎura˿Cualjesbeljpremiodespa񯬃13jmasbfamosodengliteraturaferoticaf?s [21:23] Culebra\Brillante
Tri.12317 Eros-SexɎura˿Cualjesbeljpremiodespa񯬃13jmasbfamosodengliteraturaferoticaf?s
[21:23] Culebra\Brillante 1 Pista: ** ******* ******** Valor pregunta : 14902 Puntos [21:23] Culebra\Brillante
1 Pista: ** ******* ******** Valor pregunta : 14902 Puntos
[21:23] Culebra\Brillante 2 Pista: la�****** ******** 30 segundos y 14902 Puntos [21:23] Culebra\Brillante
2 Pista: la�****** ******** 30 segundos y 14902 Puntos
[21:23] Culebra\Brillante 3 Pista: la�o**i*a *e**i*a* 15 segundos y 14902 Puntos [21:23] Culebra\Brillante
3 Pista: la�o**i*a *e**i*a* 15 segundos y 14902 Puntos
[21:23] Culebra\Brillante Tiempo! La respuesta es -> la�onrisa�ertical <- [21:23] Culebra\Brillante
Tiempo! La respuesta es -> la�onrisa�ertical <-
[21:23] Culebra\Brillante 14902 Puntos a adidos al BOTE, donde hay 2827423 Puntos [21:23] Culebra\Brillante
14902 Puntos a adidos al BOTE, donde hay 2827423 Puntos
[21:24] Culebra\Brillante Por favor, se agradece la correcci󮠥n su lenguaje [21:24] Culebra\Brillante
Por favor, se agradece la correcci󮠥n su lenguaje
[21:24] Culebra\Brillante Tri.18169 PoliticaɎaTa˿D󮤥paparecepeltperi󤩣ocm᳃13tadelantadoc?k [21:24] Culebra\Brillante
Tri.18169 PoliticaɎaTa˿D󮤥paparecepeltperi󤩣ocm᳃13tadelantadoc?k
[21:24] Culebra\Brillante 1 Pista: ******* Valor pregunta : 6408 Puntos [21:24] Culebra\Brillante
1 Pista: ******* Valor pregunta : 6408 Puntos
[21:24] Culebra\Brillante 2 Pista: seg**** 30 segundos y 6408 Puntos [21:24] Culebra\Brillante
2 Pista: seg**** 30 segundos y 6408 Puntos
[21:24] Culebra\Brillante 3 Pista: sego*ia 15 segundos y 6408 Puntos [21:24] Culebra\Brillante
3 Pista: sego*ia 15 segundos y 6408 Puntos
[21:24] Culebra\Brillante Tiempo! La respuesta es -> segovia <- [21:24] Culebra\Brillante
Tiempo! La respuesta es -> segovia <-
[21:24] Culebra\Brillante 6408 Puntos a adidos al BOTE, donde hay 2833831 Puntos [21:24] Culebra\Brillante
6408 Puntos a adidos al BOTE, donde hay 2833831 Puntos
[21:25] Culebra\Brillante This is #Mexico, I am your host Culebra\Brillante, running Culebra\Brillante [21:25] Culebra\Brillante
This is #Mexico, I am your host Culebra\Brillante, running Culebra\Brillante
[21:25] Culebra\Brillante Tri.16648 Deporteɡlamut˿Ennqueaequipoajug󃱳rennlaxNBArelbpivotgespa񯬃13bFernandoaMart�.r?r [21:25] Culebra\Brillante
Tri.16648 Deporteɡlamut˿Ennqueaequipoajug󃱳rennlaxNBArelbpivotgespa񯬃13bFernandoaMart�.r?r
[21:25] Culebra\Brillante 1 Pista: ******** ***** ******* Valor pregunta : 16723 Puntos [21:25] Culebra\Brillante
1 Pista: ******** ***** ******* Valor pregunta : 16723 Puntos
[21:25] Culebra\Brillante 2 Pista: por***** ***** ******* 30 segundos y 16723 Puntos [21:25] Culebra\Brillante
2 Pista: por***** ***** ******* 30 segundos y 16723 Puntos
[21:25] Culebra\Brillante 3 Pista: por**a** **ai* **a*e** 15 segundos y 16723 Puntos [21:25] Culebra\Brillante
3 Pista: por**a** **ai* **a*e** 15 segundos y 16723 Puntos
[21:25] Culebra\Brillante Tiempo! La respuesta es -> portland�rail�lazers <- [21:25] Culebra\Brillante
Tiempo! La respuesta es -> portland�rail�lazers <-
[21:25] Culebra\Brillante 16723 Puntos a adidos al BOTE, donde hay 2850554 Puntos [21:25] Culebra\Brillante
16723 Puntos a adidos al BOTE, donde hay 2850554 Puntos
[21:26] Culebra\Brillante This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [21:26] Culebra\Brillante
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[21:26] Culebra\Brillante Tri.20370 Mitologiaɇretel˿DIOSAbROMANAbDELbAMORb?b [21:26] Culebra\Brillante
Tri.20370 Mitologiaɇretel˿DIOSAbROMANAbDELbAMORb?b
[21:26] Culebra\Brillante 1 Pista: ***** Valor pregunta : 6887 Puntos [21:26] Culebra\Brillante
1 Pista: ***** Valor pregunta : 6887 Puntos
[21:26] Culebra\Brillante 2 Pista: ven** 30 segundos y 6887 Puntos [21:26] Culebra\Brillante
2 Pista: ven** 30 segundos y 6887 Puntos
[21:26] CaballitoDeMar}Feliz ¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [21:26] CaballitoDeMar}Feliz
¦ Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[21:26] Culebra\Brillante 3 Pista: venu* 15 segundos y 6887 Puntos [21:26] Culebra\Brillante
3 Pista: venu* 15 segundos y 6887 Puntos
[21:26] Culebra\Brillante Tiempo! La respuesta es -> venus <- [21:26] Culebra\Brillante
Tiempo! La respuesta es -> venus <-
[21:26] Culebra\Brillante 6887 Puntos a adidos al BOTE, donde hay 2857441 Puntos [21:26] Culebra\Brillante
6887 Puntos a adidos al BOTE, donde hay 2857441 Puntos
[21:26] Culebra\Brillante Recuerda que est Trivia e GRATIS, por favor, no se queje [21:26] Culebra\Brillante
Recuerda que est Trivia e GRATIS, por favor, no se queje
[21:26] Culebra\Brillante Tri.2068 MiscelaneaɍARdeJAVA˿DEhQUɃ13hSIGNOhDELhZOD́COhEShUNAhPERSONAhNACIDAhENTREhELh20hDEhENEROhYhELh18hDEhFEBRERO?h?h [21:26] Culebra\Brillante
Tri.2068 MiscelaneaɍARdeJAVA˿DEhQUɃ13hSIGNOhDELhZOD́COhEShUNAhPERSONAhNACIDAhENTREhELh20hDEhENEROhYhELh18hDEhFEBRERO?h?h
[21:26] Culebra\Brillante 1 Pista: ******* Valor pregunta : 17305 Puntos [21:26] Culebra\Brillante
1 Pista: ******* Valor pregunta : 17305 Puntos
[21:27] Culebra\Brillante 2 Pista: acu**** 30 segundos y 17305 Puntos [21:27] Culebra\Brillante
2 Pista: acu**** 30 segundos y 17305 Puntos
[21:27] CaracolSuave acuario [21:27] CaracolSuave
acuario
[21:27] Culebra\Brillante �As�e hace CaracolSuave!! Contestaste "acuario" en �7.032 segundos y sumas �7305�12 puntos [21:27] Culebra\Brillante
�As�e hace CaracolSuave!! Contestaste "acuario" en �7.032 segundos y sumas �7305�12 puntos
[21:27] Culebra\Brillante CaracolSuave has acertado 7 seguidas!! Puntos HOY: 7796984, SEMANA: 30465230 y MES: 64660059 [21:27] Culebra\Brillante
CaracolSuave has acertado 7 seguidas!! Puntos HOY: 7796984, SEMANA: 30465230 y MES: 64660059
[21:27] Culebra\Brillante This MONTHS Top 11-20: - #11: ChicodeGranada 738439 #12: Guiarte_Yo 619557 #13: BLaNKoN_PeR4eVeR 200000 #14: fff 173570 #15: Miriam_ 156310 #16: Cosmo 149640 #17: DanielPerez_ 116023 #18: elagujero 108090 #19: Alii 82683 #20: HeaLth_Rider 80860 [21:27] Culebra\Brillante
This MONTHS Top 11-20: - #11: ChicodeGranada 738439 #12: Guiarte_Yo 619557 #13: BLaNKoN_PeR4eVeR 200000 #14: fff 173570 #15: Miriam_ 156310 #16: Cosmo 149640 #17: DanielPerez_ 116023 #18: elagujero 108090 #19: Alii 82683 #20: HeaLth_Rider 80860
[21:27] Culebra\Brillante Tri.4604 Medicina-Saludɳtephewo˿Comopseyconoceyaolaoparteydeylaomedulaoespinalaendcontactopcondelacerebro?e?e [21:27] Culebra\Brillante
Tri.4604 Medicina-Saludɳtephewo˿Comopseyconoceyaolaoparteydeylaomedulaoespinalaendcontactopcondelacerebro?e?e
[21:27] Culebra\Brillante 1 Pista: ***** Pregunta de BONUS : 25000 Puntos [21:27] Culebra\Brillante
1 Pista: ***** Pregunta de BONUS : 25000 Puntos
[21:27] Culebra\Brillante 2 Pista: bul** 30 segundos y 25000 Puntos [21:27] Culebra\Brillante
2 Pista: bul** 30 segundos y 25000 Puntos
[21:28] Culebra\Brillante 3 Pista: bul*o 15 segundos y 25000 Puntos [21:28] Culebra\Brillante
3 Pista: bul*o 15 segundos y 25000 Puntos
[21:28] Culebra\Brillante Tiempo! La respuesta es -> bulbo <- [21:28] Culebra\Brillante
Tiempo! La respuesta es -> bulbo <-
[21:28] Culebra\Brillante 25000 Puntos a adidos al BOTE, donde hay 2882441 Puntos [21:28] Culebra\Brillante
25000 Puntos a adidos al BOTE, donde hay 2882441 Puntos
[21:28] Culebra\Brillante R᮫ing �ltima SEMANA: #1: CaracolSuave 52274936 #2: Paulus 12116637 #3: _Samantha_ 12018901 [21:28] Culebra\Brillante
R᮫ing �ltima SEMANA: #1: CaracolSuave 52274936 #2: Paulus 12116637 #3: _Samantha_ 12018901
[21:28] Culebra\Brillante Tri.4208 Medicina-SaludɍARdeJAVA˓EGڎqLAqLISTAqDEqFOBIASqEXISTENTES,qLAqLEUCOFOBIAqESqELqMIEDOqAqUNqCOLORq߃U�?q?q [21:28] Culebra\Brillante
Tri.4208 Medicina-SaludɍARdeJAVA˓EGڎqLAqLISTAqDEqFOBIASqEXISTENTES,qLAqLEUCOFOBIAqESqELqMIEDOqAqUNqCOLORq߃U�?q?q
[21:28] Culebra\Brillante 1 Pista: ****** Valor pregunta : 12358 Puntos [21:28] Culebra\Brillante
1 Pista: ****** Valor pregunta : 12358 Puntos
[21:28] Culebra\Brillante 2 Pista: bla*** 30 segundos y 12358 Puntos [21:28] Culebra\Brillante
2 Pista: bla*** 30 segundos y 12358 Puntos
[21:28] Culebra\Brillante 3 Pista: bla**o 15 segundos y 12358 Puntos [21:28] Culebra\Brillante
3 Pista: bla**o 15 segundos y 12358 Puntos
[21:29] Culebra\Brillante Tiempo! La respuesta es -> blanco <- [21:29] Culebra\Brillante
Tiempo! La respuesta es -> blanco <-
[21:29] Culebra\Brillante 12358 Puntos a adidos al BOTE, donde hay 2894799 Puntos [21:29] Culebra\Brillante
12358 Puntos a adidos al BOTE, donde hay 2894799 Puntos
[21:29] Culebra\Brillante Los jugadore Top10 (Semanal & Mensual) Tienen auto-Voice! [21:29] Culebra\Brillante
Los jugadore Top10 (Semanal & Mensual) Tienen auto-Voice!
[21:29] Culebra\Brillante Tri.18866 Personajesɤisney˿(Dibujos)T�lo:n"Oliverly...n?n [21:29] Culebra\Brillante
Tri.18866 Personajesɤisney˿(Dibujos)T�lo:n"Oliverly...n?n
[21:29] Culebra\Brillante 1 Pista: ** ******** Valor pregunta : 13063 Puntos [21:29] Culebra\Brillante
1 Pista: ** ******** Valor pregunta : 13063 Puntos
[21:29] Culebra\Brillante 2 Pista: su�******* 30 segundos y 13063 Puntos [21:29] Culebra\Brillante
2 Pista: su�******* 30 segundos y 13063 Puntos
[21:29] Culebra\Brillante 3 Pista: su�a**i**a 15 segundos y 13063 Puntos [21:29] Culebra\Brillante
3 Pista: su�a**i**a 15 segundos y 13063 Puntos
[21:30] Culebra\Brillante Tiempo! La respuesta es -> su�andilla <- [21:30] Culebra\Brillante
Tiempo! La respuesta es -> su�andilla <-
[21:30] Culebra\Brillante 13063 Puntos a adidos al BOTE, donde hay 2907862 Puntos [21:30] Culebra\Brillante
13063 Puntos a adidos al BOTE, donde hay 2907862 Puntos
[21:30] Culebra\Brillante Si detecta una pregunta o respuesta incorrecta, por favor, comun�elo a un OP de la sala [21:30] Culebra\Brillante
Si detecta una pregunta o respuesta incorrecta, por favor, comun�elo a un OP de la sala
[21:30] Culebra\Brillante Tri.7954 GastronomiaɊoselete˿Cualbfuehelbprimerxcafehinstantaneof?g [21:30] Culebra\Brillante
Tri.7954 GastronomiaɊoselete˿Cualbfuehelbprimerxcafehinstantaneof?g
[21:30] Culebra\Brillante 1 Pista: ** ******* Valor pregunta : 16486 Puntos [21:30] Culebra\Brillante
1 Pista: ** ******* Valor pregunta : 16486 Puntos
[21:30] CaballitoDeMar}Feliz « Tigre\Real en emisión » Radio Luna de Miel · Temática: Música variada · País: · https://www.radiolunademiel.com [21:30] CaballitoDeMar}Feliz
« Tigre\Real en emisión » Radio Luna de Miel · Temática: Música variada · País: · https://www.radiolunademiel.com
[21:30] Culebra\Brillante 2 Pista: el�****** 30 segundos y 16486 Puntos [21:30] Culebra\Brillante
2 Pista: el�****** 30 segundos y 16486 Puntos
[21:30] Culebra\Brillante 3 Pista: el�e**a*e 15 segundos y 16486 Puntos [21:30] Culebra\Brillante
3 Pista: el�e**a*e 15 segundos y 16486 Puntos
[21:31] Culebra\Brillante Tiempo! La respuesta es -> el�escafe <- [21:31] Culebra\Brillante
Tiempo! La respuesta es -> el�escafe <-
[21:31] Culebra\Brillante 16486 Puntos a adidos al BOTE, donde hay 2924348 Puntos [21:31] Culebra\Brillante
16486 Puntos a adidos al BOTE, donde hay 2924348 Puntos
[21:31] Culebra\Brillante R᮫ing SEMANA: - #1: CaracolSuave 30465230 #2: Paulus 8435839 #3: siva- 4607335 #4: LeCaTwaLk_z 2198600 #5: ChicodeGranada 244103 #6: Miriam_ 108988 #7: elagujero 108090 #8: Maryel_ 25000 #9: YasuoGr 23969 #10: Tigre_Marron 20136 [21:31] Culebra\Brillante
R᮫ing SEMANA: - #1: CaracolSuave 30465230 #2: Paulus 8435839 #3: siva- 4607335 #4: LeCaTwaLk_z 2198600 #5: ChicodeGranada 244103 #6: Miriam_ 108988 #7: elagujero 108090 #8: Maryel_ 25000 #9: YasuoGr 23969 #10: Tigre_Marron 20136
[21:31] Culebra\Brillante Tri.4772 GastronomiaɂRUJI˿CUALzESzELzPLATOzMASzTIPICOzDEzFORNELLS?z?z [21:31] Culebra\Brillante
Tri.4772 GastronomiaɂRUJI˿CUALzESzELzPLATOzMASzTIPICOzDEzFORNELLS?z?z
[21:31] Culebra\Brillante 1 Pista: ********* ** ******** Valor pregunta : 17575 Puntos [21:31] Culebra\Brillante
1 Pista: ********* ** ******** Valor pregunta : 17575 Puntos
[21:31] Culebra\Brillante 2 Pista: cal****** ** ******** 30 segundos y 17575 Puntos [21:31] Culebra\Brillante
2 Pista: cal****** ** ******** 30 segundos y 17575 Puntos
[21:31] Culebra\Brillante 3 Pista: cal*e*e*a *e *a**o**a 15 segundos y 17575 Puntos [21:31] Culebra\Brillante
3 Pista: cal*e*e*a *e *a**o**a 15 segundos y 17575 Puntos
[21:32] Culebra\Brillante Tiempo! La respuesta es -> caldereta�e�angosta <- [21:32] Culebra\Brillante
Tiempo! La respuesta es -> caldereta�e�angosta <-
[21:32] Culebra\Brillante 17575 Puntos a adidos al BOTE, donde hay 2941923 Puntos [21:32] Culebra\Brillante
17575 Puntos a adidos al BOTE, donde hay 2941923 Puntos
[21:32] Culebra\Brillante Tenemos m᳠de 70.000 preguntas y respuestas!! [21:32] Culebra\Brillante
Tenemos m᳠de 70.000 preguntas y respuestas!!
[21:32] Culebra\Brillante Tri.14500 GastronomiaɌULAA˚umokdetlavuvavantesddetfermentar.x?x [21:32] Culebra\Brillante
Tri.14500 GastronomiaɌULAA˚umokdetlavuvavantesddetfermentar.x?x
[21:32] Culebra\Brillante 1 Pista: ***** Pregunta de BONUS : 100000 Puntos [21:32] Culebra\Brillante
1 Pista: ***** Pregunta de BONUS : 100000 Puntos
[21:32] Culebra\Brillante 2 Pista: mos** 30 segundos y 100000 Puntos [21:32] Culebra\Brillante
2 Pista: mos** 30 segundos y 100000 Puntos
[21:32] CaracolSuave mosto [21:32] CaracolSuave
mosto
[21:32] Culebra\Brillante �Increible!! CaracolSuave contest󺠃04"mosto" en �1 segundos, y ha ganado �00000�12 puntos [21:32] Culebra\Brillante
�Increible!! CaracolSuave contest󺠃04"mosto" en �1 segundos, y ha ganado �00000�12 puntos
[21:32] Culebra\Brillante CaracolSuave has acertado 8 seguidas!! Puntos HOY: 7896984, SEMANA: 30565230 y MES: 64760059 [21:32] Culebra\Brillante
CaracolSuave has acertado 8 seguidas!! Puntos HOY: 7896984, SEMANA: 30565230 y MES: 64760059
[21:32] Culebra\Brillante Tri.1406 Literaturaɴjmm.com˿Lazalcahuetazm᳃13dfamosazdeonuestrazliteratura.t?t [21:32] Culebra\Brillante
Tri.1406 Literaturaɴjmm.com˿Lazalcahuetazm᳃13dfamosazdeonuestrazliteratura.t?t
[21:32] Culebra\Brillante 1 Pista: ** ********* Valor pregunta : 12266 Puntos [21:32] Culebra\Brillante
1 Pista: ** ********* Valor pregunta : 12266 Puntos
[21:32] Culebra\Brillante 2 Pista: La�******** 30 segundos y 12266 Puntos [21:32] Culebra\Brillante
2 Pista: La�******** 30 segundos y 12266 Puntos
[21:33] Culebra\Brillante 3 Pista: La�e*e**i*a 15 segundos y 12266 Puntos [21:33] Culebra\Brillante
3 Pista: La�e*e**i*a 15 segundos y 12266 Puntos
[21:33] Culebra\Brillante Tiempo! La respuesta es -> La�elestina <- [21:33] Culebra\Brillante
Tiempo! La respuesta es -> La�elestina <-
[21:33] Culebra\Brillante 12266 Puntos a adidos al BOTE, donde hay 2954189 Puntos [21:33] Culebra\Brillante
12266 Puntos a adidos al BOTE, donde hay 2954189 Puntos
[21:33] Culebra\Brillante Atenci󮠡 las preguntas MEGA BONUS de 500.000 y 1.000.000 de puntos [21:33] Culebra\Brillante
Atenci󮠡 las preguntas MEGA BONUS de 500.000 y 1.000.000 de puntos
[21:33] Culebra\Brillante Tri.2536 Geografiaɓebosin˿Enfqu郱3yprovincianestჱ3yelacabondeblanNao?y?y [21:33] Culebra\Brillante
Tri.2536 Geografiaɓebosin˿Enfqu郱3yprovincianestჱ3yelacabondeblanNao?y?y
[21:33] Culebra\Brillante 1 Pista: ******** Valor pregunta : 6887 Puntos [21:33] Culebra\Brillante
1 Pista: ******** Valor pregunta : 6887 Puntos
[21:33] Culebra\Brillante 2 Pista: ali***** 30 segundos y 6887 Puntos [21:33] Culebra\Brillante
2 Pista: ali***** 30 segundos y 6887 Puntos
[21:34] Culebra\Brillante 3 Pista: ali*a**e 15 segundos y 6887 Puntos [21:34] Culebra\Brillante
3 Pista: ali*a**e 15 segundos y 6887 Puntos
[21:34] Culebra\Brillante Tiempo! La respuesta es -> alicante <- [21:34] Culebra\Brillante
Tiempo! La respuesta es -> alicante <-
[21:34] Culebra\Brillante 6887 Puntos a adidos al BOTE, donde hay 2961076 Puntos [21:34] Culebra\Brillante
6887 Puntos a adidos al BOTE, donde hay 2961076 Puntos
[21:34] Culebra\Brillante Recuerda que est Trivia e GRATIS, por favor, no se queje [21:34] Culebra\Brillante
Recuerda que est Trivia e GRATIS, por favor, no se queje
[21:34] Culebra\Brillante Tri.11627 LiteraturaɃHESARE˿AUTORnDEnAUTOBIOGRAFIAnDEnFEDERICOnSANCHEZ...n?n [21:34] Culebra\Brillante
Tri.11627 LiteraturaɃHESARE˿AUTORnDEnAUTOBIOGRAFIAnDEnFEDERICOnSANCHEZ...n?n
[21:34] Culebra\Brillante 1 Pista: ***** ******* Pregunta de BONUS : 100000 Puntos [21:34] Culebra\Brillante
1 Pista: ***** ******* Pregunta de BONUS : 100000 Puntos
[21:34] Culebra\Brillante 2 Pista: jor** ******* 30 segundos y 100000 Puntos [21:34] Culebra\Brillante
2 Pista: jor** ******* 30 segundos y 100000 Puntos
[21:35] Culebra\Brillante 3 Pista: jor*e *e***u* 15 segundos y 100000 Puntos [21:35] Culebra\Brillante
3 Pista: jor*e *e***u* 15 segundos y 100000 Puntos
[21:35] Culebra\Brillante Tiempo! La respuesta es -> jorge�emprun <- [21:35] Culebra\Brillante
Tiempo! La respuesta es -> jorge�emprun <-
[21:35] Culebra\Brillante 100000 Puntos a adidos al BOTE, donde hay 3061076 Puntos [21:35] Culebra\Brillante
100000 Puntos a adidos al BOTE, donde hay 3061076 Puntos
[21:35] CaracolSuave jorge semprum [21:35] CaracolSuave
jorge semprum
[21:35] Culebra\Brillante Tri.12728 Cancionesɴjmm.com˿Elpprimerk鸩tofdefThefCranberries,fallჱ3fpork1.994,f(unadcanci󮃱3qfabulosa,fporkcierto)ffue....f?f [21:35] Culebra\Brillante
Tri.12728 Cancionesɴjmm.com˿Elpprimerk鸩tofdefThefCranberries,fallჱ3fpork1.994,f(unadcanci󮃱3qfabulosa,fporkcierto)ffue....f?f
[21:35] Culebra\Brillante 1 Pista: ****** Valor pregunta : 8267 Puntos [21:35] Culebra\Brillante
1 Pista: ****** Valor pregunta : 8267 Puntos
[21:35] Culebra\Brillante 2 Pista: lin*** 30 segundos y 8267 Puntos [21:35] Culebra\Brillante
2 Pista: lin*** 30 segundos y 8267 Puntos
[21:35] Culebra\Brillante 3 Pista: lin*e* 15 segundos y 8267 Puntos [21:35] Culebra\Brillante
3 Pista: lin*e* 15 segundos y 8267 Puntos
[21:36] Tigre\Real CaracolSuave BeSiToS CATALANES !!!!MmMuUuAaAcCcKkKsSs!!! ;@~;@~;@~;@~ ;@~;@~;@~;@~;@~;@~;@~;@~;@~;@~;@~;@~ [21:36] Tigre\Real
CaracolSuave BeSiToS CATALANES !!!!MmMuUuAaAcCcKkKsSs!!! ;@~;@~;@~;@~ ;@~;@~;@~;@~;@~;@~;@~;@~;@~;@~;@~;@~
[21:36] Culebra\Brillante Tiempo! La respuesta es -> linger <- [21:36] Culebra\Brillante
Tiempo! La respuesta es -> linger <-
[21:36] Culebra\Brillante 8267 Puntos a adidos al BOTE, donde hay 3069343 Puntos [21:36] Culebra\Brillante
8267 Puntos a adidos al BOTE, donde hay 3069343 Puntos
[21:36] Tigre\Real .radio [21:36] Tigre\Real
.radio
[21:36] CaballitoDeMar}Feliz « Radio Luna de Miel » DJ: Tigre\Real · Tema: Música variada · Peticiones: Cerradas · Canción: - cuña para damero [21:36] CaballitoDeMar}Feliz
« Radio Luna de Miel » DJ: Tigre\Real · Tema: Música variada · Peticiones: Cerradas · Canción: - cuña para damero
[21:36] Culebra\Brillante Si desea agregar preguntas & respuestas a la BASE DE DATOS, por favor, comun�elo a un OP de la sala [21:36] Culebra\Brillante
Si desea agregar preguntas & respuestas a la BASE DE DATOS, por favor, comun�elo a un OP de la sala
[21:36] Culebra\Brillante Tri.17613 MusicaɃort˿Eniqu郱3mgrupoetocaxlaxguitarraxKeithaRichardsy?m [21:36] Culebra\Brillante
Tri.17613 MusicaɃort˿Eniqu郱3mgrupoetocaxlaxguitarraxKeithaRichardsy?m
[21:36] Culebra\Brillante 1 Pista: ******* ****** Valor pregunta : 13984 Puntos [21:36] Culebra\Brillante
1 Pista: ******* ****** Valor pregunta : 13984 Puntos
[21:36] Culebra\Brillante 2 Pista: rol**** ****** 30 segundos y 13984 Puntos [21:36] Culebra\Brillante
2 Pista: rol**** ****** 30 segundos y 13984 Puntos
[21:36] CaracolSuave [Tigre\Real] holaaaa Muacksssssssssssssssssssssssssssssssssssssssssssssssssss [21:36] CaracolSuave
[Tigre\Real] holaaaa Muacksssssssssssssssssssssssssssssssssssssssssssssssssss
[21:36] Culebra\Brillante 3 Pista: rol*i** **o*e* 15 segundos y 13984 Puntos [21:36] Culebra\Brillante
3 Pista: rol*i** **o*e* 15 segundos y 13984 Puntos
[21:37] Culebra\Brillante Tiempo! La respuesta es -> rolling�tones <- [21:37] Culebra\Brillante
Tiempo! La respuesta es -> rolling�tones <-
[21:37] Culebra\Brillante 13984 Puntos a adidos al BOTE, donde hay 3083327 Puntos [21:37] Culebra\Brillante
13984 Puntos a adidos al BOTE, donde hay 3083327 Puntos
[21:37] Culebra\Brillante R᮫ing por D́: - Domingo: Paulus 8435839 Lunes: CaracolSuave 6563878 Martes: CaracolSuave 8576491 Miercoles: CaracolSuave 7893517 Jueves: CaracolSuave 5997199 Viernes: CaracolSuave 3467306 Sᢡdo: Paulus 7947521 [21:37] Culebra\Brillante
R᮫ing por D́: - Domingo: Paulus 8435839 Lunes: CaracolSuave 6563878 Martes: CaracolSuave 8576491 Miercoles: CaracolSuave 7893517 Jueves: CaracolSuave 5997199 Viernes: CaracolSuave 3467306 Sᢡdo: Paulus 7947521
[21:37] Culebra\Brillante Tri.2546 CienciaɆilipides˿1834:eߑuewhizorWerneroSiemenslpararobtenerolarformaci󮃱3lcient�carquewdeseabar?e [21:37] Culebra\Brillante
Tri.2546 CienciaɆilipides˿1834:eߑuewhizorWerneroSiemenslpararobtenerolarformaci󮃱3lcient�carquewdeseabar?e
[21:37] Culebra\Brillante 1 Pista: ********* **** ******* *** ******** Pregunta de BONUS : 25000 Puntos [21:37] Culebra\Brillante
1 Pista: ********* **** ******* *** ******** Pregunta de BONUS : 25000 Puntos
[21:37] Culebra\Brillante 2 Pista: ali****** **** ******* *** ******** 30 segundos y 25000 Puntos [21:37] Culebra\Brillante
2 Pista: ali****** **** ******* *** ******** 30 segundos y 25000 Puntos
[21:37] Culebra\Brillante 3 Pista: ali**a**e *o*o o*i*ia* *e* e*e**i*o 15 segundos y 25000 Puntos [21:37] Culebra\Brillante
3 Pista: ali**a**e *o*o o*i*ia* *e* e*e**i*o 15 segundos y 25000 Puntos
[21:38] Culebra\Brillante Tiempo! La respuesta es -> alistarse�omo�ficial�el�jercito <- [21:38] Culebra\Brillante
Tiempo! La respuesta es -> alistarse�omo�ficial�el�jercito <-
[21:38] Culebra\Brillante 25000 Puntos a adidos al BOTE, donde hay 3108327 Puntos [21:38] Culebra\Brillante
25000 Puntos a adidos al BOTE, donde hay 3108327 Puntos
[21:38] Culebra\Brillante Para conocer los jugadores con mayores puntuaciones escriba... !top10 [21:38] Culebra\Brillante
Para conocer los jugadores con mayores puntuaciones escriba... !top10
[21:38] Culebra\Brillante Tri.1859 Informaticaɐax˿AgcuantoxpuedewreducirsewaparentementewlaglatenciagdewlagmemoriagconyIA-64g?g [21:38] Culebra\Brillante
Tri.1859 Informaticaɐax˿AgcuantoxpuedewreducirsewaparentementewlaglatenciagdewlagmemoriagconyIA-64g?g
[21:38] Culebra\Brillante 1 Pista: * **** Valor pregunta : 12272 Puntos [21:38] Culebra\Brillante
1 Pista: * **** Valor pregunta : 12272 Puntos
[21:38] Culebra\Brillante 2 Pista: a�*** 30 segundos y 12272 Puntos [21:38] Culebra\Brillante
2 Pista: a�*** 30 segundos y 12272 Puntos
[21:38] Culebra\Brillante 3 Pista: a�e*o 15 segundos y 12272 Puntos [21:38] Culebra\Brillante
3 Pista: a�e*o 15 segundos y 12272 Puntos
[21:38] Culebra\Brillante Tiempo! La respuesta es -> a�ero <- [21:38] Culebra\Brillante
Tiempo! La respuesta es -> a�ero <-
[21:38] Culebra\Brillante 12272 Puntos a adidos al BOTE, donde hay 3120599 Puntos [21:38] Culebra\Brillante
12272 Puntos a adidos al BOTE, donde hay 3120599 Puntos
[21:39] Culebra\Brillante Tri.5306 Biologiaɳherif˿Cuᬃ13hesjelhnombreevulgarjdelhEquusjquagga?o?o [21:39] Culebra\Brillante
Tri.5306 Biologiaɳherif˿Cuᬃ13hesjelhnombreevulgarjdelhEquusjquagga?o?o
[21:39] Culebra\Brillante 1 Pista: ***** Valor pregunta : 10494 Puntos [21:39] Culebra\Brillante
1 Pista: ***** Valor pregunta : 10494 Puntos
[21:39] Culebra\Brillante 2 Pista: ceb** 30 segundos y 10494 Puntos [21:39] Culebra\Brillante
2 Pista: ceb** 30 segundos y 10494 Puntos
[21:39] CaracolSuave cebra [21:39] CaracolSuave
cebra
[21:39] Culebra\Brillante �Eso es CaracolSuave!! Dijiste: "cebra" y ello te ha valido: �0494�12 puntos [21:39] Culebra\Brillante
�Eso es CaracolSuave!! Dijiste: "cebra" y ello te ha valido: �0494�12 puntos
[21:39] Culebra\Brillante CaracolSuave has acertado 9 seguidas!! Puntos HOY: 7907478, SEMANA: 30575724 y MES: 64770553 [21:39] Culebra\Brillante
CaracolSuave has acertado 9 seguidas!! Puntos HOY: 7907478, SEMANA: 30575724 y MES: 64770553
[21:39] Culebra\Brillante Atenci󮠡 las preguntas BONUS de 25.000 y 100.000 puntos!!! [21:39] Culebra\Brillante
Atenci󮠡 las preguntas BONUS de 25.000 y 100.000 puntos!!!
[21:39] Culebra\Brillante Tri.7853 CineɉRC-Domain.org˿EngquekpeliculagAlexxAngulozhaciagdekcatedraticozdekteologiagporplagUniversidadpdekDeustoz?x [21:39] Culebra\Brillante
Tri.7853 CineɉRC-Domain.org˿EngquekpeliculagAlexxAngulozhaciagdekcatedraticozdekteologiagporplagUniversidadpdekDeustoz?x
[21:39] Culebra\Brillante 1 Pista: ** *** ** ** ****** Valor pregunta : 12004 Puntos [21:39] Culebra\Brillante
1 Pista: ** *** ** ** ****** Valor pregunta : 12004 Puntos
[21:39] Culebra\Brillante 2 Pista: el�** ** ** ****** 30 segundos y 12004 Puntos [21:39] Culebra\Brillante
2 Pista: el�** ** ** ****** 30 segundos y 12004 Puntos
[21:40] Culebra\Brillante 3 Pista: el�ia *e *a *e**ia 15 segundos y 12004 Puntos [21:40] Culebra\Brillante
3 Pista: el�ia *e *a *e**ia 15 segundos y 12004 Puntos
[21:40] CaracolSuave el dia de la bestia [21:40] CaracolSuave
el dia de la bestia
[21:40] Culebra\Brillante �emuestra lo que sabes CaracolSuave! Has respondido "el dia de la bestia" correctamente y eso te da: �2004�12 puntos [21:40] Culebra\Brillante
�emuestra lo que sabes CaracolSuave! Has respondido "el dia de la bestia" correctamente y eso te da: �2004�12 puntos
[21:40] Culebra\Brillante CaracolSuave has acertado 10 seguidas!! Puntos HOY: 7919482, SEMANA: 30587728 y MES: 64782557 [21:40] Culebra\Brillante
CaracolSuave has acertado 10 seguidas!! Puntos HOY: 7919482, SEMANA: 30587728 y MES: 64782557
[21:40] Culebra\Brillante Bonus especial de 50000 Puntos para CaracolSuave por acertar 10 seguidas!!! [21:40] Culebra\Brillante
Bonus especial de 50000 Puntos para CaracolSuave por acertar 10 seguidas!!!
[21:40] Culebra\Brillante Tri.388 Literaturaɣarlovigo˿Enzqueea񯃱3vmuriovAgathatChristie?y?y [21:40] Culebra\Brillante
Tri.388 Literaturaɣarlovigo˿Enzqueea񯃱3vmuriovAgathatChristie?y?y
[21:40] Culebra\Brillante 1 Pista: **** Valor pregunta : 13273 Puntos [21:40] Culebra\Brillante
1 Pista: **** Valor pregunta : 13273 Puntos
[21:40] Culebra\Brillante 2 Pista: 197* 30 segundos y 13273 Puntos [21:40] Culebra\Brillante
2 Pista: 197* 30 segundos y 13273 Puntos
[21:40] CaracolSuave 1970 [21:40] CaracolSuave
1970
[21:40] CaracolSuave 1979 [21:40] CaracolSuave
1979
[21:40] Culebra\Brillante 3 Pista: 197* 15 segundos y 13273 Puntos [21:40] Culebra\Brillante
3 Pista: 197* 15 segundos y 13273 Puntos
[21:41] Culebra\Brillante Tiempo! La respuesta es -> 1976 <- [21:41] Culebra\Brillante
Tiempo! La respuesta es -> 1976 <-
[21:41] Culebra\Brillante 13273 Puntos a adidos al BOTE, donde hay 3133872 Puntos [21:41] Culebra\Brillante
13273 Puntos a adidos al BOTE, donde hay 3133872 Puntos
[21:41] Culebra\Brillante Por favor, se agradece la correcci󮠥n su lenguaje [21:41] Culebra\Brillante
Por favor, se agradece la correcci󮠥n su lenguaje
[21:41] Culebra\Brillante Tri.6169 InformaticaɌucky_LuK˿COMOzSEzDENOMINAzALzVALORzQUEzNOzSEzLEzPUEDEzALTERARzSUSzDATOSzDURANTEzLAzEJECUCIONzDEzUNzPROGRAMAz?z [21:41] Culebra\Brillante
Tri.6169 InformaticaɌucky_LuK˿COMOzSEzDENOMINAzALzVALORzQUEzNOzSEzLEzPUEDEzALTERARzSUSzDATOSzDURANTEzLAzEJECUCIONzDEzUNzPROGRAMAz?z
[21:41] Culebra\Brillante 1 Pista: ********* Valor pregunta : 24773 Puntos [21:41] Culebra\Brillante
1 Pista: ********* Valor pregunta : 24773 Puntos
[21:41] Culebra\Brillante 2 Pista: con****** 30 segundos y 24773 Puntos [21:41] Culebra\Brillante
2 Pista: con****** 30 segundos y 24773 Puntos
[21:41] Culebra\Brillante 3 Pista: con**a**e 15 segundos y 24773 Puntos [21:41] Culebra\Brillante
3 Pista: con**a**e 15 segundos y 24773 Puntos
[21:42] Culebra\Brillante Tiempo! La respuesta es -> constante <- [21:42] Culebra\Brillante
Tiempo! La respuesta es -> constante <-
[21:42] Culebra\Brillante 24773 Puntos a adidos al BOTE, donde hay 3158645 Puntos [21:42] Culebra\Brillante
24773 Puntos a adidos al BOTE, donde hay 3158645 Puntos
[21:42] Culebra\Brillante This is #Mexico, I am your host Culebra\Brillante, running Culebra\Brillante [21:42] Culebra\Brillante
This is #Mexico, I am your host Culebra\Brillante, running Culebra\Brillante
[21:42] Culebra\Brillante Tri.6793 Medicina-Saludɱuicksand˿CUALuESuLAuPOSTURAuADECUADAuENuLAuQUEuSEuDEBEuPONERuAuUNAuPERSONAuINCONSCIENTEu?u [21:42] Culebra\Brillante
Tri.6793 Medicina-Saludɱuicksand˿CUALuESuLAuPOSTURAuADECUADAuENuLAuQUEuSEuDEBEuPONERuAuUNAuPERSONAuINCONSCIENTEu?u
[21:42] Culebra\Brillante 1 Pista: ** **** Pregunta de BONUS : 25000 Puntos [21:42] Culebra\Brillante
1 Pista: ** **** Pregunta de BONUS : 25000 Puntos
[21:42] Culebra\Brillante 2 Pista: de�*** 30 segundos y 25000 Puntos [21:42] Culebra\Brillante
2 Pista: de�*** 30 segundos y 25000 Puntos
[21:42] Culebra\Brillante 3 Pista: de�a*o 15 segundos y 25000 Puntos [21:42] Culebra\Brillante
3 Pista: de�a*o 15 segundos y 25000 Puntos
[21:43] Culebra\Brillante Tiempo! La respuesta es -> de�ado <- [21:43] Culebra\Brillante
Tiempo! La respuesta es -> de�ado <-
[21:43] Culebra\Brillante 25000 Puntos a adidos al BOTE, donde hay 3183645 Puntos [21:43] Culebra\Brillante
25000 Puntos a adidos al BOTE, donde hay 3183645 Puntos
[21:43] Culebra\Brillante This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [21:43] Culebra\Brillante
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[21:43] Culebra\Brillante Tri.7632 Fisica-Quimicaɖivian˿Fenomenodporoelpquekunfl�idodpasakakestadodgaseosod?v [21:43] Culebra\Brillante
Tri.7632 Fisica-Quimicaɖivian˿Fenomenodporoelpquekunfl�idodpasakakestadodgaseosod?v
[21:43] Culebra\Brillante 1 Pista: ********** Valor pregunta : 21062 Puntos [21:43] Culebra\Brillante
1 Pista: ********** Valor pregunta : 21062 Puntos
[21:43] Culebra\Brillante 2 Pista: ebu******* 30 segundos y 21062 Puntos [21:43] Culebra\Brillante
2 Pista: ebu******* 30 segundos y 21062 Puntos
[21:43] Culebra\Brillante 3 Pista: ebu**i*io* 15 segundos y 21062 Puntos [21:43] Culebra\Brillante
3 Pista: ebu**i*io* 15 segundos y 21062 Puntos
[21:44] Culebra\Brillante Tiempo! La respuesta es -> ebullicion <- [21:44] Culebra\Brillante
Tiempo! La respuesta es -> ebullicion <-
[21:44] Culebra\Brillante 21062 Puntos a adidos al BOTE, donde hay 3204707 Puntos [21:44] Culebra\Brillante
21062 Puntos a adidos al BOTE, donde hay 3204707 Puntos
[21:44] Culebra\Brillante Recuerda que est Trivia e GRATIS, por favor, no se queje [21:44] Culebra\Brillante
Recuerda que est Trivia e GRATIS, por favor, no se queje
[21:44] Culebra\Brillante Tri.18618 Cancionesɉsis^˿Dehquehgrupoyesplamcancionh"WastedcTime"s?s [21:44] Culebra\Brillante
Tri.18618 Cancionesɉsis^˿Dehquehgrupoyesplamcancionh"WastedcTime"s?s
[21:44] Culebra\Brillante 1 Pista: **** *** Valor pregunta : 15198 Puntos [21:44] Culebra\Brillante
1 Pista: **** *** Valor pregunta : 15198 Puntos
[21:44] Culebra\Brillante 2 Pista: ski* *** 30 segundos y 15198 Puntos [21:44] Culebra\Brillante
2 Pista: ski* *** 30 segundos y 15198 Puntos
[21:44] Culebra\Brillante 3 Pista: ski* *o* 15 segundos y 15198 Puntos [21:44] Culebra\Brillante
3 Pista: ski* *o* 15 segundos y 15198 Puntos
[21:44] Culebra\Brillante Tiempo! La respuesta es -> skid�ow <- [21:44] Culebra\Brillante
Tiempo! La respuesta es -> skid�ow <-
[21:44] Culebra\Brillante 15198 Puntos a adidos al BOTE, donde hay 3219905 Puntos [21:44] Culebra\Brillante
15198 Puntos a adidos al BOTE, donde hay 3219905 Puntos
[21:45] Culebra\Brillante This MONTHS Top 11-20: - #11: ChicodeGranada 738439 #12: Guiarte_Yo 619557 #13: BLaNKoN_PeR4eVeR 200000 #14: fff 173570 #15: Miriam_ 156310 #16: Cosmo 149640 #17: DanielPerez_ 116023 #18: elagujero 108090 #19: Alii 82683 #20: HeaLth_Rider 80860 [21:45] Culebra\Brillante
This MONTHS Top 11-20: - #11: ChicodeGranada 738439 #12: Guiarte_Yo 619557 #13: BLaNKoN_PeR4eVeR 200000 #14: fff 173570 #15: Miriam_ 156310 #16: Cosmo 149640 #17: DanielPerez_ 116023 #18: elagujero 108090 #19: Alii 82683 #20: HeaLth_Rider 80860
[21:45] Culebra\Brillante Tri.1922 CancionesɃocoman˿"�ammaumia!"iߤegquieneesiesto"i?i [21:45] Culebra\Brillante
Tri.1922 CancionesɃocoman˿"�ammaumia!"iߤegquieneesiesto"i?i
[21:45] Culebra\Brillante 1 Pista: **** Valor pregunta : 18716 Puntos [21:45] Culebra\Brillante
1 Pista: **** Valor pregunta : 18716 Puntos
[21:45] Culebra\Brillante 2 Pista: abb* 30 segundos y 18716 Puntos [21:45] Culebra\Brillante
2 Pista: abb* 30 segundos y 18716 Puntos
[21:45] CaballitoDeMar}Feliz ¦ Emitiendo ( Tigre\Real ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [21:45] CaballitoDeMar}Feliz
¦ Emitiendo ( Tigre\Real ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[21:45] Culebra\Brillante 3 Pista: abba 15 segundos y 18716 Puntos [21:45] Culebra\Brillante
3 Pista: abba 15 segundos y 18716 Puntos
[21:45] Culebra\Brillante Tiempo! La respuesta es -> abba <- [21:45] Culebra\Brillante
Tiempo! La respuesta es -> abba <-
[21:45] Culebra\Brillante 18716 Puntos a adidos al BOTE, donde hay 3238621 Puntos [21:45] Culebra\Brillante
18716 Puntos a adidos al BOTE, donde hay 3238621 Puntos
[21:46] Culebra\Brillante R᮫ing �ltima SEMANA: #1: CaracolSuave 52274936 #2: Paulus 12116637 #3: _Samantha_ 12018901 [21:46] Culebra\Brillante
R᮫ing �ltima SEMANA: #1: CaracolSuave 52274936 #2: Paulus 12116637 #3: _Samantha_ 12018901
[21:46] Culebra\Brillante Tri.14776 Cancionesɖonk˿Dewquienqesacartananfilippod?e [21:46] Culebra\Brillante
Tri.14776 Cancionesɖonk˿Dewquienqesacartananfilippod?e
[21:46] Culebra\Brillante 1 Pista: ***** * ** ***** *** **** Valor pregunta : 22158 Puntos [21:46] Culebra\Brillante
1 Pista: ***** * ** ***** *** **** Valor pregunta : 22158 Puntos
[21:46] Culebra\Brillante 2 Pista: nel** * ** ***** *** **** 30 segundos y 22158 Puntos [21:46] Culebra\Brillante
2 Pista: nel** * ** ***** *** **** 30 segundos y 22158 Puntos
[21:46] Culebra\Brillante 3 Pista: nel*o * *a *a**a *e* *o*o 15 segundos y 22158 Puntos [21:46] Culebra\Brillante
3 Pista: nel*o * *a *a**a *e* *o*o 15 segundos y 22158 Puntos
[21:46] Culebra\Brillante Tiempo! La respuesta es -> nello��a�anda�el�oco <- [21:46] Culebra\Brillante
Tiempo! La respuesta es -> nello��a�anda�el�oco <-
[21:46] Culebra\Brillante 22158 Puntos a adidos al BOTE, donde hay 3260779 Puntos [21:46] Culebra\Brillante
22158 Puntos a adidos al BOTE, donde hay 3260779 Puntos
[21:46] Culebra\Brillante Los jugadore Top10 (Semanal & Mensual) Tienen auto-Voice! [21:46] Culebra\Brillante
Los jugadore Top10 (Semanal & Mensual) Tienen auto-Voice!
[21:46] Culebra\Brillante Tri.10377 Musicaɨelvetis˿Discoeenvelmqueiseiincluyenv"intergalactic"fyl"bodylmoving"fentreiotrosotemas"f?f [21:46] Culebra\Brillante
Tri.10377 Musicaɨelvetis˿Discoeenvelmqueiseiincluyenv"intergalactic"fyl"bodylmoving"fentreiotrosotemas"f?f
[21:46] Culebra\Brillante 1 Pista: ***** ***** Valor pregunta : 9475 Puntos [21:46] Culebra\Brillante
1 Pista: ***** ***** Valor pregunta : 9475 Puntos
[21:47] Culebra\Brillante 2 Pista: hel** ***** 30 segundos y 9475 Puntos [21:47] Culebra\Brillante
2 Pista: hel** ***** 30 segundos y 9475 Puntos
[21:47] Culebra\Brillante 3 Pista: hel*o *a*** 15 segundos y 9475 Puntos [21:47] Culebra\Brillante
3 Pista: hel*o *a*** 15 segundos y 9475 Puntos
[21:47] Culebra\Brillante Tiempo! La respuesta es -> hello�asty <- [21:47] Culebra\Brillante
Tiempo! La respuesta es -> hello�asty <-
[21:47] Culebra\Brillante 9475 Puntos a adidos al BOTE, donde hay 3270254 Puntos [21:47] Culebra\Brillante
9475 Puntos a adidos al BOTE, donde hay 3270254 Puntos
[21:47] Culebra\Brillante Si detecta una pregunta o respuesta incorrecta, por favor, comun�elo a un OP de la sala [21:47] Culebra\Brillante
Si detecta una pregunta o respuesta incorrecta, por favor, comun�elo a un OP de la sala
[21:47] Culebra\Brillante Tri.1506 Informaticaɐax˿Comorsewllamawunawtarjetawconzsalidastparawpuertorserie,pparalelorymjoysticko?p [21:47] Culebra\Brillante
Tri.1506 Informaticaɐax˿Comorsewllamawunawtarjetawconzsalidastparawpuertorserie,pparalelorymjoysticko?p
[21:47] Culebra\Brillante 1 Pista: ***** ** Valor pregunta : 6252 Puntos [21:47] Culebra\Brillante
1 Pista: ***** ** Valor pregunta : 6252 Puntos
[21:48] Culebra\Brillante 2 Pista: Mul** ** 30 segundos y 6252 Puntos [21:48] Culebra\Brillante
2 Pista: Mul** ** 30 segundos y 6252 Puntos
[21:48] Culebra\Brillante 3 Pista: Mul*i IO 15 segundos y 6252 Puntos [21:48] Culebra\Brillante
3 Pista: Mul*i IO 15 segundos y 6252 Puntos
[21:48] Culebra\Brillante Tiempo! La respuesta es -> Multi�O <- [21:48] Culebra\Brillante
Tiempo! La respuesta es -> Multi�O <-
[21:48] Culebra\Brillante 6252 Puntos a adidos al BOTE, donde hay 3276506 Puntos [21:48] Culebra\Brillante
6252 Puntos a adidos al BOTE, donde hay 3276506 Puntos
[21:48] Culebra\Brillante R᮫ing SEMANA: - #1: CaracolSuave 30637728 #2: Paulus 8435839 #3: siva- 4607335 #4: LeCaTwaLk_z 2198600 #5: ChicodeGranada 244103 #6: Miriam_ 108988 #7: elagujero 108090 #8: Maryel_ 25000 #9: YasuoGr 23969 #10: Tigre_Marron 20136 [21:48] Culebra\Brillante
R᮫ing SEMANA: - #1: CaracolSuave 30637728 #2: Paulus 8435839 #3: siva- 4607335 #4: LeCaTwaLk_z 2198600 #5: ChicodeGranada 244103 #6: Miriam_ 108988 #7: elagujero 108090 #8: Maryel_ 25000 #9: YasuoGr 23969 #10: Tigre_Marron 20136
[21:48] Culebra\Brillante Tri.917 HistoriaɊAVEA˿04/11/1974:jCONjQUEjOTRAjCIUDADjQUEDAjINAGURADOjOFICIALMENTEjUNjPUENTEjAREOjDESDEjMADRIDj?j [21:48] Culebra\Brillante
Tri.917 HistoriaɊAVEA˿04/11/1974:jCONjQUEjOTRAjCIUDADjQUEDAjINAGURADOjOFICIALMENTEjUNjPUENTEjAREOjDESDEjMADRIDj?j
[21:48] Culebra\Brillante 1 Pista: ********* Valor pregunta : 23386 Puntos [21:48] Culebra\Brillante
1 Pista: ********* Valor pregunta : 23386 Puntos
[21:49] Culebra\Brillante 2 Pista: BAR****** 30 segundos y 23386 Puntos [21:49] Culebra\Brillante
2 Pista: BAR****** 30 segundos y 23386 Puntos
[21:49] CaracolSuave barcelona [21:49] CaracolSuave
barcelona
[21:49] Culebra\Brillante �Muy bien CaracolSuave!! Acertaste "barcelona" en tan s󬯠�0.938 segundos y por eso has ganado: �3386�12 puntos [21:49] Culebra\Brillante
�Muy bien CaracolSuave!! Acertaste "barcelona" en tan s󬯠�0.938 segundos y por eso has ganado: �3386�12 puntos
[21:49] Culebra\Brillante CaracolSuave has acertado 11 seguidas!! Puntos HOY: 7992868, SEMANA: 30661114 y MES: 64855943 [21:49] Culebra\Brillante
CaracolSuave has acertado 11 seguidas!! Puntos HOY: 7992868, SEMANA: 30661114 y MES: 64855943
[21:49] Culebra\Brillante Tenemos m᳠de 70.000 preguntas y respuestas!! [21:49] Culebra\Brillante
Tenemos m᳠de 70.000 preguntas y respuestas!!
[21:49] Culebra\Brillante Tri.14692 Geografiaɳubmarin˿Cuᬃ13xeswlazcapitalxdeuTennessee?l?l [21:49] Culebra\Brillante
Tri.14692 Geografiaɳubmarin˿Cuᬃ13xeswlazcapitalxdeuTennessee?l?l
[21:49] Culebra\Brillante 1 Pista: ********* Valor pregunta : 7630 Puntos [21:49] Culebra\Brillante
1 Pista: ********* Valor pregunta : 7630 Puntos
[21:49] Tigre\Real CaracolSuave ***Asiasssss***Asiasssss*** :)))))) [21:49] Tigre\Real
CaracolSuave ***Asiasssss***Asiasssss*** :))))))
[21:49] CaracolSuave :))))) [21:49] CaracolSuave
:)))))
[21:49] Culebra\Brillante 2 Pista: nas****** 30 segundos y 7630 Puntos [21:49] Culebra\Brillante
2 Pista: nas****** 30 segundos y 7630 Puntos
[21:49] Tigre\Real (:)) [21:49] Tigre\Real
(:))
[21:49] Culebra\Brillante 3 Pista: nas**i**e 15 segundos y 7630 Puntos [21:49] Culebra\Brillante
3 Pista: nas**i**e 15 segundos y 7630 Puntos
[21:50] Culebra\Brillante Tiempo! La respuesta es -> nashville <- [21:50] Culebra\Brillante
Tiempo! La respuesta es -> nashville <-
[21:50] Culebra\Brillante 7630 Puntos a adidos al BOTE, donde hay 3284136 Puntos [21:50] Culebra\Brillante
7630 Puntos a adidos al BOTE, donde hay 3284136 Puntos
[21:50] Tigre\Real bravoooooooooooooooo bravooooooooooooooo bravoooooooooooooo bravoooooooooooo bravooooooooooooooo bravoooooooooooo [21:50] Tigre\Real
bravoooooooooooooooo bravooooooooooooooo bravoooooooooooooo bravoooooooooooo bravooooooooooooooo bravoooooooooooo
[21:50] Culebra\Brillante Tri.6564 Arteɔruchi˿Awqueicorrienteiperteneceielbcuadrof"Lasmse񯲩tasmdeiAvignon"w?w [21:50] Culebra\Brillante
Tri.6564 Arteɔruchi˿Awqueicorrienteiperteneceielbcuadrof"Lasmse񯲩tasmdeiAvignon"w?w
[21:50] Culebra\Brillante 1 Pista: ******* Valor pregunta : 5405 Puntos [21:50] Culebra\Brillante
1 Pista: ******* Valor pregunta : 5405 Puntos
[21:50] Culebra\Brillante 2 Pista: cub**** 30 segundos y 5405 Puntos [21:50] Culebra\Brillante
2 Pista: cub**** 30 segundos y 5405 Puntos
[21:50] Culebra\Brillante 3 Pista: cubi**o 15 segundos y 5405 Puntos [21:50] Culebra\Brillante
3 Pista: cubi**o 15 segundos y 5405 Puntos
[21:50] Culebra\Brillante Tiempo! La respuesta es -> cubismo <- [21:50] Culebra\Brillante
Tiempo! La respuesta es -> cubismo <-
[21:50] Culebra\Brillante 5405 Puntos a adidos al BOTE, donde hay 3289541 Puntos [21:50] Culebra\Brillante
5405 Puntos a adidos al BOTE, donde hay 3289541 Puntos
[21:51] Culebra\Brillante Atenci󮠡 las preguntas MEGA BONUS de 500.000 y 1.000.000 de puntos [21:51] Culebra\Brillante
Atenci󮠡 las preguntas MEGA BONUS de 500.000 y 1.000.000 de puntos
[21:51] Culebra\Brillante Tri.5486 Informaticaɖivian˿Lalconversaci󮃱3sinteractivalenstiporrealpensInternetpsedllama?z?z [21:51] Culebra\Brillante
Tri.5486 Informaticaɖivian˿Lalconversaci󮃱3sinteractivalenstiporrealpensInternetpsedllama?z?z
[21:51] Culebra\Brillante 1 Pista: **** Valor pregunta : 5947 Puntos [21:51] Culebra\Brillante
1 Pista: **** Valor pregunta : 5947 Puntos
[21:51] Culebra\Brillante 2 Pista: cha* 30 segundos y 5947 Puntos [21:51] Culebra\Brillante
2 Pista: cha* 30 segundos y 5947 Puntos
[21:51] Culebra\Brillante 3 Pista: cha* 15 segundos y 5947 Puntos [21:51] Culebra\Brillante
3 Pista: cha* 15 segundos y 5947 Puntos
[21:51] CaracolSuave chat [21:51] CaracolSuave
chat
[21:51] Culebra\Brillante �Enhorabuena CaracolSuave!! Has contestado "chat" y por ello has ganado �947�12 puntos [21:51] Culebra\Brillante
�Enhorabuena CaracolSuave!! Has contestado "chat" y por ello has ganado �947�12 puntos
[21:51] Culebra\Brillante CaracolSuave has acertado 12 seguidas!! Puntos HOY: 7998815, SEMANA: 30667061 y MES: 64861890 [21:51] Culebra\Brillante
CaracolSuave has acertado 12 seguidas!! Puntos HOY: 7998815, SEMANA: 30667061 y MES: 64861890
[21:52] Culebra\Brillante Recuerda que est Trivia e GRATIS, por favor, no se queje [21:52] Culebra\Brillante
Recuerda que est Trivia e GRATIS, por favor, no se queje
[21:52] Culebra\Brillante Tri.10774 Economiaɓchiele˿C󭯃13xseillamaralz�iceibursᴩlzdeilarBolsardeiMadrido?o [21:52] Culebra\Brillante
Tri.10774 Economiaɓchiele˿C󭯃13xseillamaralz�iceibursᴩlzdeilarBolsardeiMadrido?o
[21:52] Culebra\Brillante 1 Pista: ****** Valor pregunta : 7876 Puntos [21:52] Culebra\Brillante
1 Pista: ****** Valor pregunta : 7876 Puntos
[21:52] Culebra\Brillante 2 Pista: ibe*** 30 segundos y 7876 Puntos [21:52] Culebra\Brillante
2 Pista: ibe*** 30 segundos y 7876 Puntos
[21:52] Culebra\Brillante 3 Pista: ibe*** 15 segundos y 7876 Puntos [21:52] Culebra\Brillante
3 Pista: ibe*** 15 segundos y 7876 Puntos
[21:52] Culebra\Brillante Tiempo! La respuesta es -> ibex35 <- [21:52] Culebra\Brillante
Tiempo! La respuesta es -> ibex35 <-
[21:52] Culebra\Brillante 7876 Puntos a adidos al BOTE, donde hay 3297417 Puntos [21:52] Culebra\Brillante
7876 Puntos a adidos al BOTE, donde hay 3297417 Puntos
[21:52] Culebra\Brillante Tri.12420 Medicina-Saludɬusie˅lhcuerpovhumano:s߁rteriaslquepaportanzsangrepoxigenadabablabcabeza?s?s [21:52] Culebra\Brillante
Tri.12420 Medicina-Saludɬusie˅lhcuerpovhumano:s߁rteriaslquepaportanzsangrepoxigenadabablabcabeza?s?s
[21:52] Culebra\Brillante 1 Pista: *** ********* Valor pregunta : 12799 Puntos [21:52] Culebra\Brillante
1 Pista: *** ********* Valor pregunta : 12799 Puntos
[21:53] Culebra\Brillante 2 Pista: las ********* 30 segundos y 12799 Puntos [21:53] Culebra\Brillante
2 Pista: las ********* 30 segundos y 12799 Puntos
[21:53] Culebra\Brillante 3 Pista: las *a*o*i*a* 15 segundos y 12799 Puntos [21:53] Culebra\Brillante
3 Pista: las *a*o*i*a* 15 segundos y 12799 Puntos
[21:53] Culebra\Brillante Tiempo! La respuesta es -> las�arotidas <- [21:53] Culebra\Brillante
Tiempo! La respuesta es -> las�arotidas <-
[21:53] Culebra\Brillante 12799 Puntos a adidos al BOTE, donde hay 3310216 Puntos [21:53] Culebra\Brillante
12799 Puntos a adidos al BOTE, donde hay 3310216 Puntos
[21:53] Culebra\Brillante Si desea agregar preguntas & respuestas a la BASE DE DATOS, por favor, comun�elo a un OP de la sala [21:53] Culebra\Brillante
Si desea agregar preguntas & respuestas a la BASE DE DATOS, por favor, comun�elo a un OP de la sala
[21:53] Culebra\Brillante Tri.4168 Fisica-QuimicaɉSA˿AkQueaelementohmetᬩcohcorrespondeaelwsimbolohBiy?k [21:53] Culebra\Brillante
Tri.4168 Fisica-QuimicaɉSA˿AkQueaelementohmetᬩcohcorrespondeaelwsimbolohBiy?k
[21:53] Culebra\Brillante 1 Pista: ******* Valor pregunta : 13191 Puntos [21:53] Culebra\Brillante
1 Pista: ******* Valor pregunta : 13191 Puntos
[21:54] Culebra\Brillante 2 Pista: bis**** 30 segundos y 13191 Puntos [21:54] Culebra\Brillante
2 Pista: bis**** 30 segundos y 13191 Puntos
[21:54] Culebra\Brillante 3 Pista: bis*u*o 15 segundos y 13191 Puntos [21:54] Culebra\Brillante
3 Pista: bis*u*o 15 segundos y 13191 Puntos
[21:54] Culebra\Brillante Tiempo! La respuesta es -> bismuto <- [21:54] Culebra\Brillante
Tiempo! La respuesta es -> bismuto <-
[21:54] Culebra\Brillante 13191 Puntos a adidos al BOTE, donde hay 3323407 Puntos [21:54] Culebra\Brillante
13191 Puntos a adidos al BOTE, donde hay 3323407 Puntos
[21:54] Culebra\Brillante R᮫ing por D́: - Domingo: Paulus 8435839 Lunes: CaracolSuave 6563878 Martes: CaracolSuave 8576491 Miercoles: CaracolSuave 7893517 Jueves: CaracolSuave 5997199 Viernes: CaracolSuave 3467306 Sᢡdo: Paulus 7947521 [21:54] Culebra\Brillante
R᮫ing por D́: - Domingo: Paulus 8435839 Lunes: CaracolSuave 6563878 Martes: CaracolSuave 8576491 Miercoles: CaracolSuave 7893517 Jueves: CaracolSuave 5997199 Viernes: CaracolSuave 3467306 Sᢡdo: Paulus 7947521
[21:54] Culebra\Brillante Tri.13198 Biologiaɳherif˿Cuᬃ13zesnelznombrexcient�cozdelzcangurozgigante?c?c [21:54] Culebra\Brillante
Tri.13198 Biologiaɳherif˿Cuᬃ13zesnelznombrexcient�cozdelzcangurozgigante?c?c
[21:54] Culebra\Brillante 1 Pista: ******** ********* Valor pregunta : 9352 Puntos [21:54] Culebra\Brillante
1 Pista: ******** ********* Valor pregunta : 9352 Puntos
[21:55] Culebra\Brillante 2 Pista: mac***** ********* 30 segundos y 9352 Puntos [21:55] Culebra\Brillante
2 Pista: mac***** ********* 30 segundos y 9352 Puntos
[21:55] Culebra\Brillante 3 Pista: mac*o*u* *i*a**eu* 15 segundos y 9352 Puntos [21:55] Culebra\Brillante
3 Pista: mac*o*u* *i*a**eu* 15 segundos y 9352 Puntos
[21:55] Culebra\Brillante Tiempo! La respuesta es -> macropus�iganteus <- [21:55] Culebra\Brillante
Tiempo! La respuesta es -> macropus�iganteus <-
[21:55] Culebra\Brillante 9352 Puntos a adidos al BOTE, donde hay 3332759 Puntos [21:55] Culebra\Brillante
9352 Puntos a adidos al BOTE, donde hay 3332759 Puntos
[21:55] Culebra\Brillante Para conocer los jugadores con mayores puntuaciones escriba... !top10 [21:55] Culebra\Brillante
Para conocer los jugadores con mayores puntuaciones escriba... !top10
[21:55] Culebra\Brillante Tri.7820 MiscelaneaɁwelete˿GUARDATEtDELtMOZOtCUANDOtLEtSALEt?t [21:55] Culebra\Brillante
Tri.7820 MiscelaneaɁwelete˿GUARDATEtDELtMOZOtCUANDOtLEtSALEt?t
[21:55] Culebra\Brillante 1 Pista: ** **** Valor pregunta : 11237 Puntos [21:55] Culebra\Brillante
1 Pista: ** **** Valor pregunta : 11237 Puntos
[21:55] Culebra\Brillante 2 Pista: el�*** 30 segundos y 11237 Puntos [21:55] Culebra\Brillante
2 Pista: el�*** 30 segundos y 11237 Puntos
[21:56] Culebra\Brillante 3 Pista: el�o*o 15 segundos y 11237 Puntos [21:56] Culebra\Brillante
3 Pista: el�o*o 15 segundos y 11237 Puntos
[21:56] Culebra\Brillante Tiempo! La respuesta es -> el�ozo <- [21:56] Culebra\Brillante
Tiempo! La respuesta es -> el�ozo <-
[21:56] Culebra\Brillante 11237 Puntos a adidos al BOTE, donde hay 3343996 Puntos [21:56] Culebra\Brillante
11237 Puntos a adidos al BOTE, donde hay 3343996 Puntos
[21:56] Culebra\Brillante Tri.8121 Cotilleo-TVɍARLANARE˿CONbQUEbNOMBREbSEbCONOCEbENbESPA񁃱3bAbLAbSERIEbAMERICANAb"CHARMED"b?b [21:56] Culebra\Brillante
Tri.8121 Cotilleo-TVɍARLANARE˿CONbQUEbNOMBREbSEbCONOCEbENbESPA񁃱3bAbLAbSERIEbAMERICANAb"CHARMED"b?b
[21:56] Culebra\Brillante 1 Pista: ********** Valor pregunta : 9273 Puntos [21:56] Culebra\Brillante
1 Pista: ********** Valor pregunta : 9273 Puntos
[21:56] Culebra\Brillante 2 Pista: emb******* 30 segundos y 9273 Puntos [21:56] Culebra\Brillante
2 Pista: emb******* 30 segundos y 9273 Puntos
[21:57] Culebra\Brillante 3 Pista: emb*u*a*a* 15 segundos y 9273 Puntos [21:57] Culebra\Brillante
3 Pista: emb*u*a*a* 15 segundos y 9273 Puntos
[21:57] Culebra\Brillante Tiempo! La respuesta es -> embrujadas <- [21:57] Culebra\Brillante
Tiempo! La respuesta es -> embrujadas <-
[21:57] Culebra\Brillante 9273 Puntos a adidos al BOTE, donde hay 3353269 Puntos [21:57] Culebra\Brillante
9273 Puntos a adidos al BOTE, donde hay 3353269 Puntos
[21:57] Culebra\Brillante Atenci󮠡 las preguntas BONUS de 25.000 y 100.000 puntos!!! [21:57] Culebra\Brillante
Atenci󮠡 las preguntas BONUS de 25.000 y 100.000 puntos!!!
[21:57] Culebra\Brillante Tri.5072 Cotilleo-TVɴjmm.com˅ngAgostozdee2004qseeconoci󃱳qeluef�roznoviazgozdelutorerozFrangRiveravyalavmodelo...q?q [21:57] Culebra\Brillante
Tri.5072 Cotilleo-TVɴjmm.com˅ngAgostozdee2004qseeconoci󃱳qeluef�roznoviazgozdelutorerozFrangRiveravyalavmodelo...q?q
[21:57] Culebra\Brillante 1 Pista: ***** ******* Valor pregunta : 24488 Puntos [21:57] Culebra\Brillante
1 Pista: ***** ******* Valor pregunta : 24488 Puntos
[21:57] Culebra\Brillante 2 Pista: car** ******* 30 segundos y 24488 Puntos [21:57] Culebra\Brillante
2 Pista: car** ******* 30 segundos y 24488 Puntos
[21:58] Culebra\Brillante 3 Pista: car*a *o*a*e* 15 segundos y 24488 Puntos [21:58] Culebra\Brillante
3 Pista: car*a *o*a*e* 15 segundos y 24488 Puntos
[21:58] Culebra\Brillante Tiempo! La respuesta es -> carla�oyanes <- [21:58] Culebra\Brillante
Tiempo! La respuesta es -> carla�oyanes <-
[21:58] Culebra\Brillante 24488 Puntos a adidos al BOTE, donde hay 3377757 Puntos [21:58] Culebra\Brillante
24488 Puntos a adidos al BOTE, donde hay 3377757 Puntos
[21:58] Culebra\Brillante Tri.14518 MusicaɄonNadie˅nyloswprimerosw80's,cdenominaci󮃱3yquebsebdi󃱳caflafoleadafdebgruposwsurgidoswenyMadrid.c?c [21:58] Culebra\Brillante
Tri.14518 MusicaɄonNadie˅nyloswprimerosw80's,cdenominaci󮃱3yquebsebdi󃱳caflafoleadafdebgruposwsurgidoswenyMadrid.c?c
[21:58] Culebra\Brillante 1 Pista: ****** *******񪠃 Valor pregunta : 22649 Puntos [21:58] Culebra\Brillante
1 Pista: ****** *******񪠃 Valor pregunta : 22649 Puntos
[21:58] Culebra\Brillante 2 Pista: mov*** *******񪠃 30 segundos y 22649 Puntos [21:58] Culebra\Brillante
2 Pista: mov*** *******񪠃 30 segundos y 22649 Puntos
[21:58] Culebra\Brillante 3 Pista: movi*a *a**i*e񡠃 15 segundos y 22649 Puntos [21:58] Culebra\Brillante
3 Pista: movi*a *a**i*e񡠃 15 segundos y 22649 Puntos
[21:59] CaracolSuave movida madrile�a [21:59] CaracolSuave
movida madrile�a
[21:59] Culebra\Brillante �Absolutamente correcto CaracolSuave!! Acertaste "movida madrile񡢃12 en �9.687 segundos y ganas �2649�12 puntos [21:59] Culebra\Brillante
�Absolutamente correcto CaracolSuave!! Acertaste "movida madrile񡢃12 en �9.687 segundos y ganas �2649�12 puntos
[21:59] Culebra\Brillante CaracolSuave has acertado 13 seguidas!! Puntos HOY: 8021464, SEMANA: 30689710 y MES: 64884539 [21:59] Culebra\Brillante
CaracolSuave has acertado 13 seguidas!! Puntos HOY: 8021464, SEMANA: 30689710 y MES: 64884539
[21:59] Culebra\Brillante Por favor, se agradece la correcci󮠥n su lenguaje [21:59] Culebra\Brillante
Por favor, se agradece la correcci󮠥n su lenguaje
[21:59] Culebra\Brillante Tri.5874 Cineɉcia˿Dewquienpesglahpeliculah"Cazadorgblanco,zcorazonpnegro"?z?z [21:59] Culebra\Brillante
Tri.5874 Cineɉcia˿Dewquienpesglahpeliculah"Cazadorgblanco,zcorazonpnegro"?z?z
[21:59] Culebra\Brillante 1 Pista: ***** ******** Valor pregunta : 23334 Puntos [21:59] Culebra\Brillante
1 Pista: ***** ******** Valor pregunta : 23334 Puntos
[21:59] Culebra\Brillante 2 Pista: cli** ******** 30 segundos y 23334 Puntos [21:59] Culebra\Brillante
2 Pista: cli** ******** 30 segundos y 23334 Puntos
[21:59] Culebra\Brillante 3 Pista: cli** ea***oo* 15 segundos y 23334 Puntos [21:59] Culebra\Brillante
3 Pista: cli** ea***oo* 15 segundos y 23334 Puntos
[22:00] Culebra\Brillante Tiempo! La respuesta es -> clint�astwood <- [22:00] Culebra\Brillante
Tiempo! La respuesta es -> clint�astwood <-
[22:00] Culebra\Brillante 23334 Puntos a adidos al BOTE, donde hay 3401091 Puntos [22:00] Culebra\Brillante
23334 Puntos a adidos al BOTE, donde hay 3401091 Puntos
[22:00] Culebra\Brillante This is #Mexico, I am your host Culebra\Brillante, running Culebra\Brillante [22:00] Culebra\Brillante
This is #Mexico, I am your host Culebra\Brillante, running Culebra\Brillante
[22:00] Culebra\Brillante Tri.18623 Musicaɳouthpark˿C󭯃13dsexllamanqlosodj'sodex"PontuAeri"z?z [22:00] Culebra\Brillante
Tri.18623 Musicaɳouthpark˿C󭯃13dsexllamanqlosodj'sodex"PontuAeri"z?z
[22:00] Culebra\Brillante 1 Pista: ******* * **** ******** Valor pregunta : 6146 Puntos [22:00] Culebra\Brillante
1 Pista: ******* * **** ******** Valor pregunta : 6146 Puntos
[22:00] CaballitoDeMar}Feliz » Ahora suena: - No Woman, No Cry · https://www.radiolunademiel.com [22:00] CaballitoDeMar}Feliz
» Ahora suena: - No Woman, No Cry · https://www.radiolunademiel.com
[22:00] CaracolSuave .tema [22:00] CaracolSuave
.tema
[22:00] CaracolSuave .radio [22:00] CaracolSuave
.radio
[22:00] CaballitoDeMar}Feliz « Radio Luna de Miel » DJ: Tigre\Real · Tema: Música variada · Peticiones: Cerradas · Canción: - No Woman, No Cry [22:00] CaballitoDeMar}Feliz
« Radio Luna de Miel » DJ: Tigre\Real · Tema: Música variada · Peticiones: Cerradas · Canción: - No Woman, No Cry
[22:00] Culebra\Brillante 2 Pista: sku**** * **** ******** 30 segundos y 6146 Puntos [22:00] Culebra\Brillante
2 Pista: sku**** * **** ******** 30 segundos y 6146 Puntos
[22:00] CaballitoDeMar}Feliz ¦ Emitiendo ( Tigre\Real ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [22:00] CaballitoDeMar}Feliz
¦ Emitiendo ( Tigre\Real ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[22:00] Culebra\Brillante 3 Pista: sku*e*o * *a*i *e**a**a 15 segundos y 6146 Puntos [22:00] Culebra\Brillante
3 Pista: sku*e*o * *a*i *e**a**a 15 segundos y 6146 Puntos
[22:00] Culebra\Brillante Tiempo! La respuesta es -> skudero��avi�etralla <- [22:00] Culebra\Brillante
Tiempo! La respuesta es -> skudero��avi�etralla <-
[22:00] Culebra\Brillante 6146 Puntos a adidos al BOTE, donde hay 3407237 Puntos [22:00] Culebra\Brillante
6146 Puntos a adidos al BOTE, donde hay 3407237 Puntos
[22:01] Culebra\Brillante This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [22:01] Culebra\Brillante
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[22:01] Culebra\Brillante Tri.15937 Idiomasɓebosin˿Diccionario-Sin󮩭oideeorla,imarcoideecuadro?i?i [22:01] Culebra\Brillante
Tri.15937 Idiomasɓebosin˿Diccionario-Sin󮩭oideeorla,imarcoideecuadro?i?i
[22:01] Culebra\Brillante 1 Pista: ******** Pregunta de BONUS : 50000 Puntos [22:01] Culebra\Brillante
1 Pista: ******** Pregunta de BONUS : 50000 Puntos
[22:01] Culebra\Brillante 2 Pista: pas***** 30 segundos y 50000 Puntos [22:01] Culebra\Brillante
2 Pista: pas***** 30 segundos y 50000 Puntos
[22:01] Culebra\Brillante 3 Pista: pas*a**u 15 segundos y 50000 Puntos [22:01] Culebra\Brillante
3 Pista: pas*a**u 15 segundos y 50000 Puntos
[22:01] Culebra\Brillante Tiempo! La respuesta es -> paspartu <- [22:01] Culebra\Brillante
Tiempo! La respuesta es -> paspartu <-
[22:01] Culebra\Brillante 50000 Puntos a adidos al BOTE, donde hay 3457237 Puntos [22:01] Culebra\Brillante
50000 Puntos a adidos al BOTE, donde hay 3457237 Puntos
[22:02] Culebra\Brillante Recuerda que est Trivia e GRATIS, por favor, no se queje [22:02] Culebra\Brillante
Recuerda que est Trivia e GRATIS, por favor, no se queje
[22:02] Culebra\Brillante Tri.3454 MiscelaneaɌopes˿Enfqueaciudadlimaginariafestarianflasellavese?c [22:02] Culebra\Brillante
Tri.3454 MiscelaneaɌopes˿Enfqueaciudadlimaginariafestarianflasellavese?c
[22:02] Culebra\Brillante 1 Pista: ********* Pregunta de BONUS : 100000 Puntos [22:02] Culebra\Brillante
1 Pista: ********* Pregunta de BONUS : 100000 Puntos
[22:02] Culebra\Brillante 2 Pista: atl****** 30 segundos y 100000 Puntos [22:02] Culebra\Brillante
2 Pista: atl****** 30 segundos y 100000 Puntos
[22:02] Culebra\Brillante 3 Pista: atla**i*a 15 segundos y 100000 Puntos [22:02] Culebra\Brillante
3 Pista: atla**i*a 15 segundos y 100000 Puntos
[22:02] Culebra\Brillante Tiempo! La respuesta es -> atlantida <- [22:02] Culebra\Brillante
Tiempo! La respuesta es -> atlantida <-
[22:02] Culebra\Brillante 100000 Puntos a adidos al BOTE, donde hay 3557237 Puntos [22:02] Culebra\Brillante
100000 Puntos a adidos al BOTE, donde hay 3557237 Puntos
[22:02] Culebra\Brillante This MONTHS Top 11-20: - #11: ChicodeGranada 738439 #12: Guiarte_Yo 619557 #13: BLaNKoN_PeR4eVeR 200000 #14: fff 173570 #15: Miriam_ 156310 #16: Cosmo 149640 #17: DanielPerez_ 116023 #18: elagujero 108090 #19: Alii 82683 #20: HeaLth_Rider 80860 [22:02] Culebra\Brillante
This MONTHS Top 11-20: - #11: ChicodeGranada 738439 #12: Guiarte_Yo 619557 #13: BLaNKoN_PeR4eVeR 200000 #14: fff 173570 #15: Miriam_ 156310 #16: Cosmo 149640 #17: DanielPerez_ 116023 #18: elagujero 108090 #19: Alii 82683 #20: HeaLth_Rider 80860
[22:02] Culebra\Brillante Tri.11121 Mitologiaɭ˿CU�pESpLApISLApDEpLOSpHOMBRESpP�ARO?p?p [22:02] Culebra\Brillante
Tri.11121 Mitologiaɭ˿CU�pESpLApISLApDEpLOSpHOMBRESpP�ARO?p?p
[22:02] Culebra\Brillante 1 Pista: **** ** ****** Valor pregunta : 10914 Puntos [22:02] Culebra\Brillante
1 Pista: **** ** ****** Valor pregunta : 10914 Puntos
[22:03] Culebra\Brillante 2 Pista: isl* ** ****** 30 segundos y 10914 Puntos [22:03] Culebra\Brillante
2 Pista: isl* ** ****** 30 segundos y 10914 Puntos
[22:03] Culebra\Brillante 3 Pista: isla *e *a**ua 15 segundos y 10914 Puntos [22:03] Culebra\Brillante
3 Pista: isla *e *a**ua 15 segundos y 10914 Puntos
[22:03] CaracolSuave isla de pascua [22:03] CaracolSuave
isla de pascua
[22:03] Culebra\Brillante �Est᳠que lo tiras CaracolSuave!! ߃󭯠supiste que "isla de pascua" era la respuesta? Venga, �0914�12 puntos suben a tu marcador [22:03] Culebra\Brillante
�Est᳠que lo tiras CaracolSuave!! ߃󭯠supiste que "isla de pascua" era la respuesta? Venga, �0914�12 puntos suben a tu marcador
[22:03] Culebra\Brillante CaracolSuave has acertado 14 seguidas!! Puntos HOY: 8032378, SEMANA: 30700624 y MES: 64895453 [22:03] Culebra\Brillante
CaracolSuave has acertado 14 seguidas!! Puntos HOY: 8032378, SEMANA: 30700624 y MES: 64895453
[22:03] Culebra\Brillante R᮫ing �ltima SEMANA: #1: CaracolSuave 52274936 #2: Paulus 12116637 #3: _Samantha_ 12018901 [22:03] Culebra\Brillante
R᮫ing �ltima SEMANA: #1: CaracolSuave 52274936 #2: Paulus 12116637 #3: _Samantha_ 12018901
[22:03] Culebra\Brillante Tri.6493 Eros-Sexɴjmm.com˿Elwlugarmpreferidowpormlosqespa񯬥sqendtercermlugarm(trasqlaicamaiywlaiplaya)oparaihacermguarreridasqespa񯬡sqesqel...o?o [22:03] Culebra\Brillante
Tri.6493 Eros-Sexɴjmm.com˿Elwlugarmpreferidowpormlosqespa񯬥sqendtercermlugarm(trasqlaicamaiywlaiplaya)oparaihacermguarreridasqespa񯬡sqesqel...o?o
[22:03] Culebra\Brillante 1 Pista: ****** ** **񪠃 Pregunta de BONUS : 200000 Puntos [22:03] Culebra\Brillante
1 Pista: ****** ** **񪠃 Pregunta de BONUS : 200000 Puntos
[22:04] Culebra\Brillante 2 Pista: cua*** ** **񪠃 30 segundos y 200000 Puntos [22:04] Culebra\Brillante
2 Pista: cua*** ** **񪠃 30 segundos y 200000 Puntos
[22:04] CaracolSuave cuarto de ba�o [22:04] CaracolSuave
cuarto de ba�o
[22:04] Culebra\Brillante �Bien CaracolSuave!! Tu respuesta: "cuarto de ba񯢃12 es correcta y ganas �00000�12 puntos [22:04] Culebra\Brillante
�Bien CaracolSuave!! Tu respuesta: "cuarto de ba񯢃12 es correcta y ganas �00000�12 puntos
[22:04] Culebra\Brillante CaracolSuave has acertado 15 seguidas!! Puntos HOY: 8232378, SEMANA: 30900624 y MES: 65095453 [22:04] Culebra\Brillante
CaracolSuave has acertado 15 seguidas!! Puntos HOY: 8232378, SEMANA: 30900624 y MES: 65095453
[22:04] Culebra\Brillante Los jugadore Top10 (Semanal & Mensual) Tienen auto-Voice! [22:04] Culebra\Brillante
Los jugadore Top10 (Semanal & Mensual) Tienen auto-Voice!
[22:04] Culebra\Brillante Tri.12524 IdiomasɁlkaid˿ASTURIANO-ESPA񏌺CORUXA?n?n [22:04] Culebra\Brillante
Tri.12524 IdiomasɁlkaid˿ASTURIANO-ESPA񏌺CORUXA?n?n
[22:04] Culebra\Brillante 1 Pista: ******* Pregunta de BONUS : 100000 Puntos [22:04] Culebra\Brillante
1 Pista: ******* Pregunta de BONUS : 100000 Puntos
[22:04] Culebra\Brillante 2 Pista: lec**** 30 segundos y 100000 Puntos [22:04] Culebra\Brillante
2 Pista: lec**** 30 segundos y 100000 Puntos
[22:04] CaracolSuave lectura [22:04] CaracolSuave
lectura
[22:04] Culebra\Brillante 3 Pista: lec*u*a 15 segundos y 100000 Puntos [22:04] Culebra\Brillante
3 Pista: lec*u*a 15 segundos y 100000 Puntos
[22:05] CaracolSuave lechuga [22:05] CaracolSuave
lechuga
[22:05] Culebra\Brillante Tiempo! La respuesta es -> lechuza <- [22:05] Culebra\Brillante
Tiempo! La respuesta es -> lechuza <-
[22:05] Culebra\Brillante 100000 Puntos a adidos al BOTE, donde hay 3657237 Puntos [22:05] Culebra\Brillante
100000 Puntos a adidos al BOTE, donde hay 3657237 Puntos
[22:05] Culebra\Brillante Si detecta una pregunta o respuesta incorrecta, por favor, comun�elo a un OP de la sala [22:05] Culebra\Brillante
Si detecta una pregunta o respuesta incorrecta, por favor, comun�elo a un OP de la sala
[22:05] Culebra\Brillante Tri.11499 CancionesɃocoman˿Deaquienseswlaqcancions"Noqsoportoqeldrap"z?z [22:05] Culebra\Brillante
Tri.11499 CancionesɃocoman˿Deaquienseswlaqcancions"Noqsoportoqeldrap"z?z
[22:05] Culebra\Brillante 1 Pista: ******* ****** Pregunta de BONUS : 25000 Puntos [22:05] Culebra\Brillante
1 Pista: ******* ****** Pregunta de BONUS : 25000 Puntos
[22:05] Culebra\Brillante 2 Pista: joa**** ****** 30 segundos y 25000 Puntos [22:05] Culebra\Brillante
2 Pista: joa**** ****** 30 segundos y 25000 Puntos
[22:05] Culebra\Brillante 3 Pista: joa*ui* *a*i*a 15 segundos y 25000 Puntos [22:05] Culebra\Brillante
3 Pista: joa*ui* *a*i*a 15 segundos y 25000 Puntos
[22:06] Culebra\Brillante Tiempo! La respuesta es -> joaquin�abina <- [22:06] Culebra\Brillante
Tiempo! La respuesta es -> joaquin�abina <-
[22:06] Culebra\Brillante 25000 Puntos a adidos al BOTE, donde hay 3682237 Puntos [22:06] Culebra\Brillante
25000 Puntos a adidos al BOTE, donde hay 3682237 Puntos
[22:06] Culebra\Brillante R᮫ing SEMANA: - #1: CaracolSuave 30900624 #2: Paulus 8435839 #3: siva- 4607335 #4: LeCaTwaLk_z 2198600 #5: ChicodeGranada 244103 #6: Miriam_ 108988 #7: elagujero 108090 #8: Maryel_ 25000 #9: YasuoGr 23969 #10: Tigre_Marron 20136 [22:06] Culebra\Brillante
R᮫ing SEMANA: - #1: CaracolSuave 30900624 #2: Paulus 8435839 #3: siva- 4607335 #4: LeCaTwaLk_z 2198600 #5: ChicodeGranada 244103 #6: Miriam_ 108988 #7: elagujero 108090 #8: Maryel_ 25000 #9: YasuoGr 23969 #10: Tigre_Marron 20136
[22:06] Culebra\Brillante Tri.459 DeporteɔeLaRaNhA˿F1:c߃uantoszgrandeszPremioszdebeb"durar"celkmotorsdebunymonoplaza,caupartirsdebesteba񯃱3l2005?c(cifra)"c?c [22:06] Culebra\Brillante
Tri.459 DeporteɔeLaRaNhA˿F1:c߃uantoszgrandeszPremioszdebeb"durar"celkmotorsdebunymonoplaza,caupartirsdebesteba񯃱3l2005?c(cifra)"c?c
[22:06] Culebra\Brillante 1 Pista: * Pregunta de BONUS : 50000 Puntos [22:06] Culebra\Brillante
1 Pista: * Pregunta de BONUS : 50000 Puntos
[22:06] Culebra\Brillante 2 Pista: 2 30 segundos y 50000 Puntos [22:06] Culebra\Brillante
2 Pista: 2 30 segundos y 50000 Puntos
[22:06] CaracolSuave 2 [22:06] CaracolSuave
2
[22:06] Culebra\Brillante �Bingo!! CaracolSuave dio la respuesta: "2" en �9.984 segundos e incrementa sus ganancias con �0000�12 puntos [22:06] Culebra\Brillante
�Bingo!! CaracolSuave dio la respuesta: "2" en �9.984 segundos e incrementa sus ganancias con �0000�12 puntos
[22:06] Culebra\Brillante CaracolSuave has acertado 16 seguidas!! Puntos HOY: 8282378, SEMANA: 30950624 y MES: 65145453 [22:06] Culebra\Brillante
CaracolSuave has acertado 16 seguidas!! Puntos HOY: 8282378, SEMANA: 30950624 y MES: 65145453
[22:06] Culebra\Brillante Tenemos m᳠de 70.000 preguntas y respuestas!! [22:06] Culebra\Brillante
Tenemos m᳠de 70.000 preguntas y respuestas!!
[22:06] Culebra\Brillante Tri.14272 Arteɤepeche˿JuntodavlavpuertavdeelavCapillavSixtinavhaygunwcancelbdeemᲭol,pߑui鮃13wlodlabr󿃱3p?p [22:06] Culebra\Brillante
Tri.14272 Arteɤepeche˿JuntodavlavpuertavdeelavCapillavSixtinavhaygunwcancelbdeemᲭol,pߑui鮃13wlodlabr󿃱3p?p
[22:06] Culebra\Brillante 1 Pista: **** ** ******* Valor pregunta : 15996 Puntos [22:06] Culebra\Brillante
1 Pista: **** ** ******* Valor pregunta : 15996 Puntos
[22:07] Culebra\Brillante 2 Pista: min* ** ******* 30 segundos y 15996 Puntos [22:07] Culebra\Brillante
2 Pista: min* ** ******* 30 segundos y 15996 Puntos
[22:07] Culebra\Brillante 3 Pista: mino *a *ie*o*e 15 segundos y 15996 Puntos [22:07] Culebra\Brillante
3 Pista: mino *a *ie*o*e 15 segundos y 15996 Puntos
[22:07] Culebra\Brillante Tiempo! La respuesta es -> mino�a�iesole <- [22:07] Culebra\Brillante
Tiempo! La respuesta es -> mino�a�iesole <-
[22:07] Culebra\Brillante 15996 Puntos a adidos al BOTE, donde hay 3698233 Puntos [22:07] Culebra\Brillante
15996 Puntos a adidos al BOTE, donde hay 3698233 Puntos
[22:07] Culebra\Brillante Tri.16548 Cancionesɋarmo˿Decquecgrupojesglaecancionw"Everyubreathvyouytake"k?k [22:07] Culebra\Brillante
Tri.16548 Cancionesɋarmo˿Decquecgrupojesglaecancionw"Everyubreathvyouytake"k?k
[22:07] Culebra\Brillante 1 Pista: ****** Valor pregunta : 13541 Puntos [22:07] Culebra\Brillante
1 Pista: ****** Valor pregunta : 13541 Puntos
[22:07] Culebra\Brillante 2 Pista: pol*** 30 segundos y 13541 Puntos [22:07] Culebra\Brillante
2 Pista: pol*** 30 segundos y 13541 Puntos
[22:08] CaracolSuave police [22:08] CaracolSuave
police
[22:08] Culebra\Brillante �Est᳠que lo tiras CaracolSuave!! ߃󭯠supiste que "police" era la respuesta? Venga, �3541�12 puntos suben a tu marcador [22:08] Culebra\Brillante
�Est᳠que lo tiras CaracolSuave!! ߃󭯠supiste que "police" era la respuesta? Venga, �3541�12 puntos suben a tu marcador
[22:08] Culebra\Brillante CaracolSuave has acertado 17 seguidas!! Puntos HOY: 8295919, SEMANA: 30964165 y MES: 65158994 [22:08] Culebra\Brillante
CaracolSuave has acertado 17 seguidas!! Puntos HOY: 8295919, SEMANA: 30964165 y MES: 65158994
[22:08] Culebra\Brillante Atenci󮠡 las preguntas MEGA BONUS de 500.000 y 1.000.000 de puntos [22:08] Culebra\Brillante
Atenci󮠡 las preguntas MEGA BONUS de 500.000 y 1.000.000 de puntos
[22:08] Culebra\Brillante Tri.18926 Cotilleo-TVɍARdeJAVA˿CӍOxSExLLAMABAxELxPERROxQUExSIEMPRExAYUDABAxAxSOPHIExAxSACARxAxSUxT͏,xELxINSPECTORxGADGET,xDExLOSxL͏SxENxLOSxQUExSExMET́?x?x [22:08] Culebra\Brillante
Tri.18926 Cotilleo-TVɍARdeJAVA˿CӍOxSExLLAMABAxELxPERROxQUExSIEMPRExAYUDABAxAxSOPHIExAxSACARxAxSUxT͏,xELxINSPECTORxGADGET,xDExLOSxL͏SxENxLOSxQUExSExMET́?x?x
[22:08] Culebra\Brillante 1 Pista: ****** Pregunta de BOTE!! : 3698233 Puntos [22:08] Culebra\Brillante
1 Pista: ****** Pregunta de BOTE!! : 3698233 Puntos
[22:08] Culebra\Brillante 2 Pista: sul*** 30 segundos y 3698233 Puntos [22:08] Culebra\Brillante
2 Pista: sul*** 30 segundos y 3698233 Puntos
[22:08] Culebra\Brillante 3 Pista: sul*a* 15 segundos y 3698233 Puntos [22:08] Culebra\Brillante
3 Pista: sul*a* 15 segundos y 3698233 Puntos
[22:08] CaracolSuave sultan [22:08] CaracolSuave
sultan
[22:08] Culebra\Brillante �Suma y sigue CaracolSuave!! La respuesta: "sultan" incrementa tu marcador en �698233�12 puntos [22:08] Culebra\Brillante
�Suma y sigue CaracolSuave!! La respuesta: "sultan" incrementa tu marcador en �698233�12 puntos
[22:08] Culebra\Brillante CaracolSuave has acertado 18 seguidas!! Puntos HOY: 11994152, SEMANA: 34662398 y MES: 68857227 [22:08] Culebra\Brillante
CaracolSuave has acertado 18 seguidas!! Puntos HOY: 11994152, SEMANA: 34662398 y MES: 68857227
[22:08] Culebra\Brillante Recuerda que est Trivia e GRATIS, por favor, no se queje [22:08] Culebra\Brillante
Recuerda que est Trivia e GRATIS, por favor, no se queje
[22:08] Culebra\Brillante Tri.7679 DeporteɔeLaRaNhA˿GanadorddelxDakard1996,gcategoriamMOTOSg?g [22:08] Culebra\Brillante
Tri.7679 DeporteɔeLaRaNhA˿GanadorddelxDakard1996,gcategoriamMOTOSg?g
[22:08] Culebra\Brillante 1 Pista: *** ****** Pregunta de BONUS : 100000 Puntos [22:08] Culebra\Brillante
1 Pista: *** ****** Pregunta de BONUS : 100000 Puntos
[22:09] Culebra\Brillante 2 Pista: edi ****** 30 segundos y 100000 Puntos [22:09] Culebra\Brillante
2 Pista: edi ****** 30 segundos y 100000 Puntos
[22:09] Culebra\Brillante 3 Pista: edi o*io*i 15 segundos y 100000 Puntos [22:09] Culebra\Brillante
3 Pista: edi o*io*i 15 segundos y 100000 Puntos
[22:09] Culebra\Brillante Tiempo! La respuesta es -> edi�rioli <- [22:09] Culebra\Brillante
Tiempo! La respuesta es -> edi�rioli <-
[22:09] Culebra\Brillante 100000 Puntos a adidos al BOTE, donde hay 100000 Puntos [22:09] Culebra\Brillante
100000 Puntos a adidos al BOTE, donde hay 100000 Puntos
[22:09] Culebra\Brillante Tri.20238 Geografiaɳubmarin˿Cuᬃ13eesulalciudadwquezhacezdezpuertoqdezSantiagoqdezChile?l?l [22:09] Culebra\Brillante
Tri.20238 Geografiaɳubmarin˿Cuᬃ13eesulalciudadwquezhacezdezpuertoqdezSantiagoqdezChile?l?l
[22:09] Culebra\Brillante 1 Pista: ********** Pregunta de BOTE!! : 100000 Puntos [22:09] Culebra\Brillante
1 Pista: ********** Pregunta de BOTE!! : 100000 Puntos
[22:10] Culebra\Brillante 2 Pista: val******* 30 segundos y 100000 Puntos [22:10] Culebra\Brillante
2 Pista: val******* 30 segundos y 100000 Puntos
[22:10] Culebra\Brillante 3 Pista: val*a*ai*o 15 segundos y 100000 Puntos [22:10] Culebra\Brillante
3 Pista: val*a*ai*o 15 segundos y 100000 Puntos
[22:10] Culebra\Brillante Tiempo! La respuesta es -> valparaiso <- [22:10] Culebra\Brillante
Tiempo! La respuesta es -> valparaiso <-
[22:10] Culebra\Brillante 100000 Puntos BOTE vuelven al BOTE [22:10] Culebra\Brillante
100000 Puntos BOTE vuelven al BOTE
[22:10] Culebra\Brillante Si desea agregar preguntas & respuestas a la BASE DE DATOS, por favor, comun�elo a un OP de la sala [22:10] Culebra\Brillante
Si desea agregar preguntas & respuestas a la BASE DE DATOS, por favor, comun�elo a un OP de la sala
[22:10] Culebra\Brillante Tri.7498 PoliticaɍARdeJAVA˅NbELbNڍEROb10bDEbQUɃ13bCALLEbVIVEbELbPRIMERbMINISTRObBRIT�ICObTONYbBLAIR?b?b [22:10] Culebra\Brillante
Tri.7498 PoliticaɍARdeJAVA˅NbELbNڍEROb10bDEbQUɃ13bCALLEbVIVEbELbPRIMERbMINISTRObBRIT�ICObTONYbBLAIR?b?b
[22:10] Culebra\Brillante 1 Pista: ******* ****** Valor pregunta : 24129 Puntos [22:10] Culebra\Brillante
1 Pista: ******* ****** Valor pregunta : 24129 Puntos
[22:11] Culebra\Brillante 2 Pista: dow**** ****** 30 segundos y 24129 Puntos [22:11] Culebra\Brillante
2 Pista: dow**** ****** 30 segundos y 24129 Puntos
[22:11] Culebra\Brillante 3 Pista: dow*i** ***ee* 15 segundos y 24129 Puntos [22:11] Culebra\Brillante
3 Pista: dow*i** ***ee* 15 segundos y 24129 Puntos
[22:11] Culebra\Brillante Tiempo! La respuesta es -> downing�treet <- [22:11] Culebra\Brillante
Tiempo! La respuesta es -> downing�treet <-
[22:11] Culebra\Brillante 24129 Puntos a adidos al BOTE, donde hay 124129 Puntos [22:11] Culebra\Brillante
24129 Puntos a adidos al BOTE, donde hay 124129 Puntos
[22:11] Culebra\Brillante R᮫ing por D́: - Domingo: Paulus 8435839 Lunes: CaracolSuave 6563878 Martes: CaracolSuave 8576491 Miercoles: CaracolSuave 7893517 Jueves: CaracolSuave 5997199 Viernes: CaracolSuave 3467306 Sᢡdo: Paulus 7947521 [22:11] Culebra\Brillante
R᮫ing por D́: - Domingo: Paulus 8435839 Lunes: CaracolSuave 6563878 Martes: CaracolSuave 8576491 Miercoles: CaracolSuave 7893517 Jueves: CaracolSuave 5997199 Viernes: CaracolSuave 3467306 Sᢡdo: Paulus 7947521
[22:11] Culebra\Brillante Tri.5317 DeporteɔDI˿ArQUErGUARDAMETArLErENDOSOrBUTRAGUE񏃱3rSUrPRIMERrGOLrENrPRIMERArDIVISIONr?r [22:11] Culebra\Brillante
Tri.5317 DeporteɔDI˿ArQUErGUARDAMETArLErENDOSOrBUTRAGUE񏃱3rSUrPRIMERrGOLrENrPRIMERArDIVISIONr?r
[22:11] Culebra\Brillante 1 Pista: ****** Valor pregunta : 20235 Puntos [22:11] Culebra\Brillante
1 Pista: ****** Valor pregunta : 20235 Puntos
[22:11] Culebra\Brillante 2 Pista: ced*** 30 segundos y 20235 Puntos [22:11] Culebra\Brillante
2 Pista: ced*** 30 segundos y 20235 Puntos
[22:12] CaracolSuave cedrun [22:12] CaracolSuave
cedrun
[22:12] Culebra\Brillante �Ol頃04CaracolSuave!! Has contestado: "cedrun" en �2.781 segundos y sumas �0235�12 puntos a tu marcador. �Sigue as� [22:12] Culebra\Brillante
�Ol頃04CaracolSuave!! Has contestado: "cedrun" en �2.781 segundos y sumas �0235�12 puntos a tu marcador. �Sigue as�
[22:12] Culebra\Brillante CaracolSuave has acertado 19 seguidas!! Puntos HOY: 12014387, SEMANA: 34682633 y MES: 68877462 [22:12] Culebra\Brillante
CaracolSuave has acertado 19 seguidas!! Puntos HOY: 12014387, SEMANA: 34682633 y MES: 68877462
[22:12] Culebra\Brillante Para conocer los jugadores con mayores puntuaciones escriba... !top10 [22:12] Culebra\Brillante
Para conocer los jugadores con mayores puntuaciones escriba... !top10
[22:12] Culebra\Brillante Tri.19550 Historiaɳubmarin˿D󮤥jvenci󃱳uclodoveooajlosbalamanes?u?u [22:12] Culebra\Brillante
Tri.19550 Historiaɳubmarin˿D󮤥jvenci󃱳uclodoveooajlosbalamanes?u?u
[22:12] Culebra\Brillante 1 Pista: ******* Pregunta de BONUS : 200000 Puntos [22:12] Culebra\Brillante
1 Pista: ******* Pregunta de BONUS : 200000 Puntos
[22:12] Culebra\Brillante 2 Pista: tol**** 30 segundos y 200000 Puntos [22:12] Culebra\Brillante
2 Pista: tol**** 30 segundos y 200000 Puntos
[22:12] Culebra\Brillante 3 Pista: tol*ia* 15 segundos y 200000 Puntos [22:12] Culebra\Brillante
3 Pista: tol*ia* 15 segundos y 200000 Puntos
[22:12] Culebra\Brillante Tiempo! La respuesta es -> tolbiac <- [22:12] Culebra\Brillante
Tiempo! La respuesta es -> tolbiac <-
[22:12] Culebra\Brillante 200000 Puntos a adidos al BOTE, donde hay 324129 Puntos [22:12] Culebra\Brillante
200000 Puntos a adidos al BOTE, donde hay 324129 Puntos
[22:13] Culebra\Brillante Tri.7282 Eros-Sexɩfen˿(siglas)usignificadosdebDIUu?u [22:13] Culebra\Brillante
Tri.7282 Eros-Sexɩfen˿(siglas)usignificadosdebDIUu?u
[22:13] Culebra\Brillante 1 Pista: *********** ************ Valor pregunta : 9825 Puntos [22:13] Culebra\Brillante
1 Pista: *********** ************ Valor pregunta : 9825 Puntos
[22:13] Culebra\Brillante 2 Pista: dis******** ************ 30 segundos y 9825 Puntos [22:13] Culebra\Brillante
2 Pista: dis******** ************ 30 segundos y 9825 Puntos
[22:13] Culebra\Brillante 3 Pista: dis*o*i*i*o i***au*e*i*o 15 segundos y 9825 Puntos [22:13] Culebra\Brillante
3 Pista: dis*o*i*i*o i***au*e*i*o 15 segundos y 9825 Puntos
[22:13] Culebra\Brillante Tiempo! La respuesta es -> dispositivo�ntrauterino <- [22:13] Culebra\Brillante
Tiempo! La respuesta es -> dispositivo�ntrauterino <-
[22:13] Culebra\Brillante 9825 Puntos a adidos al BOTE, donde hay 333954 Puntos [22:13] Culebra\Brillante
9825 Puntos a adidos al BOTE, donde hay 333954 Puntos
[22:14] Culebra\Brillante Atenci󮠡 las preguntas BONUS de 25.000 y 100.000 puntos!!! [22:14] Culebra\Brillante
Atenci󮠡 las preguntas BONUS de 25.000 y 100.000 puntos!!!
[22:14] Culebra\Brillante Tri.18553 Miscelaneaɴjmm.com˿Cuandovunawreligi󮃱3zovfilosof�13wessunawmezclawdedotrassdoctrinassseddicedquedes...r?r [22:14] Culebra\Brillante
Tri.18553 Miscelaneaɴjmm.com˿Cuandovunawreligi󮃱3zovfilosof�13wessunawmezclawdedotrassdoctrinassseddicedquedes...r?r
[22:14] Culebra\Brillante 1 Pista: *********** Valor pregunta : 6379 Puntos [22:14] Culebra\Brillante
1 Pista: *********** Valor pregunta : 6379 Puntos
[22:14] Culebra\Brillante 2 Pista: sin******** 30 segundos y 6379 Puntos [22:14] Culebra\Brillante
2 Pista: sin******** 30 segundos y 6379 Puntos
[22:14] CaracolSuave sincretismo [22:14] CaracolSuave
sincretismo
[22:14] Culebra\Brillante 3 Pista: sin**e*i**a 15 segundos y 6379 Puntos [22:14] Culebra\Brillante
3 Pista: sin**e*i**a 15 segundos y 6379 Puntos
[22:14] CaracolSuave sincretisma [22:14] CaracolSuave
sincretisma
[22:14] Culebra\Brillante Tiempo! La respuesta es -> sincretista <- [22:14] Culebra\Brillante
Tiempo! La respuesta es -> sincretista <-
[22:14] Culebra\Brillante 6379 Puntos a adidos al BOTE, donde hay 340333 Puntos [22:14] Culebra\Brillante
6379 Puntos a adidos al BOTE, donde hay 340333 Puntos
[22:15] Culebra\Brillante Tri.17069 CienciaɆilipides˿Aeronautica-LosoVOR,rusadosoparaycrearbpasillosoa鲥os,rson...r?r [22:15] Culebra\Brillante
Tri.17069 CienciaɆilipides˿Aeronautica-LosoVOR,rusadosoparaycrearbpasillosoa鲥os,rson...r?r
[22:15] Culebra\Brillante 1 Pista: ********** ***************** Valor pregunta : 14294 Puntos [22:15] Culebra\Brillante
1 Pista: ********** ***************** Valor pregunta : 14294 Puntos
[22:15] Culebra\Brillante 2 Pista: rad******* ***************** 30 segundos y 14294 Puntos [22:15] Culebra\Brillante
2 Pista: rad******* ***************** 30 segundos y 14294 Puntos
[22:15] Culebra\Brillante 3 Pista: radio*a*o* o**i*i*e**io*a*e* 15 segundos y 14294 Puntos [22:15] Culebra\Brillante
3 Pista: radio*a*o* o**i*i*e**io*a*e* 15 segundos y 14294 Puntos
[22:15] CaballitoDeMar}Feliz ¦ Emitiendo ( Tigre\Real ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [22:15] CaballitoDeMar}Feliz
¦ Emitiendo ( Tigre\Real ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[22:15] Culebra\Brillante Tiempo! La respuesta es -> radiofaros�mnidireccionales <- [22:15] Culebra\Brillante
Tiempo! La respuesta es -> radiofaros�mnidireccionales <-
[22:15] Culebra\Brillante 14294 Puntos a adidos al BOTE, donde hay 354627 Puntos [22:15] Culebra\Brillante
14294 Puntos a adidos al BOTE, donde hay 354627 Puntos
[22:15] Culebra\Brillante Por favor, se agradece la correcci󮠥n su lenguaje [22:15] Culebra\Brillante
Por favor, se agradece la correcci󮠥n su lenguaje
[22:15] Culebra\Brillante Tri.4295 CancionesɃheewakka˿Dekquienhese"SkinkydReggae"g?g [22:15] Culebra\Brillante
Tri.4295 CancionesɃheewakka˿Dekquienhese"SkinkydReggae"g?g
[22:15] Culebra\Brillante 1 Pista: *** ****** Valor pregunta : 9428 Puntos [22:15] Culebra\Brillante
1 Pista: *** ****** Valor pregunta : 9428 Puntos
[22:16] Culebra\Brillante 2 Pista: bob ****** 30 segundos y 9428 Puntos [22:16] Culebra\Brillante
2 Pista: bob ****** 30 segundos y 9428 Puntos
[22:16] Culebra\Brillante 3 Pista: bob *a**e* 15 segundos y 9428 Puntos [22:16] Culebra\Brillante
3 Pista: bob *a**e* 15 segundos y 9428 Puntos
[22:16] CaracolSuave bob marley [22:16] CaracolSuave
bob marley
[22:16] Culebra\Brillante �Eso es CaracolSuave!! Dijiste: "bob marley" y ello te ha valido: �428�12 puntos [22:16] Culebra\Brillante
�Eso es CaracolSuave!! Dijiste: "bob marley" y ello te ha valido: �428�12 puntos
[22:16] Culebra\Brillante CaracolSuave has acertado 20 seguidas!! Puntos HOY: 12023815, SEMANA: 34692061 y MES: 68886890 [22:16] Culebra\Brillante
CaracolSuave has acertado 20 seguidas!! Puntos HOY: 12023815, SEMANA: 34692061 y MES: 68886890
[22:16] Culebra\Brillante Bonus especial de 60000 Puntos para CaracolSuave por acertar 20 seguidas!!! [22:16] Culebra\Brillante
Bonus especial de 60000 Puntos para CaracolSuave por acertar 20 seguidas!!!
[22:16] Culebra\Brillante 20 in a Row !!! I Think that CaracolSuave is HOGGING the Quiz !!! Is Everybody Asleep!? [22:16] Culebra\Brillante
20 in a Row !!! I Think that CaracolSuave is HOGGING the Quiz !!! Is Everybody Asleep!?
[22:16] Culebra\Brillante This is #Mexico, I am your host Culebra\Brillante, running Culebra\Brillante [22:16] Culebra\Brillante
This is #Mexico, I am your host Culebra\Brillante, running Culebra\Brillante
[22:16] Culebra\Brillante Tri.3114 Cienciaɍachakao˿COMObSEbLLAMAbAbLAbALTURAbDEbUNAbCARAbLATERALbDEbUNAbPIRAMIDEbREGULAR?b?b [22:16] Culebra\Brillante
Tri.3114 Cienciaɍachakao˿COMObSEbLLAMAbAbLAbALTURAbDEbUNAbCARAbLATERALbDEbUNAbPIRAMIDEbREGULAR?b?b
[22:16] Culebra\Brillante 1 Pista: ******* Pregunta de BONUS : 25000 Puntos [22:16] Culebra\Brillante
1 Pista: ******* Pregunta de BONUS : 25000 Puntos
[22:16] Culebra\Brillante 2 Pista: apo**** 30 segundos y 25000 Puntos [22:16] Culebra\Brillante
2 Pista: apo**** 30 segundos y 25000 Puntos
[22:17] Culebra\Brillante 3 Pista: apo*e*a 15 segundos y 25000 Puntos [22:17] Culebra\Brillante
3 Pista: apo*e*a 15 segundos y 25000 Puntos
[22:17] Culebra\Brillante Tiempo! La respuesta es -> apotema <- [22:17] Culebra\Brillante
Tiempo! La respuesta es -> apotema <-
[22:17] Culebra\Brillante 25000 Puntos a adidos al BOTE, donde hay 379627 Puntos [22:17] Culebra\Brillante
25000 Puntos a adidos al BOTE, donde hay 379627 Puntos
[22:17] Culebra\Brillante This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [22:17] Culebra\Brillante
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[22:17] Culebra\Brillante Tri.17831 Politicaɐrometeus˿C󭯃13lseullamarelasecretariolgeneraladelaA.C.N.U.R.z?z [22:17] Culebra\Brillante
Tri.17831 Politicaɐrometeus˿C󭯃13lseullamarelasecretariolgeneraladelaA.C.N.U.R.z?z
[22:17] Culebra\Brillante 1 Pista: ****** ***** Valor pregunta : 23927 Puntos [22:17] Culebra\Brillante
1 Pista: ****** ***** Valor pregunta : 23927 Puntos
[22:17] Culebra\Brillante 2 Pista: sad*** ***** 30 segundos y 23927 Puntos [22:17] Culebra\Brillante
2 Pista: sad*** ***** 30 segundos y 23927 Puntos
[22:18] Culebra\Brillante 3 Pista: sada*o o*a*a 15 segundos y 23927 Puntos [22:18] Culebra\Brillante
3 Pista: sada*o o*a*a 15 segundos y 23927 Puntos
[22:18] Culebra\Brillante Tiempo! La respuesta es -> sadako�gata <- [22:18] Culebra\Brillante
Tiempo! La respuesta es -> sadako�gata <-
[22:18] Culebra\Brillante 23927 Puntos a adidos al BOTE, donde hay 403554 Puntos [22:18] Culebra\Brillante
23927 Puntos a adidos al BOTE, donde hay 403554 Puntos
[22:18] Culebra\Brillante Recuerda que est Trivia e GRATIS, por favor, no se queje [22:18] Culebra\Brillante
Recuerda que est Trivia e GRATIS, por favor, no se queje
[22:18] Culebra\Brillante Tri.10582 Literaturaɴjmm.com˿Contqu郱3xobrazobtuvofBuerofVallejofelxpremiofLopeddedVegazent1949?x?x [22:18] Culebra\Brillante
Tri.10582 Literaturaɴjmm.com˿Contqu郱3xobrazobtuvofBuerofVallejofelxpremiofLopeddedVegazent1949?x?x
[22:18] Culebra\Brillante 1 Pista: ******** ** *** ******** Valor pregunta : 16435 Puntos [22:18] Culebra\Brillante
1 Pista: ******** ** *** ******** Valor pregunta : 16435 Puntos
[22:18] Culebra\Brillante 2 Pista: his***** ** *** ******** 30 segundos y 16435 Puntos [22:18] Culebra\Brillante
2 Pista: his***** ** *** ******** 30 segundos y 16435 Puntos
[22:19] Culebra\Brillante 3 Pista: his*o*ia *e u*a e**a*e*a 15 segundos y 16435 Puntos [22:19] Culebra\Brillante
3 Pista: his*o*ia *e u*a e**a*e*a 15 segundos y 16435 Puntos
[22:19] Culebra\Brillante Tiempo! La respuesta es -> historia�e�na�scalera <- [22:19] Culebra\Brillante
Tiempo! La respuesta es -> historia�e�na�scalera <-
[22:19] Culebra\Brillante 16435 Puntos a adidos al BOTE, donde hay 419989 Puntos [22:19] Culebra\Brillante
16435 Puntos a adidos al BOTE, donde hay 419989 Puntos
[22:19] Culebra\Brillante This MONTHS Top 11-20: - #11: ChicodeGranada 738439 #12: Guiarte_Yo 619557 #13: BLaNKoN_PeR4eVeR 200000 #14: fff 173570 #15: Miriam_ 156310 #16: Cosmo 149640 #17: DanielPerez_ 116023 #18: elagujero 108090 #19: Alii 82683 #20: HeaLth_Rider 80860 [22:19] Culebra\Brillante
This MONTHS Top 11-20: - #11: ChicodeGranada 738439 #12: Guiarte_Yo 619557 #13: BLaNKoN_PeR4eVeR 200000 #14: fff 173570 #15: Miriam_ 156310 #16: Cosmo 149640 #17: DanielPerez_ 116023 #18: elagujero 108090 #19: Alii 82683 #20: HeaLth_Rider 80860
[22:19] Culebra\Brillante Tri.5872 CienciaɌOCUTUS˿C󭯃13bseyllamaaalecementobnaturale(calizaa+harcilla),hsinraditivos?h?h [22:19] Culebra\Brillante
Tri.5872 CienciaɌOCUTUS˿C󭯃13bseyllamaaalecementobnaturale(calizaa+harcilla),hsinraditivos?h?h
[22:19] Culebra\Brillante 1 Pista: ******* Valor pregunta : 19315 Puntos [22:19] Culebra\Brillante
1 Pista: ******* Valor pregunta : 19315 Puntos
[22:19] Culebra\Brillante 2 Pista: cli**** 30 segundos y 19315 Puntos [22:19] Culebra\Brillante
2 Pista: cli**** 30 segundos y 19315 Puntos
[22:19] Culebra\Brillante 3 Pista: cli**e* 15 segundos y 19315 Puntos [22:19] Culebra\Brillante
3 Pista: cli**e* 15 segundos y 19315 Puntos
[22:20] Culebra\Brillante Tiempo! La respuesta es -> clinker <- [22:20] Culebra\Brillante
Tiempo! La respuesta es -> clinker <-
[22:20] Culebra\Brillante 19315 Puntos a adidos al BOTE, donde hay 439304 Puntos [22:20] Culebra\Brillante
19315 Puntos a adidos al BOTE, donde hay 439304 Puntos
[22:20] Culebra\Brillante R᮫ing �ltima SEMANA: #1: CaracolSuave 52274936 #2: Paulus 12116637 #3: _Samantha_ 12018901 [22:20] Culebra\Brillante
R᮫ing �ltima SEMANA: #1: CaracolSuave 52274936 #2: Paulus 12116637 #3: _Samantha_ 12018901
[22:20] Culebra\Brillante Tri.4479 Arteɖivian˿Ensqu郱3vciudadhdewlosipaisesibajosisewprodujorlagrendici󮃱3spintadagportVelằuez?v?v [22:20] Culebra\Brillante
Tri.4479 Arteɖivian˿Ensqu郱3vciudadhdewlosipaisesibajosisewprodujorlagrendici󮃱3spintadagportVelằuez?v?v
[22:20] Culebra\Brillante 1 Pista: ***** Valor pregunta : 5907 Puntos [22:20] Culebra\Brillante
1 Pista: ***** Valor pregunta : 5907 Puntos
[22:20] Culebra\Brillante 2 Pista: bre** 30 segundos y 5907 Puntos [22:20] Culebra\Brillante
2 Pista: bre** 30 segundos y 5907 Puntos
[22:20] Culebra\Brillante 3 Pista: bre*a 15 segundos y 5907 Puntos [22:20] Culebra\Brillante
3 Pista: bre*a 15 segundos y 5907 Puntos
[22:21] Culebra\Brillante Tiempo! La respuesta es -> breda <- [22:21] Culebra\Brillante
Tiempo! La respuesta es -> breda <-
[22:21] Culebra\Brillante 5907 Puntos a adidos al BOTE, donde hay 445211 Puntos [22:21] Culebra\Brillante
5907 Puntos a adidos al BOTE, donde hay 445211 Puntos
[22:21] Culebra\Brillante Los jugadore Top10 (Semanal & Mensual) Tienen auto-Voice! [22:21] Culebra\Brillante
Los jugadore Top10 (Semanal & Mensual) Tienen auto-Voice!
[22:21] Culebra\Brillante Tri.19353 MusicaɁnghara˿Dehqui鮃13xeshelcLPt"Almostnheaven"t?t [22:21] Culebra\Brillante
Tri.19353 MusicaɁnghara˿Dehqui鮃13xeshelcLPt"Almostnheaven"t?t
[22:21] Culebra\Brillante 1 Pista: *** ***** ****** Valor pregunta : 19939 Puntos [22:21] Culebra\Brillante
1 Pista: *** ***** ****** Valor pregunta : 19939 Puntos
[22:21] Culebra\Brillante 2 Pista: the ***** ****** 30 segundos y 19939 Puntos [22:21] Culebra\Brillante
2 Pista: the ***** ****** 30 segundos y 19939 Puntos
[22:21] Culebra\Brillante 3 Pista: the *e*** *a*i** 15 segundos y 19939 Puntos [22:21] Culebra\Brillante
3 Pista: the *e*** *a*i** 15 segundos y 19939 Puntos
[22:21] CaracolSuave .radio [22:21] CaracolSuave
.radio
[22:21] CaballitoDeMar}Feliz « Radio Luna de Miel » DJ: Tigre\Real · Tema: Música variada · Peticiones: Cerradas · Canción: Paco de Lucía - Entre Dos Aguas (Remastered 2014) [22:21] CaballitoDeMar}Feliz
« Radio Luna de Miel » DJ: Tigre\Real · Tema: Música variada · Peticiones: Cerradas · Canción: Paco de Lucía - Entre Dos Aguas (Remastered 2014)
[22:22] Culebra\Brillante Tiempo! La respuesta es -> the�elly�amily <- [22:22] Culebra\Brillante
Tiempo! La respuesta es -> the�elly�amily <-
[22:22] Culebra\Brillante 19939 Puntos a adidos al BOTE, donde hay 465150 Puntos [22:22] Culebra\Brillante
19939 Puntos a adidos al BOTE, donde hay 465150 Puntos
[22:22] Culebra\Brillante Si detecta una pregunta o respuesta incorrecta, por favor, comun�elo a un OP de la sala [22:22] Culebra\Brillante
Si detecta una pregunta o respuesta incorrecta, por favor, comun�elo a un OP de la sala
[22:22] Culebra\Brillante Tri.6455 Arteɤassler˿C󭯃13jsecllamaslasformasdecplantasenhlasquecseccruzanhdosnnavesnsiendojunasm᳃13ncortasquecotra?u?u [22:22] Culebra\Brillante
Tri.6455 Arteɤassler˿C󭯃13jsecllamaslasformasdecplantasenhlasquecseccruzanhdosnnavesnsiendojunasm᳃13ncortasquecotra?u?u
[22:22] Culebra\Brillante 1 Pista: **** ****** Valor pregunta : 16716 Puntos [22:22] Culebra\Brillante
1 Pista: **** ****** Valor pregunta : 16716 Puntos
[22:22] Culebra\Brillante 2 Pista: cru* ****** 30 segundos y 16716 Puntos [22:22] Culebra\Brillante
2 Pista: cru* ****** 30 segundos y 16716 Puntos
[22:22] Culebra\Brillante 3 Pista: cru* *a*i*a 15 segundos y 16716 Puntos [22:22] Culebra\Brillante
3 Pista: cru* *a*i*a 15 segundos y 16716 Puntos
[22:22] Culebra\Brillante Tiempo! La respuesta es -> cruz�atina <- [22:22] Culebra\Brillante
Tiempo! La respuesta es -> cruz�atina <-
[22:22] Culebra\Brillante 16716 Puntos a adidos al BOTE, donde hay 481866 Puntos [22:22] Culebra\Brillante
16716 Puntos a adidos al BOTE, donde hay 481866 Puntos
[22:23] Culebra\Brillante R᮫ing SEMANA: - #1: CaracolSuave 34752061 #2: Paulus 8435839 #3: siva- 4607335 #4: LeCaTwaLk_z 2198600 #5: ChicodeGranada 244103 #6: Miriam_ 108988 #7: elagujero 108090 #8: Maryel_ 25000 #9: YasuoGr 23969 #10: Tigre_Marron 20136 [22:23] Culebra\Brillante
R᮫ing SEMANA: - #1: CaracolSuave 34752061 #2: Paulus 8435839 #3: siva- 4607335 #4: LeCaTwaLk_z 2198600 #5: ChicodeGranada 244103 #6: Miriam_ 108988 #7: elagujero 108090 #8: Maryel_ 25000 #9: YasuoGr 23969 #10: Tigre_Marron 20136
[22:23] Culebra\Brillante Tri.12886 LiteraturaɍARdeJAVAˑUɃ13iAUTORi(1562-1635)iESCRIBIӃ13iLAiNOVELAiPASTORILiENiPROSAi"iLAiARCADIA".i?i [22:23] Culebra\Brillante
Tri.12886 LiteraturaɍARdeJAVAˑUɃ13iAUTORi(1562-1635)iESCRIBIӃ13iLAiNOVELAiPASTORILiENiPROSAi"iLAiARCADIA".i?i
[22:23] Culebra\Brillante 1 Pista: **** ** **** Valor pregunta : 12298 Puntos [22:23] Culebra\Brillante
1 Pista: **** ** **** Valor pregunta : 12298 Puntos
[22:23] Culebra\Brillante 2 Pista: lop* ** **** 30 segundos y 12298 Puntos [22:23] Culebra\Brillante
2 Pista: lop* ** **** 30 segundos y 12298 Puntos
[22:23] Culebra\Brillante 3 Pista: lope *e *e*a 15 segundos y 12298 Puntos [22:23] Culebra\Brillante
3 Pista: lope *e *e*a 15 segundos y 12298 Puntos
[22:23] CaracolSuave lope de vega [22:23] CaracolSuave
lope de vega
[22:23] Culebra\Brillante �emuestra lo que sabes CaracolSuave! Has respondido "lope de vega" correctamente y eso te da: �2298�12 puntos [22:23] Culebra\Brillante
�emuestra lo que sabes CaracolSuave! Has respondido "lope de vega" correctamente y eso te da: �2298�12 puntos
[22:23] Culebra\Brillante CaracolSuave has acertado 21 seguidas!! Puntos HOY: 12096113, SEMANA: 34764359 y MES: 68959188 [22:23] Culebra\Brillante
CaracolSuave has acertado 21 seguidas!! Puntos HOY: 12096113, SEMANA: 34764359 y MES: 68959188
[22:23] Culebra\Brillante 21 in a Row !!! I Think that CaracolSuave is HOGGING the Quiz !!! Is Everybody Asleep!? [22:23] Culebra\Brillante
21 in a Row !!! I Think that CaracolSuave is HOGGING the Quiz !!! Is Everybody Asleep!?
[22:24] Culebra\Brillante Tenemos m᳠de 70.000 preguntas y respuestas!! [22:24] Culebra\Brillante
Tenemos m᳠de 70.000 preguntas y respuestas!!
[22:24] Culebra\Brillante Tri.20764 Idiomasɔruchi˿Enmingles,uxenofobiam?u [22:24] Culebra\Brillante
Tri.20764 Idiomasɔruchi˿Enmingles,uxenofobiam?u
[22:24] Culebra\Brillante 1 Pista: ********** Valor pregunta : 15643 Puntos [22:24] Culebra\Brillante
1 Pista: ********** Valor pregunta : 15643 Puntos
[22:24] Culebra\Brillante 2 Pista: xen******* 30 segundos y 15643 Puntos [22:24] Culebra\Brillante
2 Pista: xen******* 30 segundos y 15643 Puntos
[22:24] Culebra\Brillante 3 Pista: xeno**o*ia 15 segundos y 15643 Puntos [22:24] Culebra\Brillante
3 Pista: xeno**o*ia 15 segundos y 15643 Puntos
[22:24] Culebra\Brillante Tiempo! La respuesta es -> xenophobia <- [22:24] Culebra\Brillante
Tiempo! La respuesta es -> xenophobia <-
[22:24] Culebra\Brillante 15643 Puntos a adidos al BOTE, donde hay 497509 Puntos [22:24] Culebra\Brillante
15643 Puntos a adidos al BOTE, donde hay 497509 Puntos
[22:24] Culebra\Brillante Tri.6489 LiteraturaɁttica˿ComoisekllamahlahtetralogiahdekLawrencekDurrelycompuestahporsJustine,jMountolive,jLeahayvBalthazars?j [22:24] Culebra\Brillante
Tri.6489 LiteraturaɁttica˿ComoisekllamahlahtetralogiahdekLawrencekDurrelycompuestahporsJustine,jMountolive,jLeahayvBalthazars?j
[22:24] Culebra\Brillante 1 Pista: ******** ** ********** Pregunta de BONUS : 200000 Puntos [22:24] Culebra\Brillante
1 Pista: ******** ** ********** Pregunta de BONUS : 200000 Puntos
[22:25] Culebra\Brillante 2 Pista: cua***** ** ********** 30 segundos y 200000 Puntos [22:25] Culebra\Brillante
2 Pista: cua***** ** ********** 30 segundos y 200000 Puntos
[22:25] Culebra\Brillante 3 Pista: cua**e*o *e a*e*a***ia 15 segundos y 200000 Puntos [22:25] Culebra\Brillante
3 Pista: cua**e*o *e a*e*a***ia 15 segundos y 200000 Puntos
[22:25] Culebra\Brillante Tiempo! La respuesta es -> cuarteto�e�lejandria <- [22:25] Culebra\Brillante
Tiempo! La respuesta es -> cuarteto�e�lejandria <-
[22:25] Culebra\Brillante 200000 Puntos a adidos al BOTE, donde hay 697509 Puntos [22:25] Culebra\Brillante
200000 Puntos a adidos al BOTE, donde hay 697509 Puntos
[22:25] Culebra\Brillante Atenci󮠡 las preguntas MEGA BONUS de 500.000 y 1.000.000 de puntos [22:25] Culebra\Brillante
Atenci󮠡 las preguntas MEGA BONUS de 500.000 y 1.000.000 de puntos
[22:25] Culebra\Brillante Tri.18659 PersonajesɄassler˿Filosof�ߑu郱3jfil󳯦oqdijoq"Eleorgulloqdividexafloskhombres,jlafhumildadploskune"?j?j [22:25] Culebra\Brillante
Tri.18659 PersonajesɄassler˿Filosof�ߑu郱3jfil󳯦oqdijoq"Eleorgulloqdividexafloskhombres,jlafhumildadploskune"?j?j
[22:25] Culebra\Brillante 1 Pista: ******** Valor pregunta : 9513 Puntos [22:25] Culebra\Brillante
1 Pista: ******** Valor pregunta : 9513 Puntos
[22:26] Culebra\Brillante 2 Pista: soc***** 30 segundos y 9513 Puntos [22:26] Culebra\Brillante
2 Pista: soc***** 30 segundos y 9513 Puntos
[22:26] Culebra\Brillante 3 Pista: soc*a*e* 15 segundos y 9513 Puntos [22:26] Culebra\Brillante
3 Pista: soc*a*e* 15 segundos y 9513 Puntos
[22:26] Culebra\Brillante Tiempo! La respuesta es -> socrates <- [22:26] Culebra\Brillante
Tiempo! La respuesta es -> socrates <-
[22:26] Culebra\Brillante 9513 Puntos a adidos al BOTE, donde hay 707022 Puntos [22:26] Culebra\Brillante
9513 Puntos a adidos al BOTE, donde hay 707022 Puntos
[22:26] Culebra\Brillante Recuerda que est Trivia e GRATIS, por favor, no se queje [22:26] Culebra\Brillante
Recuerda que est Trivia e GRATIS, por favor, no se queje
[22:26] Culebra\Brillante Tri.9585 Eros-Sexɘavix˿Comousejllamamelsmiedoualsmatrimoniou?q [22:26] Culebra\Brillante
Tri.9585 Eros-Sexɘavix˿Comousejllamamelsmiedoualsmatrimoniou?q
[22:26] Culebra\Brillante 1 Pista: ********* Valor pregunta : 23460 Puntos [22:26] Culebra\Brillante
1 Pista: ********* Valor pregunta : 23460 Puntos
[22:27] Culebra\Brillante 2 Pista: gam****** 30 segundos y 23460 Puntos [22:27] Culebra\Brillante
2 Pista: gam****** 30 segundos y 23460 Puntos
[22:27] Culebra\Brillante 3 Pista: gamo*o*ia 15 segundos y 23460 Puntos [22:27] Culebra\Brillante
3 Pista: gamo*o*ia 15 segundos y 23460 Puntos
[22:27] Culebra\Brillante Tiempo! La respuesta es -> gamofobia <- [22:27] Culebra\Brillante
Tiempo! La respuesta es -> gamofobia <-
[22:27] Culebra\Brillante 23460 Puntos a adidos al BOTE, donde hay 730482 Puntos [22:27] Culebra\Brillante
23460 Puntos a adidos al BOTE, donde hay 730482 Puntos
[22:27] Culebra\Brillante Tri.8846 GastronomiaɁnghara˿Desd󮤥ssonct�casjlasjmigasj?r [22:27] Culebra\Brillante
Tri.8846 GastronomiaɁnghara˿Desd󮤥ssonct�casjlasjmigasj?r
[22:27] Culebra\Brillante 1 Pista: *********** Valor pregunta : 18253 Puntos [22:27] Culebra\Brillante
1 Pista: *********** Valor pregunta : 18253 Puntos
[22:27] Culebra\Brillante 2 Pista: ext******** 30 segundos y 18253 Puntos [22:27] Culebra\Brillante
2 Pista: ext******** 30 segundos y 18253 Puntos
[22:28] Culebra\Brillante 3 Pista: ext*e*a*u*a 15 segundos y 18253 Puntos [22:28] Culebra\Brillante
3 Pista: ext*e*a*u*a 15 segundos y 18253 Puntos
[22:28] Culebra\Brillante Tiempo! La respuesta es -> extremadura <- [22:28] Culebra\Brillante
Tiempo! La respuesta es -> extremadura <-
[22:28] Culebra\Brillante 18253 Puntos a adidos al BOTE, donde hay 748735 Puntos [22:28] Culebra\Brillante
18253 Puntos a adidos al BOTE, donde hay 748735 Puntos
[22:28] Culebra\Brillante Si desea agregar preguntas & respuestas a la BASE DE DATOS, por favor, comun�elo a un OP de la sala [22:28] Culebra\Brillante
Si desea agregar preguntas & respuestas a la BASE DE DATOS, por favor, comun�elo a un OP de la sala
[22:28] Culebra\Brillante Tri.11746 PoliticaɊAVEA˿3-3-1995wQUEwPERSONAJEwESPAяLwESwCONDENADOwAw1wAяSwYwMEDIOwDEwCARCELwPORwUSURPACIONwDEwFUNCIONESw?w [22:28] Culebra\Brillante
Tri.11746 PoliticaɊAVEA˿3-3-1995wQUEwPERSONAJEwESPAяLwESwCONDENADOwAw1wAяSwYwMEDIOwDEwCARCELwPORwUSURPACIONwDEwFUNCIONESw?w
[22:28] Culebra\Brillante 1 Pista: **** ****** Valor pregunta : 24896 Puntos [22:28] Culebra\Brillante
1 Pista: **** ****** Valor pregunta : 24896 Puntos
[22:28] Culebra\Brillante 2 Pista: jua* ****** 30 segundos y 24896 Puntos [22:28] Culebra\Brillante
2 Pista: jua* ****** 30 segundos y 24896 Puntos
[22:29] Culebra\Brillante 3 Pista: jua* *ue**a 15 segundos y 24896 Puntos [22:29] Culebra\Brillante
3 Pista: jua* *ue**a 15 segundos y 24896 Puntos
[22:29] Culebra\Brillante Tiempo! La respuesta es -> juan�uerra <- [22:29] Culebra\Brillante
Tiempo! La respuesta es -> juan�uerra <-
[22:29] Culebra\Brillante 24896 Puntos a adidos al BOTE, donde hay 773631 Puntos [22:29] Culebra\Brillante
24896 Puntos a adidos al BOTE, donde hay 773631 Puntos
[22:29] Culebra\Brillante R᮫ing por D́: - Domingo: Paulus 8435839 Lunes: CaracolSuave 6563878 Martes: CaracolSuave 8576491 Miercoles: CaracolSuave 7893517 Jueves: CaracolSuave 5997199 Viernes: CaracolSuave 3467306 Sᢡdo: Paulus 7947521 [22:29] Culebra\Brillante
R᮫ing por D́: - Domingo: Paulus 8435839 Lunes: CaracolSuave 6563878 Martes: CaracolSuave 8576491 Miercoles: CaracolSuave 7893517 Jueves: CaracolSuave 5997199 Viernes: CaracolSuave 3467306 Sᢡdo: Paulus 7947521
[22:29] Culebra\Brillante Tri.4048 Deporteə�l˿Enqqu郱3polimpiadascgan󃱳pJesseuOwensccuatroomedallascdeuoro?p?p [22:29] Culebra\Brillante
Tri.4048 Deporteə�l˿Enqqu郱3polimpiadascgan󃱳pJesseuOwensccuatroomedallascdeuoro?p?p
[22:29] Culebra\Brillante 1 Pista: ****** **** Valor pregunta : 5910 Puntos [22:29] Culebra\Brillante
1 Pista: ****** **** Valor pregunta : 5910 Puntos
[22:29] Culebra\Brillante 2 Pista: ber*** **** 30 segundos y 5910 Puntos [22:29] Culebra\Brillante
2 Pista: ber*** **** 30 segundos y 5910 Puntos
[22:30] Culebra\Brillante 3 Pista: ber*i* **** 15 segundos y 5910 Puntos [22:30] Culebra\Brillante
3 Pista: ber*i* **** 15 segundos y 5910 Puntos
[22:30] Culebra\Brillante Tiempo! La respuesta es -> berlin�936 <- [22:30] Culebra\Brillante
Tiempo! La respuesta es -> berlin�936 <-
[22:30] Culebra\Brillante 5910 Puntos a adidos al BOTE, donde hay 779541 Puntos [22:30] Culebra\Brillante
5910 Puntos a adidos al BOTE, donde hay 779541 Puntos
[22:30] Culebra\Brillante Para conocer los jugadores con mayores puntuaciones escriba... !top10 [22:30] Culebra\Brillante
Para conocer los jugadores con mayores puntuaciones escriba... !top10
[22:30] Culebra\Brillante Tri.16633 Eros-SexɁrzobispo˿Comoesexllamavalhartexdexfilmarpcuerposadesnudos,sydactosasexualesa?s [22:30] Culebra\Brillante
Tri.16633 Eros-SexɁrzobispo˿Comoesexllamavalhartexdexfilmarpcuerposadesnudos,sydactosasexualesa?s
[22:30] Culebra\Brillante 1 Pista: *********** Pregunta de BONUS : 200000 Puntos [22:30] Culebra\Brillante
1 Pista: *********** Pregunta de BONUS : 200000 Puntos
[22:30] CaballitoDeMar}Feliz ¦ Emitiendo ( Tigre\Real ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [22:30] CaballitoDeMar}Feliz
¦ Emitiendo ( Tigre\Real ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
[22:30] Culebra\Brillante 2 Pista: por******** 30 segundos y 200000 Puntos [22:30] Culebra\Brillante
2 Pista: por******** 30 segundos y 200000 Puntos
[22:30] Culebra\Brillante 3 Pista: por*o**a*ia 15 segundos y 200000 Puntos [22:30] Culebra\Brillante
3 Pista: por*o**a*ia 15 segundos y 200000 Puntos
[22:31] Culebra\Brillante Tiempo! La respuesta es -> pornografia <- [22:31] Culebra\Brillante
Tiempo! La respuesta es -> pornografia <-
[22:31] Culebra\Brillante 200000 Puntos a adidos al BOTE, donde hay 979541 Puntos [22:31] Culebra\Brillante
200000 Puntos a adidos al BOTE, donde hay 979541 Puntos
[22:31] Culebra\Brillante Tri.16003 Cineɭartuniki˿ACTORpPROTAGONISTApDEpELpBUSCAVIDASp?p [22:31] Culebra\Brillante
Tri.16003 Cineɭartuniki˿ACTORpPROTAGONISTApDEpELpBUSCAVIDASp?p
[22:31] Culebra\Brillante 1 Pista: **** ****** Valor pregunta : 19005 Puntos [22:31] Culebra\Brillante
1 Pista: **** ****** Valor pregunta : 19005 Puntos
[22:31] Culebra\Brillante 2 Pista: pau* ****** 30 segundos y 19005 Puntos [22:31] Culebra\Brillante
2 Pista: pau* ****** 30 segundos y 19005 Puntos
[22:31] Culebra\Brillante 3 Pista: pau* *e**a* 15 segundos y 19005 Puntos [22:31] Culebra\Brillante
3 Pista: pau* *e**a* 15 segundos y 19005 Puntos
[22:32] Culebra\Brillante Tiempo! La respuesta es -> paul�ewman <- [22:32] Culebra\Brillante
Tiempo! La respuesta es -> paul�ewman <-
[22:32] Culebra\Brillante 19005 Puntos a adidos al BOTE, donde hay 998546 Puntos [22:32] Culebra\Brillante
19005 Puntos a adidos al BOTE, donde hay 998546 Puntos
[22:32] Culebra\Brillante Atenci󮠡 las preguntas BONUS de 25.000 y 100.000 puntos!!! [22:32] Culebra\Brillante
Atenci󮠡 las preguntas BONUS de 25.000 y 100.000 puntos!!!
[22:32] Culebra\Brillante Tri.1457 HistoriaɊAVEA˿29-NOVIEMBRE-1905:lQUIENlPRESIDElELlNUEVOlGOBIERNOlESPAяLl(APELLIDO)l?l [22:32] Culebra\Brillante
Tri.1457 HistoriaɊAVEA˿29-NOVIEMBRE-1905:lQUIENlPRESIDElELlNUEVOlGOBIERNOlESPAяLl(APELLIDO)l?l
[22:32] Culebra\Brillante 1 Pista: ***** Valor pregunta : 19237 Puntos [22:32] Culebra\Brillante
1 Pista: ***** Valor pregunta : 19237 Puntos
[22:32] Culebra\Brillante 2 Pista: MOR** 30 segundos y 19237 Puntos [22:32] Culebra\Brillante
2 Pista: MOR** 30 segundos y 19237 Puntos
[22:32] Culebra\Brillante 3 Pista: MORE* 15 segundos y 19237 Puntos [22:32] Culebra\Brillante
3 Pista: MORE* 15 segundos y 19237 Puntos
[22:33] Culebra\Brillante Tiempo! La respuesta es -> MORET <- [22:33] Culebra\Brillante
Tiempo! La respuesta es -> MORET <-
[22:33] Culebra\Brillante 19237 Puntos a adidos al BOTE, donde hay 1017783 Puntos [22:33] Culebra\Brillante
19237 Puntos a adidos al BOTE, donde hay 1017783 Puntos
[22:33] Culebra\Brillante Tri.201 Cienciaɂatval˿CUANTOtTARDAtNEPTUNOtENtDARtLAtVUELTAtALtSOLt(ENtNUMERO)t?t [22:33] Culebra\Brillante
Tri.201 Cienciaɂatval˿CUANTOtTARDAtNEPTUNOtENtDARtLAtVUELTAtALtSOLt(ENtNUMERO)t?t
[22:33] Culebra\Brillante 1 Pista: *** *񪪠 Valor pregunta : 5897 Puntos [22:33] Culebra\Brillante
1 Pista: *** *񪪠 Valor pregunta : 5897 Puntos
[22:33] Culebra\Brillante 2 Pista: 165 *񪪠 30 segundos y 5897 Puntos [22:33] Culebra\Brillante
2 Pista: 165 *񪪠 30 segundos y 5897 Puntos
[22:33] Culebra\Brillante 3 Pista: 165 a񯪠 15 segundos y 5897 Puntos [22:33] Culebra\Brillante
3 Pista: 165 a񯪠 15 segundos y 5897 Puntos
[22:33] Culebra\Brillante Tiempo! La respuesta es -> 165�񯳠 <- [22:33] Culebra\Brillante
Tiempo! La respuesta es -> 165�񯳠 <-
[22:33] Culebra\Brillante 5897 Puntos a adidos al BOTE, donde hay 1023680 Puntos [22:33] Culebra\Brillante
5897 Puntos a adidos al BOTE, donde hay 1023680 Puntos
[22:34] Culebra\Brillante Por favor, se agradece la correcci󮠥n su lenguaje [22:34] Culebra\Brillante
Por favor, se agradece la correcci󮠥n su lenguaje
[22:34] Culebra\Brillante Tri.1126 InformaticaɃHARCO˿APARATOxADOSADOxAxLAxC.P.U.xQUExEVITAxLOSxRECALENTONESx?x [22:34] Culebra\Brillante
Tri.1126 InformaticaɃHARCO˿APARATOxADOSADOxAxLAxC.P.U.xQUExEVITAxLOSxRECALENTONESx?x
[22:34] Culebra\Brillante 1 Pista: ********* Valor pregunta : 15694 Puntos [22:34] Culebra\Brillante
1 Pista: ********* Valor pregunta : 15694 Puntos
[22:34] Culebra\Brillante 2 Pista: Dis****** 30 segundos y 15694 Puntos [22:34] Culebra\Brillante
2 Pista: Dis****** 30 segundos y 15694 Puntos
[22:34] Culebra\Brillante 3 Pista: Disi*a*o* 15 segundos y 15694 Puntos [22:34] Culebra\Brillante
3 Pista: Disi*a*o* 15 segundos y 15694 Puntos
[22:34] Culebra\Brillante Tiempo! La respuesta es -> Disipador <- [22:34] Culebra\Brillante
Tiempo! La respuesta es -> Disipador <-
[22:34] Culebra\Brillante 15694 Puntos a adidos al BOTE, donde hay 1039374 Puntos [22:34] Culebra\Brillante
15694 Puntos a adidos al BOTE, donde hay 1039374 Puntos
[22:35] Culebra\Brillante This is #Mexico, I am your host Culebra\Brillante, running Culebra\Brillante [22:35] Culebra\Brillante
This is #Mexico, I am your host Culebra\Brillante, running Culebra\Brillante
[22:35] Culebra\Brillante Tri.6504 DeporteɁcuarios˿(NATACION)CUANTOSoLARGOSoDEoPISCINAoSEoHACEoUNoNADADORoENoUNAoCARRERAoDEo200oMETROSo?o [22:35] Culebra\Brillante
Tri.6504 DeporteɁcuarios˿(NATACION)CUANTOSoLARGOSoDEoPISCINAoSEoHACEoUNoNADADORoENoUNAoCARRERAoDEo200oMETROSo?o
[22:35] Culebra\Brillante 1 Pista: ****** Valor pregunta : 5634 Puntos [22:35] Culebra\Brillante
1 Pista: ****** Valor pregunta : 5634 Puntos
[22:35] Culebra\Brillante 2 Pista: cua*** 30 segundos y 5634 Puntos [22:35] Culebra\Brillante
2 Pista: cua*** 30 segundos y 5634 Puntos
[22:35] Culebra\Brillante 3 Pista: cua**o 15 segundos y 5634 Puntos [22:35] Culebra\Brillante
3 Pista: cua**o 15 segundos y 5634 Puntos
[22:35] Culebra\Brillante Tiempo! La respuesta es -> cuatro <- [22:35] Culebra\Brillante
Tiempo! La respuesta es -> cuatro <-
[22:35] Culebra\Brillante 5634 Puntos a adidos al BOTE, donde hay 1045008 Puntos [22:35] Culebra\Brillante
5634 Puntos a adidos al BOTE, donde hay 1045008 Puntos
[22:36] Culebra\Brillante This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [22:36] Culebra\Brillante
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[22:36] Culebra\Brillante Tri.20379 MitologiaɎAPINE˿DIOSAcGRIEGAcMADREcDEcLAcJUSTICIAcYcLAcVIRTUDc?c [22:36] Culebra\Brillante
Tri.20379 MitologiaɎAPINE˿DIOSAcGRIEGAcMADREcDEcLAcJUSTICIAcYcLAcVIRTUDc?c
[22:36] Culebra\Brillante 1 Pista: ****** Valor pregunta : 14547 Puntos [22:36] Culebra\Brillante
1 Pista: ****** Valor pregunta : 14547 Puntos
[22:36] Culebra\Brillante 2 Pista: ver*** 30 segundos y 14547 Puntos [22:36] Culebra\Brillante
2 Pista: ver*** 30 segundos y 14547 Puntos
[22:36] Culebra\Brillante 3 Pista: ver*a* 15 segundos y 14547 Puntos [22:36] Culebra\Brillante
3 Pista: ver*a* 15 segundos y 14547 Puntos
[22:36] Culebra\Brillante Tiempo! La respuesta es -> verdad <- [22:36] Culebra\Brillante
Tiempo! La respuesta es -> verdad <-
[22:36] Culebra\Brillante 14547 Puntos a adidos al BOTE, donde hay 1059555 Puntos [22:36] Culebra\Brillante
14547 Puntos a adidos al BOTE, donde hay 1059555 Puntos
[22:36] Culebra\Brillante Recuerda que est Trivia e GRATIS, por favor, no se queje [22:36] Culebra\Brillante
Recuerda que est Trivia e GRATIS, por favor, no se queje
[22:36] Culebra\Brillante Tri.17674 LiteraturaɔeLaRaNhA˿Autorxdek"barriotdekmaravillas"s?s [22:36] Culebra\Brillante
Tri.17674 LiteraturaɔeLaRaNhA˿Autorxdek"barriotdekmaravillas"s?s
[22:36] Culebra\Brillante 1 Pista: **** ****** Valor pregunta : 12340 Puntos [22:36] Culebra\Brillante
1 Pista: **** ****** Valor pregunta : 12340 Puntos
[22:37] Culebra\Brillante 2 Pista: ros* ****** 30 segundos y 12340 Puntos [22:37] Culebra\Brillante
2 Pista: ros* ****** 30 segundos y 12340 Puntos
[22:37] Culebra\Brillante 3 Pista: rosa **a*e* 15 segundos y 12340 Puntos [22:37] Culebra\Brillante
3 Pista: rosa **a*e* 15 segundos y 12340 Puntos
[22:37] Culebra\Brillante Tiempo! La respuesta es -> rosa�hacel <- [22:37] Culebra\Brillante
Tiempo! La respuesta es -> rosa�hacel <-
[22:37] Culebra\Brillante 12340 Puntos a adidos al BOTE, donde hay 1071895 Puntos [22:37] Culebra\Brillante
12340 Puntos a adidos al BOTE, donde hay 1071895 Puntos
[22:37] Culebra\Brillante This MONTHS Top 11-20: - #11: ChicodeGranada 738439 #12: Guiarte_Yo 619557 #13: BLaNKoN_PeR4eVeR 200000 #14: fff 173570 #15: Miriam_ 156310 #16: Cosmo 149640 #17: DanielPerez_ 116023 #18: elagujero 108090 #19: Alii 82683 #20: HeaLth_Rider 80860 [22:37] Culebra\Brillante
This MONTHS Top 11-20: - #11: ChicodeGranada 738439 #12: Guiarte_Yo 619557 #13: BLaNKoN_PeR4eVeR 200000 #14: fff 173570 #15: Miriam_ 156310 #16: Cosmo 149640 #17: DanielPerez_ 116023 #18: elagujero 108090 #19: Alii 82683 #20: HeaLth_Rider 80860
[22:37] Culebra\Brillante Tri.20001 Politicaɴarra˿Conhquejconocidasppalabraspempiezaselbmanifiestoncomunista?n?n [22:37] Culebra\Brillante
Tri.20001 Politicaɴarra˿Conhquejconocidasppalabraspempiezaselbmanifiestoncomunista?n?n
[22:37] Culebra\Brillante 1 Pista: ** ******** ***** *** ****** Valor pregunta : 15333 Puntos [22:37] Culebra\Brillante
1 Pista: ** ******** ***** *** ****** Valor pregunta : 15333 Puntos
[22:38] Culebra\Brillante 2 Pista: un�******* ***** *** ****** 30 segundos y 15333 Puntos [22:38] Culebra\Brillante
2 Pista: un�******* ***** *** ****** 30 segundos y 15333 Puntos
[22:38] Culebra\Brillante 3 Pista: un�**e***o *o**a *o* eu*o*a 15 segundos y 15333 Puntos [22:38] Culebra\Brillante
3 Pista: un�**e***o *o**a *o* eu*o*a 15 segundos y 15333 Puntos
[22:38] Culebra\Brillante Tiempo! La respuesta es -> un�spectro�onda�or�uropa <- [22:38] Culebra\Brillante
Tiempo! La respuesta es -> un�spectro�onda�or�uropa <-
[22:38] Culebra\Brillante 15333 Puntos a adidos al BOTE, donde hay 1087228 Puntos [22:38] Culebra\Brillante
15333 Puntos a adidos al BOTE, donde hay 1087228 Puntos
[22:38] Culebra\Brillante R᮫ing �ltima SEMANA: #1: CaracolSuave 52274936 #2: Paulus 12116637 #3: _Samantha_ 12018901 [22:38] Culebra\Brillante
R᮫ing �ltima SEMANA: #1: CaracolSuave 52274936 #2: Paulus 12116637 #3: _Samantha_ 12018901
[22:38] Culebra\Brillante Tri.8455 Cineɔronch˿Cualrfuehlagultimagpeliculagennlagquehintervinoeriverkphoenix?z?z [22:38] Culebra\Brillante
Tri.8455 Cineɔronch˿Cualrfuehlagultimagpeliculagennlagquehintervinoeriverkphoenix?z?z
[22:38] Culebra\Brillante 1 Pista: *** **** ******* **** Valor pregunta : 7261 Puntos [22:38] Culebra\Brillante
1 Pista: *** **** ******* **** Valor pregunta : 7261 Puntos
[22:39] Culebra\Brillante 2 Pista: esa **** ******* **** 30 segundos y 7261 Puntos [22:39] Culebra\Brillante
2 Pista: esa **** ******* **** 30 segundos y 7261 Puntos
[22:39] Culebra\Brillante 3 Pista: esa *o*a **a*a*a a*o* 15 segundos y 7261 Puntos [22:39] Culebra\Brillante
3 Pista: esa *o*a **a*a*a a*o* 15 segundos y 7261 Puntos
[22:39] Culebra\Brillante Tiempo! La respuesta es -> esa�osa�lamada�mor <- [22:39] Culebra\Brillante
Tiempo! La respuesta es -> esa�osa�lamada�mor <-
[22:39] Culebra\Brillante 7261 Puntos a adidos al BOTE, donde hay 1094489 Puntos [22:39] Culebra\Brillante
7261 Puntos a adidos al BOTE, donde hay 1094489 Puntos
[22:39] Culebra\Brillante Los jugadore Top10 (Semanal & Mensual) Tienen auto-Voice! [22:39] Culebra\Brillante
Los jugadore Top10 (Semanal & Mensual) Tienen auto-Voice!
[22:39] Culebra\Brillante Tri.17980 Deporteɔ1000˿EniqueyciudadkestahelyhipodromoodeyLasartey?i [22:39] Culebra\Brillante
Tri.17980 Deporteɔ1000˿EniqueyciudadkestahelyhipodromoodeyLasartey?i
[22:39] Culebra\Brillante 1 Pista: *** ********* Valor pregunta : 18858 Puntos [22:39] Culebra\Brillante
1 Pista: *** ********* Valor pregunta : 18858 Puntos
[22:39] Culebra\Brillante 2 Pista: san ********* 30 segundos y 18858 Puntos [22:39] Culebra\Brillante
2 Pista: san ********* 30 segundos y 18858 Puntos
[22:40] Culebra\Brillante 3 Pista: san *e*a**ia* 15 segundos y 18858 Puntos [22:40] Culebra\Brillante
3 Pista: san *e*a**ia* 15 segundos y 18858 Puntos
[22:40] Culebra\Brillante Tiempo! La respuesta es -> san�ebastian <- [22:40] Culebra\Brillante
Tiempo! La respuesta es -> san�ebastian <-
[22:40] Culebra\Brillante 18858 Puntos a adidos al BOTE, donde hay 1113347 Puntos [22:40] Culebra\Brillante
18858 Puntos a adidos al BOTE, donde hay 1113347 Puntos
[22:40] Culebra\Brillante Si detecta una pregunta o respuesta incorrecta, por favor, comun�elo a un OP de la sala [22:40] Culebra\Brillante
Si detecta una pregunta o respuesta incorrecta, por favor, comun�elo a un OP de la sala
[22:40] Culebra\Brillante Tri.18867 Cotilleo-TVɓESINO˿(ThehSimpsons)g߄ondehesconehmargehelzbotehdelzdinerozparamnavidadd?g [22:40] Culebra\Brillante
Tri.18867 Cotilleo-TVɓESINO˿(ThehSimpsons)g߄ondehesconehmargehelzbotehdelzdinerozparamnavidadd?g
[22:40] Culebra\Brillante 1 Pista: ** **** Valor pregunta : 11720 Puntos [22:40] Culebra\Brillante
1 Pista: ** **** Valor pregunta : 11720 Puntos
[22:40] Culebra\Brillante 2 Pista: su�*** 30 segundos y 11720 Puntos [22:40] Culebra\Brillante
2 Pista: su�*** 30 segundos y 11720 Puntos
[22:41] Culebra\Brillante 3 Pista: su�e*o 15 segundos y 11720 Puntos [22:41] Culebra\Brillante
3 Pista: su�e*o 15 segundos y 11720 Puntos
[22:41] Culebra\Brillante Tiempo! La respuesta es -> su�elo <- [22:41] Culebra\Brillante
Tiempo! La respuesta es -> su�elo <-
[22:41] Culebra\Brillante 11720 Puntos a adidos al BOTE, donde hay 1125067 Puntos [22:41] Culebra\Brillante
11720 Puntos a adidos al BOTE, donde hay 1125067 Puntos
[22:41] Culebra\Brillante R᮫ing SEMANA: - #1: CaracolSuave 34764359 #2: Paulus 8435839 #3: siva- 4607335 #4: LeCaTwaLk_z 2198600 #5: ChicodeGranada 244103 #6: Miriam_ 108988 #7: elagujero 108090 #8: Maryel_ 25000 #9: YasuoGr 23969 #10: Tigre_Marron 20136 [22:41] Culebra\Brillante
R᮫ing SEMANA: - #1: CaracolSuave 34764359 #2: Paulus 8435839 #3: siva- 4607335 #4: LeCaTwaLk_z 2198600 #5: ChicodeGranada 244103 #6: Miriam_ 108988 #7: elagujero 108090 #8: Maryel_ 25000 #9: YasuoGr 23969 #10: Tigre_Marron 20136
[22:41] Culebra\Brillante Tri.15365 Politicaɭ˿EnnlapGreciapClᳩca,elvpoderzdelvgobiernoedetentadoeporzunngrupoereducidoedeeindividuosxseellamap?h [22:41] Culebra\Brillante
Tri.15365 Politicaɭ˿EnnlapGreciapClᳩca,elvpoderzdelvgobiernoedetentadoeporzunngrupoereducidoedeeindividuosxseellamap?h
[22:41] Culebra\Brillante 1 Pista: ********** Pregunta de BONUS : 50000 Puntos [22:41] Culebra\Brillante
1 Pista: ********** Pregunta de BONUS : 50000 Puntos
[22:41] Culebra\Brillante 2 Pista: oli******* 30 segundos y 50000 Puntos [22:41] Culebra\Brillante
2 Pista: oli******* 30 segundos y 50000 Puntos
[22:42] Culebra\Brillante 3 Pista: oli*a**uia 15 segundos y 50000 Puntos [22:42] Culebra\Brillante
3 Pista: oli*a**uia 15 segundos y 50000 Puntos
[22:42] Culebra\Brillante Tiempo! La respuesta es -> oligarquia <- [22:42] Culebra\Brillante
Tiempo! La respuesta es -> oligarquia <-
[22:42] Culebra\Brillante 50000 Puntos a adidos al BOTE, donde hay 1175067 Puntos [22:42] Culebra\Brillante
50000 Puntos a adidos al BOTE, donde hay 1175067 Puntos
[22:42] Culebra\Brillante Tenemos m᳠de 70.000 preguntas y respuestas!! [22:42] Culebra\Brillante
Tenemos m᳠de 70.000 preguntas y respuestas!!
[22:42] Culebra\Brillante Tri.9978 HistoriaɍARdeJAVA˄OMINGO,b2bDEbSEPTIEMBREbDEb1666;bENbLAbPANADEŔbKINGbESTALLAbUNAbDEbLASbCAT�TROFESbM�bDEVASTADORASbQUEbHAbSUFRIDObLAbCIUDADbDEbLONDRESbENbTODAbSUbHISTORIA.b߁bQUɃ13bNOSbREFERIMOS?b?b [22:42] Culebra\Brillante
Tri.9978 HistoriaɍARdeJAVA˄OMINGO,b2bDEbSEPTIEMBREbDEb1666;bENbLAbPANADEŔbKINGbESTALLAbUNAbDEbLASbCAT�TROFESbM�bDEVASTADORASbQUEbHAbSUFRIDObLAbCIUDADbDEbLONDRESbENbTODAbSUbHISTORIA.b߁bQUɃ13bNOSbREFERIMOS?b?b
[22:42] Culebra\Brillante 1 Pista: **** ******** ** ******* Valor pregunta : 24523 Puntos [22:42] Culebra\Brillante
1 Pista: **** ******** ** ******* Valor pregunta : 24523 Puntos
[22:42] Culebra\Brillante 2 Pista: gra* ******** ** ******* 30 segundos y 24523 Puntos [22:42] Culebra\Brillante
2 Pista: gra* ******** ** ******* 30 segundos y 24523 Puntos
[22:42] Culebra\Brillante 3 Pista: gra* i**e**io *e *o***e* 15 segundos y 24523 Puntos [22:42] Culebra\Brillante
3 Pista: gra* i**e**io *e *o***e* 15 segundos y 24523 Puntos
[22:43] Culebra\Brillante Tiempo! La respuesta es -> gran�ncendio�e�ondres <- [22:43] Culebra\Brillante
Tiempo! La respuesta es -> gran�ncendio�e�ondres <-
[22:43] Culebra\Brillante 24523 Puntos a adidos al BOTE, donde hay 1199590 Puntos [22:43] Culebra\Brillante
24523 Puntos a adidos al BOTE, donde hay 1199590 Puntos
[22:43] Culebra\Brillante Tri.632 InformaticaɌucky_LuK˿CUALdESdLAdLONGITUDdMAXIMAdENdCARACTERESdDELdNOMBREdDEdUNAdVARIABLEdENdVISUALdBASICd?d [22:43] Culebra\Brillante
Tri.632 InformaticaɌucky_LuK˿CUALdESdLAdLONGITUDdMAXIMAdENdCARACTERESdDELdNOMBREdDEdUNAdVARIABLEdENdVISUALdBASICd?d
[22:43] Culebra\Brillante 1 Pista: ** Valor pregunta : 7773 Puntos [22:43] Culebra\Brillante
1 Pista: ** Valor pregunta : 7773 Puntos
[22:43] Culebra\Brillante 2 Pista: 40 30 segundos y 7773 Puntos [22:43] Culebra\Brillante
2 Pista: 40 30 segundos y 7773 Puntos
[22:43] Culebra\Brillante 3 Pista: 40 15 segundos y 7773 Puntos [22:43] Culebra\Brillante
3 Pista: 40 15 segundos y 7773 Puntos
[22:44] Culebra\Brillante Tiempo! La respuesta es -> 40 <- [22:44] Culebra\Brillante
Tiempo! La respuesta es -> 40 <-
[22:44] Culebra\Brillante 7773 Puntos a adidos al BOTE, donde hay 1207363 Puntos [22:44] Culebra\Brillante
7773 Puntos a adidos al BOTE, donde hay 1207363 Puntos
[22:44] Culebra\Brillante Atenci󮠡 las preguntas MEGA BONUS de 500.000 y 1.000.000 de puntos [22:44] Culebra\Brillante
Atenci󮠡 las preguntas MEGA BONUS de 500.000 y 1.000.000 de puntos
[22:44] Culebra\Brillante Tri.14273 CineɄonNadie˅nyelya񯃱3o2054lTomdCruiseresiunypolic�13zquerevitazcr�nesiantesiderquerocurran,lperoolertiendenyunaztrampa.l?l [22:44] Culebra\Brillante
Tri.14273 CineɄonNadie˅nyelya񯃱3o2054lTomdCruiseresiunypolic�13zquerevitazcr�nesiantesiderquerocurran,lperoolertiendenyunaztrampa.l?l
[22:44] Culebra\Brillante 1 Pista: ******** ****** Valor pregunta : 19308 Puntos [22:44] Culebra\Brillante
1 Pista: ******** ****** Valor pregunta : 19308 Puntos
[22:44] Culebra\Brillante 2 Pista: min***** ****** 30 segundos y 19308 Puntos [22:44] Culebra\Brillante
2 Pista: min***** ****** 30 segundos y 19308 Puntos
[22:44] Culebra\Brillante 3 Pista: mino*i** *e*o** 15 segundos y 19308 Puntos [22:44] Culebra\Brillante
3 Pista: mino*i** *e*o** 15 segundos y 19308 Puntos
[22:45] Culebra\Brillante Tiempo! La respuesta es -> minority�eport <- [22:45] Culebra\Brillante
Tiempo! La respuesta es -> minority�eport <-
[22:45] Culebra\Brillante 19308 Puntos a adidos al BOTE, donde hay 1226671 Puntos [22:45] Culebra\Brillante
19308 Puntos a adidos al BOTE, donde hay 1226671 Puntos
[22:45] Culebra\Brillante Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar [22:45] Culebra\Brillante
Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar
[22:45] CaballitoDeMar}Feliz ¦ Emitiendo ( Tigre\Real ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas [22:45] CaballitoDeMar}Feliz
¦ Emitiendo ( Tigre\Real ) | Lugar ( RLDM ) | Temática ( Música variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: Cerradas
| Compartir en: